Reduced expression of lipoic acid synthase accelerates diabetic nephropathy<...
TY - JOUR. T1 - Reduced expression of lipoic acid synthase accelerates diabetic nephropathy. AU - Yi, Xianwen. AU - Xu, Longquan. AU - Hiller, Sylvia. AU - Kim, Hyung Suk. AU - Nickeleit, Volker. AU - James, Leighton R.. AU - Maeda, Nobuyo. PY - 2012/1. Y1 - 2012/1. N2 - Oxidative stress contributes to the pathogenesis of diabetic nephropathy. In mitochondria, lipoic acid synthase produces a-lipoic acid, an antioxidant and an essential cofactor in a-ketoacid dehydrogenase complexes, which participate in glucose oxidation and ATP generation. Administration of lipoic acid abrogates diabetic nephropathy in animal models, but whether lower production of endogenous lipoic acid promotes diabetic nephropathy is unknown. Here, we crossed mice heterozygous for lipoic acid synthase deficiency (Lias +/-) with Ins2 Akita/+ mice, a well characterized model of type 1 diabetes. Double mutant mice hadmore overt diabetic nephropathy, includingmicroalbuminuria, glomerular basement thickening, mesangial matrix ...
Fatty acids promote fatty liver disease via the dysregulation of 3-mercaptopyruvate sulfurtransferase/hydrogen sulfide pathway ...
Fatty acids promote fatty liver disease via the dysregulation of 3-mercaptopyruvate sulfurtransferase/hydrogen sulfide pathway ...
Fatty acids promote fatty liver disease via the dysregulation of 3-mercaptopyruvate sulfurtransferase/hydrogen sulfide pathway ...
Fatty acids promote fatty liver disease via the dysregulation of 3-mercaptopyruvate sulfurtransferase/hydrogen sulfide pathway ...
Brain 3-Mercaptopyruvate Sulfurtransferase 3MST: Cellular Localization and Downregulation after Acute Stroke - pdf descargar
Brain 3-Mercaptopyruvate Sulfurtransferase 3MST: Cellular Localization and Downregulation after Acute Stroke. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Molybdopterin synthase catalytic subunit
Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq, Jul 2008 ...
Structure Cluster
- 1OKG: 3-mercaptopyruvate sulfurtransferase from Leishmania major 3D Similarity Report Page
1OKG: The Crystal Structure of Leishmania Major 3-Mercaptopyruvate Sulfurtransferase: A Three-Domain Architecture with a Serine Protease-Like Triad at the Active Site
Plus it
We report here, to our knowledge, the first biochemical characterization of a plant biotin synthase reaction. Heterologous interactions between a plant recombinant Bio2 protein and bacterial proteins yield a functional biotin synthase complex, in good agreement with the successful functional complementation approach, using anE. coli bioB mutant, employed to isolate the bio2gene product from Arabidopsis (Baldet and Ruffet, 1996). The turnover number of the reaction was ,2 h−1 in the heterologous system with unfractionated protein extract from Bio2-overproducing strain and still ,1 h−1in the heterologous system comprising purified Bio2 protein (calculated from data in Table I). It appears from our results that biotin synthase from Arabidopsis acts as a catalyst and not, as suggested in bacteria, as a simple reactant (Gibson et al., 1999; Kiyasu et al., 2000).. The relative low levels of biotin synthase measured in our in vitro systems may reflect the limited proportion of recombinant Bio2 ...
Cysteine desulfurase - wikidoc
Thus, the two substrates of this enzyme are L-cysteine and [[[enzyme]-cysteine]], whereas its two products are L-alanine and [[[enzyme]-S-sulfanylcysteine]]. This enzyme belongs to the family of transferases, specifically the sulfurtransferases, which transfer sulfur-containing groups. The systematic name of this enzyme class is L-cysteine:[enzyme cysteine] sulfurtransferase. Other names in common use include IscS, NIFS, NifS, SufS, and cysteine desulfurylase. This enzyme participates in thiamine metabolism. ...
l-Cysteine metabolism via 3-mercaptopyruvate pathway and sulfate formation in rat liver mitochondria<...
