Loading...
*  Glycoengineering of host mimicking type-2 LacNAc polymersand Lewis X antigens on bacterial cell surfaces
... Mally, Manuela ... Lipopolysaccharide (LPS), a major component on the surface of Gram-negative bacteria, is composed of a lipid A-core and the O- ... The poly-LacNAc scaffold was used as an acceptor for fucosylation leading to polymers of Lewis X antigens. We analysed the ... Lewis X (Gal beta 1-4(Fuc alpha 1-3)GlcNAc) antigens of Helicobacter pylori or of the helminth Schistosoma mansoni modulate the ...
http://su.diva-portal.org/smash/record.jsf?pid=diva2:611891
*  'antigens surface' Protocols and Video...
Antigens, Surface: Antigens on surfaces of cells, including infectious or foreign cells or viruses. They are usually protein- ...
https://www.jove.com/keyword/antigens+surface
*  HEPATITIS B SURFACE ANTIGEN
Reactive Hepatitis B Surface Antigen will reflex to the Hepatitis B Surface Antigen Confirmatory neutralization test for an ... Home : For health professionals : Refer a patient : Laboratory Services : Test Table : HEPATITIS B SURFACE ANTIGEN ...
http://www.legacyhealth.org/for-health-professionals/refer-a-patient/laboratory-services/test-table/hepatitis-b-surface-antigen.aspx
*  Hapten - Sandwich Labeling of Cell-Surface Antigens | SpringerLink
The indirect antibody technique for amplified detection of antigens (Coons, 1956) has a wide and expanding range of ... Wofsy L., Henry C., Cammisuli S. (1978) Hapten - Sandwich Labeling of Cell-Surface Antigens. In: Reisfeld R.A., Inman F.P. (eds ... The indirect antibody technique for amplified detection of antigens (Coons, 1956) has a wide and expanding range of ... to label first-layer antibody specific for a particular antigen. The last few years have seen the introduction of hapten- ...
https://link.springer.com/chapter/10.1007/978-1-4757-0779-3_7
*  Surface Antigens on Normal and Malignant Lymphoid Cells | SpringerLink
Boumsell L., Bernard A. (1983) Surface Antigens on Normal and Malignant Lymphoid Cells. In: Chandra P. (eds) Biochemical and ... We then emphasize the most important technical requirements for assessing the reactivity of MA with cell surfaces. Finally we ...
https://link.springer.com/chapter/10.1007/978-1-4684-4454-4_6
*  T-cell surface antigen CD2 (P06729) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
http://www.ebi.ac.uk/interpro/protein/P06729
*  Hep B surface antigen positive - Hepatitis B - MedHelp
HbS antigen. positive. hep e antigen.Negative.HBV DNA.Negative.I am on treatment with lumividine tab 100 mg/day for about 3 yrs ... Hep B surface antigen positive. I am diagnosed as Hep B carrier.My test reports:HbS antigen. positive. hep e antigen.Negative. ... Interferon treatment cure this disease and gives a Surface antigen negative result.Doctors even i insisted, did not prescribe ... Interferon treatment cure this disease and gives a Surface antigen negative result.Doctors even i insisted, did not prescribe ...
http://www.medhelp.org/posts/Hepatitis-B/Hep-B-surface-antigen-positive/show/1308466
*  Influvac (Inactivated influenza vaccine [surface antigen]) Drug / Medicine Information
... surface antigen]) intended for persons living in Australia. ... Management in the AFM business unit of Bruker's Nano Surfaces ...
https://www.news-medical.net/drugs/Influvac.aspx
*  Myeloid cell surface antigen CD33 - DrugBank
lcl,BSEQ0010470,Myeloid cell surface antigen CD33 (CD33) ATGCCGCTGCTGCTACTGCTGCCCCTGCTGTGGGCAGACTTGACCCACAGGCCCAAAATC ... lcl,BSEQ0001344,Myeloid cell surface antigen CD33 MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW ... The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune ... Vitale C, Romagnani C, Puccetti A, Olive D, Costello R, Chiossone L, Pitto A, Bacigalupo A, Moretta L, Mingari MC: Surface ...
https://www.drugbank.ca/polypeptides/P20138
*  Browsing by Subject "Antigens, Surface"
Ligation of cell surface GRP78 with antibody directed against the COOH-terminal domain of GRP78 suppresses Ras/MAPK and PI 3- ... We have previously shown that treatment of prostate cancer and melanoma cells expressing GRP78 on their cell surface with ...
https://dukespace.lib.duke.edu/dspace/browse?type=subject&value=Antigens%2C%20Surface
*  Hepatitis b surface antigen | Define Hepatitis b surface antigen at Dictionary.com
Hepatitis b surface antigen definition at Dictionary.com, a free online dictionary with pronunciation, synonyms and translation ... hepatitis b surface antigen in Medicine Expand. hepatitis B surface antigen n. Abbr. HBsAg An antigen of the small spherical ...
http://www.dictionary.com/browse/hepatitis-b-surface-antigen
*  Recombinant Hepatitis A Virus Surface Antigen protein (ab68870)
Buy our Recombinant Hepatitis A Virus Surface Antigen protein. Ab68870 is an active protein fragment produced in Escherichia ... Recombinant Hepatitis A Virus Surface Antigen protein. See all Hepatitis A Virus Surface Antigen proteins and peptides. ...
