Flt3 - Fetal Liver Tyrosine Kinase 3. Looking for abbreviations of Flt3? It is Fetal Liver Tyrosine Kinase 3. Fetal Liver Tyrosine Kinase 3 listed as Flt3
Williams Jr., J. N. ; Sreenivasan, A. (1953) The stability and activation of the liver tyrosine oxidase system The Journal of Biological Chemistry, 203 (2). pp. 613-623. ISSN 0021-9258 ...
Jansen, Hans-Michael; Strähle, Uwe; Gloss, Bernd; Stewart, Francis; Schmid, Wolfgang; Boshart, Michael; Miksicek, Richard und Schlitz, Günther (1987): Cooperativity of Glucocorticoid Response Elements Located Far Upstream of the Tyrosine Aminotransferase Gene. In: Cell, Vol. 49, Nr. 1: S. 29-38 [PDF, 1MB] ...
Nitsch, Doris; Ruppert, Siegfried; Kelsey, G. D.; Schedl, A.; Weih, Falk; Stewart, A. F.; Strähle, Uwe; Schmid, Wolfgang; DeVack, Carol; Reik, A.; Boshart, Michael und Schütz, Günther (1991): Hormonal and liver-specific control of expression of the tyrosine aminotransferase gene. In: Cohen, P. und Foulkes, J. G. (Hrsg.): Molecular Aspects of Cellular Regulation. Amsterdam: Elsevier. S. 433-444 [PDF, 1MB] ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Trans-acting factor that binds to glucocorticoid modulatory elements (GME) present in the TAT (tyrosine aminotransferase) promoter and increases sensitivity to low concentrations of glucocorticoids. Binds also to the transferrin receptor promoter. Essential auxiliary factor for the replication of parvoviruses.
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Ywhaq - Ywhaq (untagged ORF) - Rat tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (Ywhaq), (10 ug) available for purchase from OriGene - Your Gene Company.
Looking for online definition of tyrosine aminotransferase in the Medical Dictionary? tyrosine aminotransferase explanation free. What is tyrosine aminotransferase? Meaning of tyrosine aminotransferase medical term. What does tyrosine aminotransferase mean?
Fingerprint Dive into the research topics of Organ specificity of glucocorticoid-sensitive tyrosine aminotransferase. Separation from aspartate aminotransferase isoenzymes. Together they form a unique fingerprint. ...
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
This study has demonstrated that GC may affect the cytotoxicity of cisplatin in the GR-rich human carcinoma cell line, SiHa. Since GC is commonly co-administered with cisplatin, this influence of GC on cytotoxicity may affect the response to cisplatin treatment in carcinoma patients.. GC mediates its effects by binding to and activation of GR. Activated GR exerts its cellular effect by either transactivating its downstream GRE-containing genes or interacting with other transcriptional factors. In the former transactivation mechanism, GC binds to its cytoplasmic receptor, dimerizes, enters the nucleus, and finally binds to GREs to transactivate the target genes, such as tyrosine aminotransferase and alanine aminotransferase (Beato et al. 1995). However, some major effects of GC, including its anti-inflammatory and immunosuppressive effects, are achieved by regulating genes that do not contain GREs in their promoters (McEwan et al. 1997, Van der Burg et al. 1997, Cato & Wade 1996). This finding ...
|p|HTC 10: ultra vivid 2K display, worlds first dual OIS, UltraPixel™ main camera, HTC UltraSelfie™ front camera, 24-bit Hi-Res HTC BoomSound™ Audio and PowerBotics battery.|/p|
На данной странице представлены обзоры и другая информация о HTC 10 серии 10 ноутбуков.
TY - JOUR. T1 - The Influence of Thyroxine and Thiouracil on Rats Fed Excess Tyrosine (34572). AU - Boctor, Amal M.. AU - Rogers, Quinton. AU - Harper, A. E.. PY - 1970/1/1. Y1 - 1970/1/1. N2 - Addition of thiouracil to a high tyrosine diet alleviated signs of tyrosine toxicity in the rat, whereas, daily injections of thyroxine aggravated them. Plasma tyrosine concentration and liver tyrosine transaminase activity were high in rats fed a high tyrosine diet; thyroxine administration increased them further, but depressed slightly the activity of liver p-hydroxyphenylpyruvate hydroxylase.. AB - Addition of thiouracil to a high tyrosine diet alleviated signs of tyrosine toxicity in the rat, whereas, daily injections of thyroxine aggravated them. Plasma tyrosine concentration and liver tyrosine transaminase activity were high in rats fed a high tyrosine diet; thyroxine administration increased them further, but depressed slightly the activity of liver p-hydroxyphenylpyruvate hydroxylase.. UR - ...