TY - JOUR. T1 - l-Cysteine metabolism via 3-mercaptopyruvate pathway and sulfate formation in rat liver mitochondria. AU - Ubuka, T.. AU - Ohta, Jun. AU - Yao, W. B.. AU - Abe, T.. AU - Teraoka, T.. AU - Kurozumi, Y.. PY - 1992/2. Y1 - 1992/2. N2 - We have studied the 3-mercaptopyruvate pathway (transamination pathway) of l-cysteine metabolism in rat liver mitochondria. l-Cysteine and other substrates at 10 mM concentration were incubated with mitochondrial fraction at pH 8.4, and sulfate and thiosulfate were determined by ion chromatography. When l-cysteine alone was incubated, sulfate formed was 0.7 μmol per mitochondria from one g of liver per 60 min. Addition of 2-oxoglutarate and GSH resulted in more than 3-fold increase in sulfate formation, and thiosulfate was formed besides sulfate. The sum (A + 2B) of sulfate (A) and thiosulfate (B) formed was approximately 7-times that with l-cysteine alone. Incubation with 3-mercaptopyruvate resulted in sulfate and thiosulfate formation, and sulfate ...
Neuroscience2014 | Per session
In eukaryotes, hydrogen sulfide (H2S) acts as a signaling molecule and cytoprotectant. It modulates synaptic transmission, relaxes smooth muscle, and regulates a release of insulin, endoplasmic reticulum stress and apoptosis. H2S also protects neurons and cardiac muscle from oxidative stress and ischemia reperfusion injury. H2S is known to be produced from L-cysteine by cystathionine β-synthase (CBS), cystathionine γ-lyase (CSE), and 3-mercaptopyruvate sulfurtransferase (3MST) coupled with cysteine aminotransferase (CAT). Here we report an additional biosynthetic pathway for the production of H2S from D-cysteine involving 3MST and D-amino acid oxidase (DAO). Unlike the L-cysteine pathway, this D-cysteine-dependent pathway seems to operate predominantly in the cerebellum and the kidney. Our study revealed that administration of D-cysteine protected primary cultures of cerebellar neurons from oxidative stress induced by H2O2 and attenuated ischemia-reperfusion injury in the kidney more than ...
EC 2.8.3 to 2.9.1
1b) L-aspartate89-[ribosomal protein S12]-methanethiol + S-adenosyl-L-methionine + reduced acceptor = 3-methylthio-L-aspartate89-[ribosomal protein S12] + L-methionine + 5-deoxyadenosine + oxidized receptor. Other name(s): RimO; [ribosomal protein S12]-Asp89:sulfur-(sulfur carrier),S-adenosyl-L-methionine C3-methylthiotransferase. Systematic name: [ribosomal protein S12]-L-aspartate89:sulfur-(sulfur carrier),S-adenosyl-L-methionine C3-methylthiotransferase. Comments: This bacterial enzyme binds two [4Fe-4S] clusters [2,3]. A bridge of five sulfur atoms is formed between the free Fe atoms of the two [4Fe-4S] clusters [6]. In the first reaction the enzyme transfers a methyl group from AdoMet to the external sulfur ion of the sulfur bridge. In the second reaction the enzyme catalyses the reductive fragmentation of a second molecule of AdoMet, yielding a 5-deoxyadenosine radical, which then attacks the methylated sulfur atom of the polysulfide bridge, resulting in the transfer of a methylthiol ...
SACOL RS08325 - AureoWiki
Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein S12 methylthiotransferase RimO (TIGR01125; EC 2.1.1.-,2.8.1.-; HMM-score: 295.7) ...
