CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT, CUCUMIS SATIVUS (CUCUMBER) INFUSION, CUCUMIS SATIVUS EXTRACT, CUCUMIS SATIVUS FRUIT ... Cucumis sativus.. CUCUMBER EXTRACT, CUCUMBER FRUIT EXTRACT, CUCUMBER INFUSION, CUCUMBER, EXT., CUCUMIS SATIVUS (CUCUMBER) ... CUCUMIS SATIVUS INFUSION, EXTRACT OF CUCUMBER, and EXTRACT OF CUCUMIS SATIVUS ... CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT. Click here for all products containing this ingredient ...
CUCUMIS SATIVUS (CUCUMBER) EXTRACT; CUCUMIS SATIVUS EXTRACT; CUCUMIS SATIVUS FRUIT EXTRACT; EXTRACT OF CUCUMBER; EXTRACT OF ... About CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT: Extract of the fruit of the cucumber, Cucumis sativus.. Function(s): Skin- ... Show all 447 recent products that contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT.. ...
... identification and distribution of Map of Cucumis sativus -- Discover Life ... Cucumis sativus @ American Museum of Natural History, Bee Specimen Record (1); Bernice P. Bishop Museum, Thematic Collection ...
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; ...
Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ... Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ...
Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... Camelina sativa (False flax) (Myagrum sativum). Brassica napus (Rape). Capsella bursa-pastoris (Shepherds purse) (Thlaspi ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
Thread by robertduval14: forgot to put this in the photo description...but a close look at the lower left petal will reveal a small and well camouflaged c...
tr,E7CEX8,E7CEX8_CUCSA WRKY protein OS=Cucumis sativus OX=3659 GN=WRKY37 PE=2 SV=1 ...
ASM journals are the most prominent publications in the field, delivering up-to-date and authoritative coverage of both basic and clinical microbiology.. About ASM , Contact Us , Press Room. ASM is a member of. ...
Jazzer has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.).. ...
Cápal, P., Ondřej, V. Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.). In Vitro Cell.Dev.Biol.- ... Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.). *Petr Cápal1,2. & ... Navrátilová B, Luhová L, Petřivalský M (2008) Effect of UV-C irradiation on mesophyll protoplasts of Cucumis sativus. Plant ... Ondřej V, Navrátilová B, Lebeda A (2009b) The heterochromatin as a marker for protoplast differentiation of Cucumis sativus. ...
Home » Proteomic characterization of iron deficiency responses in Cucumis sativus L. roots ...
Daniel J. Geduld (2011) CIL:39018, Cucumis sativus, plant cell, cucumber peel. CIL. Dataset. https://doi.org/doi:10.7295/ ...
Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress. Xingwang Liu1,2† ... Citation: Liu X, Liu B, Xue S, Cai Y, Qi W, Jian C, Xu S, Wang T and Ren H (2016) Cucumber (Cucumis sativus L.) Nitric Oxide ...
Cucumis sativus) - Cucumber (Cucumis sativus) Introduction Both cucumbers and melons are members of the same genus: Cucumis ... Cucumber Cucumis sativus. 1. Cucumber (Cucumis sativus)*Introduction *Both cucumbers and melons are members of the same genus ... Cucumis Sativus L. - Cucumis Sativus L. Nick Lorenz May 1, 2006 Phylogeny Interesting Facts Cucumbers originated in India where ... Cucumber Cucumis sativus. Description:. Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ...
Cucumis sativus explanation free. What is Cucumis sativus? Meaning of Cucumis sativus medical term. What does Cucumis sativus ... Looking for online definition of Cucumis sativus in the Medical Dictionary? ... Cucumis sativus. Also found in: Dictionary, Thesaurus, Encyclopedia, Wikipedia.. Related to Cucumis sativus: Tribulus ... Cucumis sativus , definition of Cucumis sativus by Medical dictionary https://medical-dictionary.thefreedictionary.com/Cucumis+ ...
Ranjan, P., Pandey, A., Munshi, A.D. et al. Orange-fleshed cucumber (Cucumis sativus var. sativus L.) germplasm from North-East ... Orange-fleshed cucumber (Cucumis sativus var. sativus L.) germplasm from North-East India: agro-morphological, biochemical and ... Qi C, Yuan Z, Li Y (1983) A new type of cucumber-Cucumis sativus L. var. xishuangbannanesis [sic]. Acta Hortic Sin 10:259-264 ... Lv J, Qi J, Shi Q, Shen D, Zhang S, Shao G et al (2012) Genetic diversity and population structure of cucumber (Cucumis sativus ...
... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... Liu, L. (2008). Inheritance Analysis and QTL Mapping of Powdery Mildew Resistance in Cucumber (Cucumis sativus L.). Doctors ... The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus ...
Huang S, Li R, Zhang Z, Li L, Gu X, Fan W et al (2009) The genome of the cucumber, Cucumis sativus L. Nat Genet 41:1275-1281 ... Zhou Y, Hu L, Jiang L, Liu H, Liu S (2017b) Molecular cloning and characterization of an ASR gene from Cucumis sativus. Plant ... Cucumis sativus), enhances tolerance to heat and cold in Escherichia coli. AMB Express 7:182CrossRefPubMedPubMedCentralGoogle ... Identification and transcriptional analysis of dehydrin gene family in cucumber (Cucumis sativus). ...
Morrell, Clare Katrina (1987) The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls. University of ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ...
Knowing the extent and structure of genetic variation in germplasm collections is essential for the conservation and utilization of biodiversity in cultivated plants. Cucumber is the fourth most important vegetable crop worldwide and is a model system for other Cucurbitaceae, a family that also includes melon, watermelon, pumpkin and squash. Previous isozyme studies revealed a low genetic diversity in cucumber, but detailed insights into the crops genetic structure and diversity are largely missing. We have fingerprinted 3,342 accessions from the Chinese, Dutch and U.S. cucumber collections with 23 highly polymorphic Simple Sequence Repeat (SSR) markers evenly distributed in the genome. The data reveal three distinct populations, largely corresponding to three geographic regions. Population 1 corresponds to germplasm from China, except for the unique semi-wild landraces found in Xishuangbanna in Southwest China and East Asia; population 2 to Europe, America, and Central and West Asia; and population 3
Pot experiments were conducted on cucumber (Cucumis sativus L.) plants in the green house of the National Research Center. ... EFFECTS OF SALICYLIC ACID ON SEEDLING GROWTH AND NITROGEN METABOLISM IN CUCUMBER (CUCUMIS SATIVUS L.). Singh, Pramod Kumar; ... Subplastidic preparations from cotyledons of cucumber (Cucumis sativus L.) were tested for their ability to synthesize ... Cucumis sativus L.) exposed to NaCl stress. Salt stress reduced net photosynthetic rates (P), actual photochemical efficiency ...
Cucumis sativus L. 24-Epibrassinolide Root Cell wall Lignin Ca(NO3)2 stress ... 24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress. ...
Effect of Cucumis sativus L. extract (CSE) on LPS induced HO-1 expression. a Expression of HO-1 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS induced TLR4 expression. a Expression of TLR4 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS-induced pAECs toxicity. a Representative images of pAECs morphology under LPS ... Effect of Cucumis sativus L. extract on LPS-induced angiogenesis. pAECs were cultured on a extracellular matrix with LPS (10 μg ...