TY - JOUR. T1 - Acute renal failure after treatment with sunitinib in a patient with multiple myeloma. AU - Leung, Nelson. AU - Saucier, Nathan A.. AU - Zeldenrust, Steven R.. AU - Gunderson, Heidi D.. AU - Cornell, Lynn D.. PY - 2009/8. Y1 - 2009/8. N2 - Sunitinib is a multiple tyrosine kinase receptors inhibitor that is approved for the treatment of advanced renal cell carcinoma. Amongst its targets are fetal liver tyrosine kinase receptor 3 (FLT 3) and vascular endothelial growth factor receptor (VEGFR). Renal toxicity has not been reported from the trials, but several patients have been reported to develop a pre-eclampsia-like syndrome. We report the first case of acute tubular necrosis in a patient with multiple myeloma following treatment with sunitinib.. AB - Sunitinib is a multiple tyrosine kinase receptors inhibitor that is approved for the treatment of advanced renal cell carcinoma. Amongst its targets are fetal liver tyrosine kinase receptor 3 (FLT 3) and vascular endothelial growth ...
Because of the interest in the relationship between cholesteryl ester (CE) accumulation and atherosclerosis, we have attempted to select an easily grown tissue culture cell which accumulates CE when...
Phosphatidylcholine, phosphatidylethanolamine, and triglycerides were isolated from minimal deviation hepatoma 7288C cells cultured as monolayers to confluency in roller flasks containing Swims 77...
Cloning and characterization of highly polymorphic porcine microsatellites. The extension coat color locus and the loci for blood group O and tyrosine aminotransferase are on pig chromosome 6
Searcy, G.K.; Senter, S.D.; Wilson, R.L., 1995: Glutamic-Oxaloacetic Transaminase Activity: A Potential End-Point-Temperature Indicator for Imported Cooked Beef †
CP000386.PE405 Location/Qualifiers FT CDS complement(443797..445194) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Rxyl_0412" FT /product="aminotransferase" FT /EC_number="2.6.1.-" FT /note="TIGRFAM: 2,4-diaminobutyrate 4-transaminase; PFAM: FT aminotransferase class-III; KEGG: ava:Ava_2839 FT diaminobutyrate--2-oxoglutarate aminotransferase" FT /db_xref="EnsemblGenomes-Gn:Rxyl_0412" FT /db_xref="EnsemblGenomes-Tr:ABG03386" FT /db_xref="GOA:Q1AYZ2" FT /db_xref="InterPro:IPR004637" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q1AYZ2" FT /protein_id="ABG03386.1" FT /translation="MREGENTLRAESTAAFRARKGLSEGLLERQAARESNARTYPRSIP FT IAVSRARGPYVWDADGRRYLDCLSGAGTLALGHNHPVVVEAIREVLDRGGPLHTLDLAT FT PVKDRFVEELFGSLPRRFAERARIHFCGPAGADAVEAAVKLAKTATGRETVLSFSGGYH FT GMTHGALSLTGKLAPKEPLAGLMPGVHFLPYPYGYRCPFGVGGEDGWRVGARYVERLLD FT DPESGVKRPAAMVLEVVQGEGGSIPAPDGWVREMRRITRERGIPLIVDEIQTGLGRTGT FT ...
Rabbit anti Rat tyrosine hydroxylase (pSer31) antibody recognizes tyrosine hydroxylase (TH), also known as tyrosine 3-monooxygenase, when
Reuber, M, "Morphologic and biologic correlation of hyperplastic and neoplastic hepatic lesions occurring spontaneously in c3h x y hybrid mice." (1971). Subject Strain Bibliography 1971. 1817 ...
|p|HTC U Play: Perfectly symmetric. Exquisitely thin. Featuring voice-activated HTC Sense Companion, HTC USonic and 3D curved glass.|/p|
Аланинаминотрансфераза (АлАТ, АЛТ, GPT) - внутриклеточный фермент из группы аминотрансфераз, катализирующих взаимопревращения аминокислот и кетокислот путем переноса аминогруппы.. Наиболее высокая активность аланинаминотрансферазы выявляется в печени и почках, меньшая - в сердце, скелетных мышцах, поджелудочной железе, селезенке, легких, эритроцитах. Активность фермента в сыворотке крови у мужчин несколько выше, чем у женщин. Содержание АлАТ в сыворотке крови здоровых людей невелико. Но при разрушении или повреждении клеток, богатых АлАТ ...