Construção do residencial Cidadão Manauara 2 beneficiará até mil famílias - Fato Amazônico
Na etapa A do residencial, a construção dos apartamentos já foi concluída e, agora, os trabalhos se concentram em asfaltamento, arborização e paisagismo, com previsão de entrega para janeiro de 2020. Serão beneficiadas 400 famílias selecionadas na lista de espera e mais cem famílias afetadas pelo incêndio no Educandos. Já na etapa B, as obras seguem em fase de construção e devem ser finalizadas até julho do próximo ano, seguindo as mesmas regras de distribuição da primeira etapa.. Ainda durante vistoria às obras, o prefeito também apontou o interesse em realizar uma nova rodada do Programa Habitacional do Servidor Público Municipal, que oferece apartamentos aos servidores por um preço abaixo de mercado, com abatimento no contracheque. É uma parceria que dá certo, porque nossos colaboradores conseguem sua casa própria com desconto no valor e o vendedor tem a segurança do pagamento, debitado automaticamente, descreveu.. Arthur também destacou que somando títulos ...
Suresh Kuchipudi
p,,br/,,/p, ,p class=shortcode-media shortcode-media-rebelmouse-proxy-image, ,img class=rm-shortcode data-rm-shortcode-id=37eb9eb1eb5ff5f23aef812d882a195d id=08dde type=lazy-image data-runner-src=https://assets.rebelmouse.io/eyJhbGciOiJIUzI1NiIsInR5cCI6IkpXVCJ9.eyJpbWFnZSI6Imh0dHBzOi8vbWVkaWEucmJsLm1zL2ltYWdlP3U9JTJGZmlsZXMlMkYzMTYxMDMlMkZvcmlnaW5hbCUyRmZpbGUtMjAyMDAyMTktMTEwMDUtcjhtZWkwLmpwZyUzRml4bGliJTNEcmItMS4xLjAlMjZxJTNEMzAlMjZhdXRvJTNEZm9ybWF0JTI2dyUzRDYwMCUyNmglM0Q0MDAlMjZmaXQlM0Rjcm9wJTI2ZHByJTNEMiZobz1odHRwcyUzQSUyRiUyRmltYWdlcy50aGVjb252ZXJzYXRpb24uY29tJnM9NjMwJmg9YTVhMjk2Mzg3MDI4YTIzM2NmZWRjNDQwODFkNmNjZWQxMTBmMzYwNDUwMDUzYjJhZDI0OTFjMzk0M2M0Y2U5MCZzaXplPTk4MHgmYz0yNjE0ODI3NTQ2IiwiZXhwaXJlc19hdCI6MTU5NTc2NjM3Nn0.H31dGZBryOFU-RtujBZWoa61gCSMeiwaNiSn7MIPTvg/img.jpg/, ,small class=image-media media-photo-credit placeholder=Add Photo Credit..., ,a ...
3-mercaptopyruvate | definition of 3-mercaptopyruvate by Medical dictionary
Looking for online definition of 3-mercaptopyruvate in the Medical Dictionary? 3-mercaptopyruvate explanation free. What is 3-mercaptopyruvate? Meaning of 3-mercaptopyruvate medical term. What does 3-mercaptopyruvate mean?
Identification of persulfide-binding and disulfide-forming cysteine residues in the NifS-like domain of the molybdenum cofactor...
The Moco (molybdenum cofactor) sulfurase ABA3 from Arabidopsis thaliana catalyses the sulfuration of the Moco of aldehyde oxidase and xanthine oxidoreductase, which represents the final activation step of these enzymes. ABA3 consists of an N-terminal NifS-like domain that exhibits L-cysteine desulfurase activity and a C-terminal domain that binds sulfurated Moco. The strictly conserved Cys430 in the NifS-like domain binds a persulfide intermediate, which is abstracted from the substrate L-cysteine and finally needs to be transferred to the Moco of aldehyde oxidase and xanthine oxidoreductase. In addition to Cys⁴³⁰, another eight cysteine residues are located in the NifS-like domain, with two of them being highly conserved among Moco sulfurase proteins and, at the same time, being in close proximity to Cys⁴³⁰. By determination of the number of surface-exposed cysteine residues and the number of persulfide-binding cysteine residues in combination with the sequential substitution of each ...
Dehydroepiandrosterone and dehydroepiandrosterone sulphotransferase activity and expression in human disease - eTheses...
