國立中興大學生命科學系
Hsing-Mei Chiang, Ying-Ning Ho, Chieh-Chen Huang 2012 Application of Plant Endophytic Bacterium, Burkholderia cenocepacia 869T2 ... Burkholderia cenocepacia 869T2, on biocontrol of Fusarium Wilt in planta,2012 International Banana Symposium. November 19-22, ... Burkholderia cenocepacia 869T2,ASM 113th General Meeting (asm2013). May 18-21, 2013 Denver, United States. ... 重要作物苗期病害診斷檢測及防治管理技術之研發與
Семейная средиземноморская лихорадка
News
Ophiocordyceps kimflemingae
Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1. ... Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1. 1412 ... Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1. ... Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG ...
Burkholderia | SeqCode Registry
Burkholderia caryophylli * Burkholderia catarinensis * Burkholderia catudaia * Burkholderia cenocepacia * Burkholderia cepaciaT ... Burkholderia Nomenclatural type. Burkholderia cepaciaT Nomenclatural status. Validly published under the ICNP. Taxonomy. ... Burkholderia Citation. Formal styling. Burkholderia Yabuuchi et al. 1993 emend. Gillis et al. 1995 emend. Sawana et al. 2014 ... Burkholderia Yabuuchi et al., 1993 * Burkholderia Yabuuchi, Kosako, Oyaizu, Yano, Hotta, Hashimoto, Ezaki & Arakawa, 1993 ( ...
Species: Burkholderia andongensis
"Candidatus Burkholderia catophylla" * Burkholderia catudaia * Burkholderia cenocepacia * Burkholderia cepacia * Burkholderia ... Parent taxon: Burkholderia Yabuuchi et al. 1993 Assigned by: Lemaire B, Robbrecht E, van Wyk B, Van Oevelen S, Verstraete B, ... Linking: To permanently link to this page, use https://lpsn.dsmz.de/species/burkholderia-andongensis. Copy to clipboard. Link ...
Burkholderia cepacia complex (BCC) causing bacteremia in patients suffering from B-cell acute lymphocytic leukemia: A case...
Burkholderia cepacia complex consists of 24 species of microorganisms that include B. cepacia, B. multivorans, B. cenocepacia, ... Key words: Burkholderia cepacia complex (BCC), Hematological malignancy, Septicemia, Bacteremia, Burkholderia vietnamese. ... Burkholderia cepacia complex (BCC) causing bacteremia in patients suffering from B-cell acute lymphocytic leukemia: A case ... Burkholderia cepacia complex (BCC) causing bacteremia in patients suffering from B-cell acute lymphocytic leukemia: A case ...
Designing Probes for Immunodiagnostics : Structural Insights into an Epitope Targeting Burkholderia Infections
... cenocepacia Pal and through computational analyses. Our results are discussed in the context of designing new diagnostic ... antigen from Burkholderia pseudomallei, which could also diagnose Burkholderia cepacia infections. Here, considering the high ... antigen from Burkholderia pseudomallei, which could also diagnose Burkholderia cepacia infections. Here, considering the high ... Designing Probes for Immunodiagnostics : Structural Insights into an Epitope Targeting Burkholderia Infections. R. Capelli. ...
Christmas/New Year Opening hours - Community Pharmacy England
Immune system - wikidoc
Such biofilms are present in many successful infections, e.g., the chronic Pseudomonas aeruginosa and Burkholderia cenocepacia ...
Burkholderia pseudomallei natural competency and DNA catabolism: Identification and characterization of relevant genes from a...
The library was transferred to non-competent Bp K96243 and B. cenocepacia (Bc) K56-2, harboring chromosomally-inserted FRT- ... Burkholderia pseudomallei (Bp) strains 1026b and K96243 and B. thailandensis strain E264 are able to utilize DNA as a sole ... Burkholderia pseudomallei (Bp) strains 1026b and K96243 and B. thailandensis strain E264 are able to utilize DNA as a sole ... Burkholderia pseudomallei (Bp) strains 1026b and K96243 and B. thailandensis strain E264 are able to utilize DNA as a sole ...
prof. Aurélien Carlier
Bakterijos - Vikipedija
Author Details | Menara Perkebunan
Uji potensi Burkholderia cenocepacia strain KTG sebagai bahan aktif pembenah hayati pada tanah tekstur berpasir di Kalimantan ... Pengaruh pemberian inokulan Burkholderia cenocepacia dan bahan organik terhadap sifat fisik tanah berpasir Effect of the ... Karakteristik gugus fungsional eksopolisakarida Burkholderia cenocepacia strain KTG dalam tiga kelas tekstur tanah The ... inoculation of Burkholderia cenocepacia and organic materials on physical properties of a sandy soil. Abstract PDF ...
Atemschutz Archive - skriptorium
Family Report for: Bacterial lip FamI.2
Burkholderia cenocepacia Show. MARSMRSRVMAGAVACAMSVAPFAATTALMTLATTHTAMAATAPADNYAA. TRYPIILVHGLTGTDKYAGVLEYWYGIQENLQQHGATVYVANLS ... Burkholderia glumae Show. MVRSMRSRVAARAVAWALAVMPLAGAAGLTMAASPAAVAADTYAATRYPV. ILVHGLAGTDKFANVVDYWYGIQSDLQSHGAKVYVANLSGFQSDDGPNG ... Burkholderia mallei Show. MKSRFASAAAAVRGARKTLAKVWAAVLAAAMCAFAAPAAHADAATGALDD. YAATRYPIILVHGLTGTDDYFGVVPYWYGMRPHLQQHGATVFVADLSGF ... Burkholderia cepacia Show. MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAA. TRYPIILVHGLSGTDKYAGVLEYWYGIQEDLQQNGATVYVANLSGFQS ...
Microorganisms | Free Full-Text | Network Analysis Based on Unique Spectral Features Enables an Efficient Selection of...
Publicly available MALDI-TOF MS data of a L. brevis dataset and spectra of Burkholderia strains of a benchmark dataset were ... cenocepacia (cluster 7) a partitioning was observed for strains belonging to genomovar IIIA (pink variants) versus IIIB (green ... Figure 2. Network analysis on benchmark dataset containing 21 strains of six Burkholderia cepacia complex species. (A) Network ... Figure 2. Network analysis on benchmark dataset containing 21 strains of six Burkholderia cepacia complex species. (A) Network ...
MBS Recombinant - Polabo
Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd) -Baculovirus Buy online. Burkholderia mallei Acetyl- ... Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd) -E. coli. 1000ug. 1575 GEN1254945.E.coli. See more ... Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd) -E. coli. 1000ug. 1575 GEN1147323.E.coli. See more ... Burkholderia cenocepacia Phosphatidylserine decarboxylase proenzyme (psd) -Yeast. 1000ug. 2078 GEN1254945.Yeast. See more ...
Recombinant Bacillus thuringiensis Ribosome maturation factor RimM (rimM), Yeast | Labstore
January | 2018 | C Kit Inhibitors
API 20NE tests were carried out on the following strains: Burkholderia sp. DBT1, B. fungorum LMG 16225T and B. cepacia LMG ... cenocepacia K56-2. The bacterium was cultured in 96-well microplates with an initial OD640 nm of 0.1, in the presence of each ... This indicates that these compounds, chiefly phenathrene, may act as major substrates for Burkholderia sp. DBT1. ... Growth tests carried out in the presence of different PAHs demonstrated that Burkholderia sp. DBT1 is able to grow on both ...