Tryptophan oxygenase (tryptophan 2,3-dioxygenase) activity increases immediately before the initiation of actinomycin D production by Streptomyces parvullus. We have attempted to discern whether this increase is due to a release from catabolite repression or to the synthesis of an inducer substance. The standard culture medium (glutamic acid-histidine-fructose medium) used in antibiotic production studies with S. parvullus contains l-glutamate as a major constituent. l-Glutamate is almost totally consumed before the onset of actinomycin D synthesis. The addition of 10 mM l-glutamate at this stage completely abolished actinomycin D production as well as tryptophan oxygenase synthesis. Fourteen amino acids were tested for a similar effect. Of these, l-glutamate and l-aspartate had the most dramatic effect on tryptophan oxygenase and beta-galactosidase (beta-d-galactosidase), another inducible enzyme. Standard glutamic acid-histidine-fructose medium, preincubated for 23 h to remove l-glutamate, allowed the
tr:F2QGR3_STROU] alaT; aminotransferase AlaT, aminotransferase, class I; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] ...
Earlier in the week the HTC Desire 310 was made official for China, and now HTC have announced the handset for Taiwan. The HTC Desire 310 is equipped with
DROID INCREDIBLE by HTC vs ZTE Boost Max+. Compare the specs and features of the DROID INCREDIBLE by HTC and ZTE Boost Max+ to see which is better.
Hi, I use HTML component (HTC) to create my own dropdown list and i use an input type text in my .htc to represent my dropdown field. The problem I hav
The retail box of the HTC Desire HD has pretty standard contents: a USB charger, standard microUSB data cable and the usual paperwork. Theres a...
Accepted name: cysteine transaminase. Reaction: L-cysteine + 2-oxoglutarate = mercaptopyruvate + L-glutamate. For diagram click here (mechanism).. Other name(s): cysteine aminotransferase; L-cysteine aminotransferase; CGT. Systematic name: L-cysteine:2-oxoglutarate aminotransferase. Comments: A pyridoxal-phosphate protein.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: 9030-32-4. References: 1. Chatagner, F. and Sauret-Ignazi, G. Role des transamination et du phosphate de pyridoxal dans la formation enzymatique de H2S a partir de la cystéine par le foie du rat en anaérobiose. Bull. Soc. Chim. Biol. 38 (1956) 415-428.. ...
Aminotransferase (AST) is an enzyme thats present in various parts of your body. Your doctor can order an AST test to check the level of aspartate aminotransferase in your blood. Abnormal results may be a sign of liver damage or disease. Learn more about this test.
Sigma-Aldrich offers abstracts and full-text articles by [Carlos Spichiger, Claudia Torres-Farfan, Hugo A Galdames, Natalia Mendez, Pamela Alonso-Vazquez, Hans G Richter].
Aspartate Aminotransferase (AST/GOT) Activity Assay Kit(谷草转氨酶活性测定试剂盒)(ab105135)比色法;敏感度大于10 mU.检测各种样本中谷草转氨酶的活性。
Biosystems Aspartate Aminotransferase (AST-GOT) stabil olmak kaydıyla, yaygın kullanım alanına sahip Biosystems reaktif Ve Cihazlarının
A study of the colorimetric dinitrophenyl-hydrazine method for the determination of serum glutamic oxalacetic transaminase activity.:
cop:Cp31_1915 K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] , (GenBank) aspC; Aspartate aminotransferase (A) MSKKDTAPESALLGSAGNPLRRKRRTFDQSDKLKNVLYEIRGPVTALAEKMELDGNTILK LNTGNPAIFGFEAPDVIMRDMIAALSTSQGYSTSKGIIPARRAIVTRYEVIPGFPAFDVD DVYLGNGVSELIMMTMQALLDNGDEVLIPMPDYPLWTAATSLSGGTPVHYLCDEDDDWNP SIEDIRSKVTEKTKAIVVINPNNPTGAVYSPEVLRDIVQVAREHDLLILVDEIYDRILYD GAVHTSIATLAPDLLCITYNGLSKAYRVAGYRAGWMVITGPKHYAHGFIEGIDLLSGTRL CSNVPAQHAIQVALGGRQSIYDLTSEGGRLLEQRNVAWEKLNQIPGVSCVKPMGALYAFP KIDLDYYDIHDDAQLMLDLLRAEKILMVQGTGFNWPQPDHFRVVTLPWAADLAVAMDRLG NFLSSYKQ ...
DROID ERIS by HTC vs ZTE Axon Pro. Compare the specs and features of the DROID ERIS by HTC and ZTE Axon Pro to see which is better.
It was only recently that Nokia won an injunction against HTC products in the UK, although the ban was later relaxed. Nokia had also recently gone...