The adrenal steroid dehydroepiandrosterone (DHEA) and its sulphate ester, DHEAS are the most abundant circulating steroid hormones in humans. Uncongugated DHEA predominately exerts its effects via its downstream conversion to active sex steroids in peripheral target tissues. In contrast the conversion of DHEAS to androgens first requires cleavage of the sulfate group, catalysed by the microsomal enzyme steroid sulfatase (STS). Conversely, DHEA is converted to inactive DHEAS by the activity of the cytosolic enzyme DHEA sulphotransferase (SULT2A1). However, in addition, evidence is growing that DHEA and DHEAS can have specific, direct effects. In this thesis, I have demonstrated that abrogation of DHEA metabolism can result in the manifestation of pathophysiological conditions. SULT2A1 requires 3-phosphoadenosine-5-phosphosulfate (PAPS) for catalytic activity. I have identified compound heterozygous mutations in the gene encoding human PAPS synthase 2 (PAPSS2) in a girl with androgen excess and ...
Persulfide formation on mitochondrial cysteine desulfurase: enzyme activation by a eukaryote-specific interacting protein and...
Cysteine desulfurases abstract sulfur from the substrate cysteine, generate a covalent persulfide on the active site cysteine of the enzyme, and then donate the persulfide sulfur to various recipients such as Fe-S clusters. In Saccharomyces cerevisiae, the Nfs1p protein is the only known cysteine desulfurase, and it forms a complex with Isd11p (Nfs1p·Isd11p). Both of these proteins are found primarily in mitochondria and both are essential for cell viability. In the present study we show, using the results of experiments with isolated mitochondria and purified proteins, that Isd11p is required for the cysteine desulfurase activity of Nfs1p. Whereas Nfs1p by itself was inactive, the Nfs1p·Isd11p complex formed persulfide and was active as a cysteine desulfurase. In the absence of Isd11p, Nfs1p was able to bind the substrate cysteine but failed to form a persulfide. Addition of Isd11p allowed Nfs1p with bound substrate to generate a covalent persulfide. We suggest that Isd11p induces an ...
Hydrogen Bond Interactions with Sulfur Donors<...
TY - JOUR. T1 - Hydrogen Bond Interactions with Sulfur Donors. AU - Sherry, A. D.. AU - Purcell, K. F.. PY - 1972/3/1. Y1 - 1972/3/1. N2 - Calorimetric enthalpy data are reported for the reactions of the acids, 1,1,1,3,3,3-hexafluoro-2-propanol and 2,2,2-trifluoroethanol, with six sulfur donors in CCl4 solution and four donors in hexane solution. Frequency shift data are also reported for the same two acids reacting with eight sulfur donors. Measurement of the heats of solution of each sulfur donor in both CCl4 and hexane allows us to estimate hexane enthalpies for the two donors whose enthalpies could not be measured directly in hexane. A comparison of oxygen and sulfur donor ΔH vs. ΔH and Δv vs. Δv equations reveals the greater importance of van der Waals repulsions in the sulfur donor reactions. The change in relative slopes of these equations may also be related to the greater importance of covalent contributions (CaCb term) to hydrogen bond formation with sulfur donors. The data adhere ...
Structural Evidence for Dimer-Interface-Driven Regulation of the Type II Cysteine Desulfurase, SufS. | Semantic Scholar
SufS is a type II cysteine desulfurase and acts as the initial step in the Suf Fe-S cluster assembly pathway. In Escherichia coli, this pathway is utilized under conditions of oxidative stress and is resistant to reactive oxygen species. Mechanistically, this means SufS must shift between protecting a covalent persulfide intermediate and making it available for transfer to the next protein partner in the pathway, SufE. Here, we report five X-ray crystal structures of SufS including a new structure of SufS containing an inward-facing persulfide intermediate on C364. Additional structures of SufS variants with substitutions at the dimer interface show changes in dimer geometry and suggest a conserved β-hairpin structure plays a role in mediating interactions with SufE. These new structures, along with previous HDX-MS and biochemical data, identify an interaction network capable of communication between active-sites of the SufS dimer coordinating the shift between desulfurase and transpersulfurase
Switch to Europe/Worldwide website
TSTD1, 0.25 mg. Thiosulfate sulfurtransferase like domain containing 1, also known as TSTD1, belongs to the family of transferases, specifically the sulfurtransferases, which transfer sulfur-containing groups.