http://www.abcam.com/recombinant-hepatitis-a-virus-surface-antigen-protein-ab68870.html
*  Mouse Cell Surface Antigens: Nomenclature and Immunophenotyping | The Journal of Immunology
Mouse Cell Surface Antigens: Nomenclature and Immunophenotyping Message Subject (Your Name) has forwarded a page to you from ... Mouse Cell Surface Antigens: Nomenclature and Immunophenotyping. Lily Lai, Noosheen Alaverdi, Lois Maltais and Herbert C. Morse ... Cell surface antigens expressed by subsets of pre-B cells and B cells. J. Immunol. 132: 332. ... The murine homologue of the T lymphocyte antigen CD28: molecular cloning and cell surface expression. J. Immunol. 144: 3201. ...
http://www.jimmunol.org/content/160/8/3861
*  Hepatitis A Surface Antigen Antibodies: Novus Biologicals
Browse our Hepatitis A Surface Antigen Antibody catalog backed by our Guarantee+. ... Hepatitis A Surface Antigen Antibodies available through Novus Biologicals. ... Hepatitis A Surface Antigen Antibodies. We offer Hepatitis A Surface Antigen Antibodies for use in common research applications ... Choose from our Hepatitis A Surface Antigen monoclonal antibodies.. Alternate Names for Hepatitis A Surface Antigen Antibodies ...
https://www.novusbio.com/primary-antibodies/hepatitis-a-surface-antigen
*  Batrevac (Influenza Vaccine, inactivated, surface antigen) Solvay
J07BB02 - Influenza, inactivated, split virus or surface antigen. Pharmaceutical companies: manufacturers, researchers, ...
https://drugs-about.com/drugs-b/batrevac.html
*  Apparent discontinuous transcription of Trypanosoma brucei variant surface antigen genes. - PubMed - NCBI
The repeated mini-exon sequence that encodes the first 35 base pairs of all variant surface antigen mRNAs of Trypanosoma brucei ... Apparent discontinuous transcription of Trypanosoma brucei variant surface antigen genes.. Campbell DA, Thornton DA, Boothroyd ... It thus seems that variant surface antigen mRNAs are transcribed discontinuously, and we present two alternative models for how ...
https://www.ncbi.nlm.nih.gov/pubmed/6090933?dopt=Abstract
*  Appendix C: Identification and Management of Hepatitis B Surface Antigen (HBsAg)--Positive Persons
Identification and Management of Hepatitis B Surface Antigen (HBsAg)--Positive Persons. Persons with chronic hepatitis B virus ...
https://www.cdc.gov/mmwr/preview/mmwrhtml/rr5516a4.htm
*  Anti-Hepatitis B Virus Surface Antigen antibody (ab19979) Protocols
There are no specific protocols for Anti-Hepatitis B Virus Surface Antigen antibody (ab19979). Please download our general ...
http://www.abcam.com/hepatitis-b-virus-surface-antigen-antibody-ab19979-protocols.html
*  Leishmania surface antigen protein Summary Report | CureHunter
... a promastigote surface protein from Leishmania infantum; contains leucine-rich repeats (LRR); nucleotide sequence in first ... Leishmania surface antigen protein. Subscribe to New Research on Leishmania surface antigen protein ... Antigens: 114404*Surface Antigens: 4354*Leishmania surface antigen protein. *Protozoan Antigens: 1*Leishmania surface antigen ... a promastigote surface protein from Leishmania infantum; contains leucine-rich repeats (LRR); nucleotide sequence in first ...
http://www.curehunter.com/public/keywordSummaryC110913.do
*  EPO - T 2126/08 (Surface antigen/ORTHO-CLINICAL DIAGNOSTICS) of 23.4.2013
T 2126/08 (Surface antigen/ORTHO-CLINICAL DIAGNOSTICS) of 23.4.2013. European Case Law Identifier:. ECLI:EP:BA:2013: ... The amino acid sequence of the surface antigen of the newly identified HBV strain, called LBN, had five amino acid differences ... 1. An isolated variant hepatitis B surface antigen comprising an amino acid sequence wherein mutations from hepatitis B wild ... surface antigen variant' which was published as EP 1 142 906. ... A hepatitis B virus (subtype ayw) surface antigen variant. ...
http://www.epo.org/law-practice/case-law-appeals/recent/t082126eu1.html
*  Hepatitis B surface antigen ihc problems
... ,, Previous Message , Next Message ,, From:. 'Nicola Falconer' ,njfja@njfja.screaming ...
http://www.histosearch.com/histonet/May00/HepatitisBsurfaceantigeni.html
*  Babesia merozoite surface antigen p58 Summary Report | CureHunter
Babesia merozoite surface antigen p58: from Babesia bigemina; candidate immunogen for inclusion in an antigenically defined ... Babesia merozoite surface antigen p58. Subscribe to New Research on Babesia merozoite surface antigen p58 ...
http://www.curehunter.com/public/keywordSummaryC071621.do
*  hep B Surface Antigen Positive - Forum on Hepatitis and HIV Coinfection - TheBody.com
... then the surface antigen can mean a chronic carrier state that is inactive due to no virus in her blood. Yes I would agree that ... hep B Surface Antigen Positive. Feb 4, 2006 My wife recently tested positive for Hep B surface antigen as part of a routine ... If your wife is at risk for hepatitis B, then the surface antigen can mean a chronic carrier state that is inactive due to no ... Yes I would agree that she should see a specialist to be certain that: 1. The hepatitis B surface antigen was confirmed. 2. To ...
http://www.thebody.com/Forums/AIDS/Hepatitis/Q171851.html
*  HBsAg Antibody | Hepatitis B virus surface antigen | ProSpec
The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian ... HBsAg is the surface antigenof the Hepatitis-B-Virus (HBV). The capsidof a virus has different surface proteins from the rest ... Antigen.. Description. HBsAg is a serological marker produced on the surface of the hepatitis B virus and is one of the first ...
https://www.prospecbio.com/hbsag_antibody