The HTC Desire 500 comes in a pillbox-shaped retail package, similar to what debuted last year with the One series. Inside, youll find a set of all-white...
Identification of Mutations that Shift Paralog Functions: Conversion of E. Coli Malate Dehydrogenase to a Lactate Dehydrogenase by Rational Design [Y. Yin and J. F. Kirsch (2007) Proceedings of the National Academy of Sciences, USA 104, 17353-17357]. The Unfolding Pathway for Apo E. coli Aspartate Aminotransferase is Dependent on the Choice of Denaturant [E. Deu, and J. F. Kirsch (2007) Biochemistry 46, 5810-5818]. Free Energies of Protein-Protein Association Determined by Electrospray Ionization Mass Spectrometry Correlate Accurately with Values Obtained by Solution Methods. [S. R. Krishnaswamy, E. R. Williams, and J. F. Kirsch (2006) Protein Science 15,1465-1475]. Directed Evolution Relieves Product Inhibition in a Rationally Designed Tyrosine Aminotransferase. [S. C. Rothman, M. Voorhies, and J. F. Kirsch (2004) Protein Science 13, 763-772]. Avoiding the Road Less Traveled: How the Topology of Enzyme-substrate Complexes Can Dictate Product Selection. [A. C. Eliot and J. F. Kirsch (2003) ...
In primary cultures of rat hepatocytes, epidermal growth factor (EGF), platelet-derived growth factor (PDGF) and foetal-calf serum (FCS) prevented the stimulation of amino acid transport by glucagon (cyclic AMP-dependent) and by catecholamines (cyclic AMP-independent), but not by insulin. The insulin effect, as well as the effect of other hormones, were totally inhibited by thrombin through a mechanism independent of its proteolytic activity. The inhibitory effect of growth factors, not found in freshly isolated hepatocytes, was expressed very early in culture (4h). Induction of tyrosine aminotransferase by glucagon or dexamethasone, which, like stimulation of transport, represents a late hormonal effect, was not affected by EGF, PDGF or FCS, but was inhibited by thrombin. In contrast, none of the rapid changes in protein phosphorylation caused by hormones was altered by growth factors. Thus the inhibition by growth factors of hormonal stimulation of transport presumably involves late step(s) in ...
TY - JOUR. T1 - TATN-1 Mutations Reveal a Novel Role for Tyrosine as a Metabolic Signal That Influences Developmental Decisions and Longevity in Caenorhabditis elegans. AU - Ferguson, Annabel A.. AU - Roy, Sudipa. AU - Kormanik, Kaitlyn N.. AU - Kim, Yongsoon. AU - Dumas, Kathleen J.. AU - Ritov, Vladimir B.. AU - Matern, Dietrich. AU - Hu, Patrick J.. AU - Fisher, Alfred L.. PY - 2013. Y1 - 2013. N2 - Recent work has identified changes in the metabolism of the aromatic amino acid tyrosine as a risk factor for diabetes and a contributor to the development of liver cancer. While these findings could suggest a role for tyrosine as a direct regulator of the behavior of cells and tissues, evidence for this model is currently lacking. Through the use of RNAi and genetic mutants, we identify tatn-1, which is the worm ortholog of tyrosine aminotransferase and catalyzes the first step of the conserved tyrosine degradation pathway, as a novel regulator of the dauer decision and modulator of the daf-2 ...
Recombinant Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) Protein (His tag). Species: Human. Source: Escherichia coli (E. coli). Order product ABIN1981684.
HTC Cases : HTC Desire S Hydro/Gel Case Blue - HTC Desire HD Cases HTC Desire S Cases HTC Wildfire S Cases HTC 7 Trophy Cases HTC, cases, HTC Desire HD cases, HTC Desire S cases, HTC Wildfire S cases
Product Human Alanine Aminotransferase (ALT) ELISA Kit From DLdevelop - An ELISA kit based on the sandwich method for detection and quantification of Human Alanine Aminotransferase (ALT)
Sauvage, P. ; Lopezsaura, P. ; Leroyhouyet, MA. ; Tulkens, Paul M. ; Trouet, André. Analytical Characterization and Purification of Plasma-membrane From Cultured Hepatoma-cells (htc Cells). In: Biochimica et Biophysica Acta : international journal of biochemistry and biophysics, Vol. 644, no. 1, p. 41-52 (1981 ...
Thermostable transaminase and aminotransferase enzymes derived from various ammonifex, aquifex and pyrobaculum organisms are disclosed. The enzymes are produced from native or recombinant host cells and can be utilized in the pharmaceutical, agricultural and other industries.
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.