Switch to Europe/Worldwide website
TSTD1, 50 µg. Thiosulfate sulfurtransferase like domain containing 1, also known as TSTD1, belongs to the family of transferases, specifically the sulfurtransferases, which transfer sulfur-containing groups.
Crystal structure of estrogen sulphotransferase<...
TY - JOUR. T1 - Crystal structure of estrogen sulphotransferase. AU - Kakuta, Y.. AU - Pedersen, L. G.. AU - Carter, C. W.. AU - Negishi, M.. AU - Pedersen, L. C.. N1 - Copyright: Copyright 2007 Elsevier B.V., All rights reserved.. PY - 1997. Y1 - 1997. N2 - The structure of estrogen sulphotransferase has been solved in the presence of inactive cofactor PAP and substrate 17β-estradiol. This structure reveals structural similarities between cytosolic sulphotransferases and nucleotide kinases.. AB - The structure of estrogen sulphotransferase has been solved in the presence of inactive cofactor PAP and substrate 17β-estradiol. This structure reveals structural similarities between cytosolic sulphotransferases and nucleotide kinases.. UR - http://www.scopus.com/inward/record.url?scp=0030670315&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=0030670315&partnerID=8YFLogxK. U2 - 10.1038/nsb1197-904. DO - 10.1038/nsb1197-904. M3 - Article. C2 - 9360604. AN - ...
Mitochondrial Iba57p Is Required for Fe/S Cluster Formation on Aconitase and Activation of Radical SAM Enzymes | Molecular and...
We have identified a novel component of the mitochondrial ISC assembly system, Iba57p (previously termed Caf17p), in a genome-wide screen for S. cerevisiae mutants that carry a coupled lysine and glutamate auxotrophy, which is indicative of defects of aconitase and homoaconitase maturation. Iba57p was demonstrated to be crucial for de novo Fe/S cluster incorporation into these mitochondrial aconitase-type Fe/S proteins. In addition, Iba57p is required for the in vivo enzymatic functions of the mitochondrial radical-SAM Fe/S proteins biotin synthase and lipoic acid synthase. Iba57p interacts with Isa1p and Isa2p, a finding consistent with the virtually identical phenotypes of isa1Δ, isa2Δ and iba57Δ cells (29, 31, 48). No defects in the maturation of other Fe/S proteins were detected in cells depleted for Iba57p or Isa1p/Isa2p (Mühlenhoff et al., unpublished). In addition, the deregulated iron homeostasis that is typical of cells with general defects in the mitochondrial ISC assembly and ...
EC 2.8.2.4
Accepted name: estrone sulfotransferase. Reaction: 3-phosphoadenylyl sulfate + estrone = adenosine 3,5-bisphosphate + estrone 3-sulfate. Glossary: 3-phosphoadenylyl sulfate = PAPS. Other names: 3-phosphoadenylyl sulfate-estrone 3-sulfotransferase; estrogen sulfotransferase; estrogen sulphotransferase; oestrogen sulphotransferase; 3-phosphoadenylylsulfate:oestrone sulfotransferase. Systematic name: 3-phosphoadenylyl-sulfate:estrone 3-sulfotransferase. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, PDB, CAS registry number: 9026-06-6. References:. 1. Adams, J.B. and Poulos, A. Enzymic synthesis of steroid sulphates. 3. Isolation and properties of estrogen sulphotransferase of bovine adrenal glands. Biochim. Biophys. Acta 146 (1967) 493-508. [PMID: 4965224]. 2. Rozhin, J., Zemlicka, J. and Brooks, S.C. Studies on bovine adrenal estrogen sulfotransferase. Inhibition and possible involvement of adenine-estrogen stacking. J. Biol. Chem. 252 (1967) 7214-7220.. 3. Adams, J.B., Ellyard, ...
