Loading...
*  UTJECAJ SUMPOROVODIKA (H2S) NA VIGOR SJEMENA KRASTAVCA (Cucumis sativus L.) U UVJETIMA SOLNOG STRESA | Croatian Digital Theses...
In our study cucumber seed (Cucumis sativus L.) from three different production years was osmoprimed with 300 μM solutions of ... U našem istraživanju je sjeme krastavca (Cucumis sativus L.) iz tri proizvodne godine, osmoprimirano s 300 μM otopinama dva ... INFLUENCE OF HYDROGEN SULFIDE (H2S) ON CUCUMBER (Cucumis sativus L.) SEED VIGOR IN SALT STRESS CONDITIONS. ... INFLUENCE OF HYDROGEN SULFIDE (H2S) ON CUCUMBER (Cucumis sativus L.) SEED VIGOR IN SALT STRESS CONDITIONS ...
https://zir.nsk.hr/en/islandora/object/pfos%3A263
*  Cucurbita legal definition of Cucurbita
Cucumis sativus, Cucurbita pepo, Glycine max, Lycopersicon esculentum, Nicotiana glutinosa, N.. Molecular identification of a ... The order Violales contains many economically important plants [Begonia, Carica papaya, Citrullus, Cucumis, Cucurbita, ...
https://legal-dictionary.thefreedictionary.com/Cucurbita
*  Labanos / Raphanus sativus / radish: Philippine Medicinal Herbs / Philippine Alternative Medicine
Raphanus sativus: Philippine Medicinal Plants - An illustrated compilation of Philippine medicinal herbs by Dr Godofredo Stuart ... PHYSICO-CHEMICAL STUDIES OF INDIGENOUS DIURETIC MEDICINAL PLANTS Citrullus vulgaris Schrad, Cucumis melo Linn, Cymbopogon ... Raphanus sativus L. is a synonym of Raphanus raphanistrum subsp. sativus (L.) Domin. The Plant List. ... Results showed R. sativus leaf extract increase the cardiotoxicity alone and in ISO treated rats. Effect could be due to the ...
http://www.stuartxchange.com/Labanos
*  KEGG GENOME: Cucumis sativus (cucumber)
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; ...
https://www.genome.jp/kegg-bin/show_organism?org=csv
*  Map of Cucumis sativus -- Discover Life
... identification and distribution of Map of Cucumis sativus -- Discover Life ... Cucumis sativus @ American Museum of Natural History, Bee Specimen Record (1); Bernice P. Bishop Museum, Thematic Collection ...
http://www.discoverlife.org/mp/20m?kind=Cucumis+sativus
*  Cucumis sativus Cucumber, Garden cucumber PFAF Plant Database
Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ... Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ...
https://pfaf.org/user/Plant.aspx?LatinName=Cucumis+sativus
*  Cucumis sativus ( Jazzer Cucumber ) | Backyard Gardener
'Jazzer' has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
https://www.backyardgardener.com/plantname/cucumis-sativus-jazzer-cucumber/
*  CUM10 - CUM10 - Cucumis sativus (Cucumber) - CUM10 gene & protein
Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... Camelina sativa (False flax) (Myagrum sativum). Brassica napus (Rape). Capsella bursa-pastoris (Shepherd's purse) (Thlaspi ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
http://www.uniprot.org/uniprot/O64959
*  Photo of Cucumber (Cucumis sativus 'Straight Eight'): crab spider - Garden.org
Thread by robertduval14: forgot to put this in the photo description...but a close look at the lower left petal will reveal a small and well camouflaged c...
https://garden.org/thread/view/15712/crab-spider/
*  PPT - Cucumber Cucumis sativus PowerPoint presentation | free to view - id: 1577d4-YjdhO
Cucumis sativus) - Cucumber (Cucumis sativus) Introduction Both cucumbers and melons are members of the same genus: Cucumis ... Cucumber Cucumis sativus. 1. Cucumber (Cucumis sativus)*Introduction *Both cucumbers and melons are members of the same genus ... Cucumis Sativus L. - Cucumis Sativus L. Nick Lorenz May 1, 2006 Phylogeny Interesting Facts Cucumbers originated in India where ... Cucumber Cucumis sativus. Description:. Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ...
http://www.powershow.com/view/1577d4-YjdhO/Cucumber_Cucumis_sativus_powerpoint_ppt_presentation
*  PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L.)
Knowing the extent and structure of genetic variation in germplasm collections is essential for the conservation and utilization of biodiversity in cultivated plants. Cucumber is the fourth most important vegetable crop worldwide and is a model system for other Cucurbitaceae, a family that also includes melon, watermelon, pumpkin and squash. Previous isozyme studies revealed a low genetic diversity in cucumber, but detailed insights into the crop's genetic structure and diversity are largely missing. We have fingerprinted 3,342 accessions from the Chinese, Dutch and U.S. cucumber collections with 23 highly polymorphic Simple Sequence Repeat (SSR) markers evenly distributed in the genome. The data reveal three distinct populations, largely corresponding to three geographic regions. Population 1 corresponds to germplasm from China, except for the unique semi-wild landraces found in Xishuangbanna in Southwest China and East Asia; population 2 to Europe, America, and Central and West Asia; and population 3
http://journals.plos.org/plosone/article/email?id=10.1371/journal.pone.0046919
*  Identification and transcriptional analysis of dehydrin gene family in cucumber ( Cucumis sativus) | Springer for Research &...