Phenolsulphotransferase in human tissue: Radiochemical enzymatic assay and biochemical properties<...
TY - JOUR. T1 - Phenolsulphotransferase in human tissue. T2 - Radiochemical enzymatic assay and biochemical properties. AU - Anderson, Robert J.. AU - Weinshilboum, R. M.. PY - 1980/4/11. Y1 - 1980/4/11. N2 - Phenolsulphotransferase (EC 2.8.2.1) (PST) is an important catecholamine and drug metabolizing enzyme. Optimal conditions have been determined for the accurate measurement of PST activity in the human platelet, human renal cortex, and human jejunum with a radiochemical microassay. 3-Methoxy-4-hydroxyphenylglycol (MHPG) and 35S-3-phosphoadenosine-5-phosphosulfate (35S-PAPS) were the substrates for the reaction. The apparent Michaelis-Menten (Km) values for MHPG with platelet, renal cortex, and jejunum were 1.09, 0.46 and 1.16 mmol/l, respectively. Apparent Km values for PAPS in the same tissues were 0.14, 0.13 and 0.21 μmol/l. The pH optimum of the reaction in all three tissues was approximately 6.2-6.8 with three different buffer systems. The coefficients of variation for the assay of ...
Day 327 (18q12.2-18q12.3): MOCOS, helping molybdenum-containing enzymes | Genome Year
Day 327 has 12 protein-coding genes (browser view) including MOCOS (molybdenum cofactor sulfurase).. MOCOS is important to the function of the four human enzymes that contain the element molybdenum.. Click here to see all 8930365 letters of Day 327 with MOCOS underlined.. ...
Gentaur Molecular :ATGen \ Thiosulfate sulfurtransferase, 1 297 aa, Human, E.coli \ ATGP0423
Gentaur molecular products has all kinds of products like :search , ATGen \ Thiosulfate sulfurtransferase, 1_297 aa, Human, E.coli \ ATGP0423 for more molecular products just contact us
Rhodanese-like domain-containing protein elisa and antibody
Shop Rhodanese-like domain-containing protein ELISA Kit, Recombinant Protein and Rhodanese-like domain-containing protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
BIOB 160N : Principles of Living Systems - Montana - Course Hero
Here is the best resource for homework help with BIOB 160N : Principles of Living Systems at Montana. Find BIOB160N study guides, notes, and practice tests
B2ULZ9 | SWISS-MODEL Repository
SWISS-MODEL Repository entry for B2ULZ9 (RIMO_AKKM8), Ribosomal protein S12 methylthiotransferase RimO. Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC81048 / CCUG 64013 / CIP 107961 / Muc)
Succinyl-CoA--D-citramalate CoA-transferase elisa and antibody
Shop Succinyl-CoA--D-citramalate CoA-transferase ELISA Kit, Recombinant Protein and Succinyl-CoA--D-citramalate CoA-transferase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
NFS1 (YCL017C) Result Summary | BioGRID
Cysteine Desulfurase; Involved In Iron-sulfur Cluster (Fe/S) Biogenesis And In Thio-modification Of Mitochondrial And Cytoplasmic TRNAs; Essential Protein Located Predominantly In Mitochondria
Caracterização genética e avaliação da diversidade de leveduras associadas a bromélias no Parque de Itapuã-Viamão/RS
Durante o período de abril de 2004 a fevereiro de 2007, foram coletadas 73 amostras de folhas de bromélias do Parque de Itapuã, Viamão, RS, com o objetivo de descrever as espécies de leveduras presentes, elucidar a ecologia destes microrganismos nesse habitat e avaliar o perfil enzimático das leveduras isoladas. Fragmentos das folhas foram submetidos a lavagens sucessivas com 0,5% Tween 20. Diluições decimais seriadas da última lavagem, amostras de água dos tanques de bromélias e de flores foram inoculadas em meio YM (levedura-malte) modificado e incubadas a 25°C por 5-7 dias. Representantes dos diferentes morfotipos foram selecionados, purificados e mantidos a 4ºC até a caracterização molecular. Dos 178 isolados obtidos, 148 foram identificados por meio do seqüenciamento da região D1/D2 do rDNA e/ou ITS, sendo 6% de afinidade ascomicética e 94% de afinidade basidiomicética. Do total identificado, cerca de 61% são espécies ainda não descritas de leveduras. Os gêneros ...
LILACS - Resultado p gina 1
Trata-se de uma pesquisa qualitativa com m todo descritivo, cujos objetivos s o descrever a rede social de apoio s fam lias para a promo o do desenvolvimento infantil, na perspectiva das fam lias e identificar a atua o da rede social de apoio s fam lias para a promo o do desenvolvimento infantil. O estudo foi realizado em um munic pio da regi o metropolitana de Curitiba em tr s unidades de sa de com Estrat gia de Sa de da Fam lia que apresentavam o maior n mero de crian as entre zero e cinco anos na sua rea de abrang ncia. A coleta das informa es ocorreu no per odo de outubro de 2009 a fevereiro de 2010. Participaram da pesquisa 85 representantes de fam lias que possuem crian as entre zero e cinco anos e residem na rea de abrang ncia das tr s unidades de sa de. Os dados foram coletados pelas t cnicas de entrevista semiestruturada, realizada com as 85 fam lias e tr s sess es de grupo focal, das quais participaram 19 das 85 fam lias entrevistadas, e analisados segundo an lise de conte do tem tica. ...
Defesa da tese de doutorado de Luciana Ribeiro Martins » MZUSP - Museu de Zoologia da USP
Resumo. Atualmente a ordem Dendrochirotida é composta por 700 espécies, sendo que metade destas estão entre as famílias Sclerodactylidae e Phyllophoridae. Todavia, a maior parte das informações acerca dos seus táxons é proveniente de revisões morfológicas muito antigas (Phyllophoridae em 1954, e Sclerodactylidae não revisada). Este estudo, portanto, se configura como o primeiro teste formal da monofilia das famílias Sclerodactylidae e Phylllophoridae e suas subfamílias. O presente trabalho constitui um estudo morfológico minucioso das estruturas que compõem o endoesqueleto dos Holothuroidea que são os ossículos dérmicos e anel calcário, vislumbrando alcançar através de uma análise cladística os objetivos descritos a seguir: (i) testar a monofilia de Phyllophoridae; (ii) testar a monofilia de Sclerodactylidae; (iii) testar a monofilia das subfamílias de Phyllophoridae e (iv) testar a monofilia das subfamílias de Sclerodactylidae. O material estudado foi obtido a partir de ...
Defesa da tese de doutorado de Luciana Ribeiro Martins » MZUSP - Museu de Zoologia da USP
Resumo. Atualmente a ordem Dendrochirotida é composta por 700 espécies, sendo que metade destas estão entre as famílias Sclerodactylidae e Phyllophoridae. Todavia, a maior parte das informações acerca dos seus táxons é proveniente de revisões morfológicas muito antigas (Phyllophoridae em 1954, e Sclerodactylidae não revisada). Este estudo, portanto, se configura como o primeiro teste formal da monofilia das famílias Sclerodactylidae e Phylllophoridae e suas subfamílias. O presente trabalho constitui um estudo morfológico minucioso das estruturas que compõem o endoesqueleto dos Holothuroidea que são os ossículos dérmicos e anel calcário, vislumbrando alcançar através de uma análise cladística os objetivos descritos a seguir: (i) testar a monofilia de Phyllophoridae; (ii) testar a monofilia de Sclerodactylidae; (iii) testar a monofilia das subfamílias de Phyllophoridae e (iv) testar a monofilia das subfamílias de Sclerodactylidae. O material estudado foi obtido a partir de ...
Course Description
Human Anat Phys I. Prerequisite: BIOB 101 or BIOB 160 or CHMY 105 or CHMY 121 or instructors consent.This course is an introduction to anatomical methodology and physiological mechanisms. Students become familiar with the systematic organization of the human body at both the micro- and macro-structural levels, the normal functions of each organ in a particular system, and the interrelationships between structure and function. Specifically covered in this semester are an introduction to histology and the integumentary, skeletal, nervous, muscular, and endocrine systems. Laboratory included. ...