Huang S, Li R, Zhang Z, Li L, Gu X, Fan W et al (2009) The genome of the cucumber, Cucumis sativus L. Nat Genet 41:1275-1281 ... Zhou Y, Hu L, Jiang L, Liu H, Liu S (2017b) Molecular cloning and characterization of an ASR gene from Cucumis sativus. Plant ... Cucumis sativus), enhances tolerance to heat and cold in Escherichia coli. AMB Express 7:182CrossRefPubMedPubMedCentralGoogle ... Identification and transcriptional analysis of dehydrin gene family in cucumber (Cucumis sativus). ...
https://rd.springer.com/article/10.1007%2Fs11738-018-2715-7
*  The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls - ePrints Soton
Morrell, Clare Katrina (1987) The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls. University of ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ...
https://eprints.soton.ac.uk/393998/
*  Frontiers | Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress |...
Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress. Xingwang Liu1,2† ... Citation: Liu X, Liu B, Xue S, Cai Y, Qi W, Jian C, Xu S, Wang T and Ren H (2016) Cucumber (Cucumis sativus L.) Nitric Oxide ...
https://www.frontiersin.org/articles/10.3389/fpls.2016.01652/full
*  Frontiers | The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis...
... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... Liu, L. (2008). Inheritance Analysis and QTL Mapping of Powdery Mildew Resistance in Cucumber (Cucumis sativus L.). Doctor's ... The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus ...
https://www.frontiersin.org/articles/10.3389/fpls.2018.00544/full
*  24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress | Springer for...
Cucumis sativus L. 24-Epibrassinolide Root Cell wall Lignin Ca(NO3)2 stress ... 24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress. ...
https://rd.springer.com/article/10.1007/s00709-017-1187-8
*  Water/ethanol extract of Cucumis sativus L. fruit attenuates lipopolysaccharide-induced inflammatory response in endothelial...
Effect of Cucumis sativus L. extract (CSE) on LPS induced HO-1 expression. a Expression of HO-1 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS induced TLR4 expression. a Expression of TLR4 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS-induced pAECs toxicity. a Representative images of pAECs morphology under LPS ... Effect of Cucumis sativus L. extract on LPS-induced angiogenesis. pAECs were cultured on a extracellular matrix with LPS (10 μg ...
https://bmccomplementalternmed.biomedcentral.com/articles/10.1186/s12906-018-2254-1
*  Transcriptomic analysis of short-fruit 1 (sf1) reveals new insights into the variation of fruit-related traits in Cucumis...
... reveals new insights into the variation of fruit-related traits in Cucumis sativus, Scientific Reports" on DeepDyve, the ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), 'Chinese long' 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), 'Chinese long' 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14), a member of the family Cucurbitaceae, is one of the most economically important ...
https://www.deepdyve.com/lp/springer_journal/transcriptomic-analysis-of-short-fruit-1-sf1-reveals-new-insights-into-tjXTYCaMx7
*  Cucumis sativus - ICG
Cucumber, Cucumis sativus L. is one of the most important cultivated vegetable crops, ranking 4th in quantity of world ... Retrieved from "http://192.168.118.79:9052/index.php?title=Cucumis_sativus&oldid=8844" ...
http://icg.big.ac.cn/index.php/Cucumis_sativus
*  कण्टकीफलं - Cucumis sativus
Botanical name - Cucumis sativus. Description - Annual climber; stem scabrous; tendrils simple; leaves alternate, petiolate, ...
https://indianmedicinalplants.info/herbs/index.php/sanskrit-names-of-medicinal-plants/44-2012-02-24-07-34-36/273-cucumis-sativus
*  Cucumis sativus - Genome GC
Cucumis sativus. cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; ...
http://gc.genestimuli.org/genome/3659
*  Cucumis Sativus - Cosmetic Analysis
Cosmetic Analysis has rated the ingredient Cucumis Sativus. Alternative names: Cucumber Extract; Cucumber Oil; Gurke; Gurken- ... Cucumis Sativus Rating based on characteristics:. Please login INCI name CUCUMIS SATIVUS Alternative names Cucumber Extract, ... Cucumis Sativus is the crushed fruit of the cucumber, Cucumis sativus, Cucurbitaceae INCI function Emollient The INCI function ... Cosmetics containing Cucumis Sativus. The list of cosmetic products below is a selection of the most requested cosmetics that ...
http://www.cosmeticanalysis.com/cosmetic-ingredients/cucumis-sativus.html
*  Chill-Induced Inhibition of Photosynthesis: Genotypic Variation within Cucumis sativus : Plant and Cell Physiology - oi
Cucumber is generally a thermophilic species; however, cultivars have been selected for higher yield during winter cultivation in unheated glasshouses in temperate regions. We tested whether photosynthesis in these varieties had greater chilling tolerance. There was no difference in the instantaneous reduction of photosynthesis at low temperature between four winter glasshouse and four summer field cultivars. After 5 d of 10°C and 100 µmol m-2 s-1 photon flux density, the four field cultivars had a sustained depression of photosynthesis after returning to clement conditions. This inhibition was associated with reduced rates of CO2 fixation and photosystem II (PSII) electron transport in the light, but not with sustained PSII photoinhibition. However, photosynthesis in the glasshouse genotypes was nearly identical to the pre-chill rates. Chill impacts on light-adapted chlorophyll fluorescence parameters, such as the quantum yield of PSII electron transport (ϕPSII), correlated well with overall ...
http://oxfordindex.oup.com/view/10.1093/pcp/pcf134