NFSv4: Clean up the OPEN/CLOSE serialisation code
NFSv4: Clean up the OPEN/CLOSE serialisation code Reduce the time spent locking the rpc_sequence structure by queuing the nfs_seqid only when we are ready to take the lock (when calling nfs_wait_on_sequence). Signed-off-by: Trond Myklebust ,[EMAIL PROTECTED], --- fs/nfs/nfs4proc.c , 30 +++++++++++------------------- fs/nfs/nfs4state.c , 32 ++++++++++++++++---------------- 2 files changed, 27 insertions(+), 35 deletions(-) diff --git a/fs/nfs/nfs4proc.c b/fs/nfs/nfs4proc.c index 9e2e1c7..a51a753 100644 --- a/fs/nfs/nfs4proc.c +++ b/fs/nfs/nfs4proc.c @@ -3331,15 +3331,12 @@ static struct nfs4_lockdata *nfs4_alloc_lockdata(struct file_lock *fl, p-,arg.fh = NFS_FH(inode); p-,arg.fl = &p-,fl; - if (!(lsp-,ls_seqid.flags & NFS_SEQID_CONFIRMED)) { - p-,arg.open_seqid = nfs_alloc_seqid(&lsp-,ls_state-,owner-,so_seqid); - if (p-,arg.open_seqid == NULL) - goto out_free; - - } + p-,arg.open_seqid = nfs_alloc_seqid(&lsp-,ls_state-,owner-,so_seqid); + if (p-,arg.open_seqid == NULL) + goto out_free; ...
S)-(-)-α-Lipoic Acid | CAS: 1077-27-6 | (S)-(-)-α-Lipoic Acid Supplier
Clinivex is a high quality reference standard supplier of (S)-(-)-α-Lipoic Acid, CAS no - 1077-27-6. View more information regarding (S)-(-)-α-Lipoic Acid, including solubility, MSDS & more.
Famílias inseridas no arranjo produtivo informal da produção de joias e bijuterias...
Introdução: A informalidade no mercado de trabalho assola muitas economias em desenvolvimento e é uma característica notável da produção de joias e bijuterias em Limeira, São Paulo, um dos maiores polos...
Avanços e limites da reforma agrária no sul do Pará: um estudo a partir do projeto...
Os projetos de assentamento sob jurisdição da Superintendência Regional de Marabá apresentam uma série de dificuldades em relação à evasão de um número considerável de famílias assentadas. Frequentemente...
Tst - Thiosulfate sulfurtransferase - Rattus norvegicus (Rat) - Tst gene & protein
Together with MRPL18, acts as a mitochondrial import factor for the cytosolic 5S rRNA. Only the nascent unfolded cytoplasmic form is able to bind to the 5S rRNA (By similarity). Involved in the formation of iron-sulfur complexes, cyanide detoxification or modification of sulfur-containing enzymes. Other thiol compounds, besides cyanide, can act as sulfur ion acceptors. Also has weak mercaptopyruvate sulfurtransferase (MST) activity.
GOT1 gene - Genetics Home Reference - NIH
Biosynthesis of L-glutamate from L-aspartate or L-cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H(2)S via the action of 3-mercaptopyruvate sulfurtransferase (3MST). Hydrogen sulfide is an important synaptic modulator and neuroprotectant in the brain. ...
Neonatal hypoglycaemia in severe succinyl-CoA: 3-oxoacid CoA-transferase deficiency
Succinyl-CoA: 3-oxoacid CoA-transferase (SCOT) deficiency is an inborn error of ketone body utilization, characterized by intermittent ketoacidotic crises and persistent ketosis. The diagnosis was suspected in a patient who presented with hypoglycaemia, ketoacidosis and coma at 4 days of age. The hy …
Overexpression of EsMcsu1 from the halophytic plant Eutrema salsugineum promotes abscisic acid biosynthesis and increases...
The stress phytohormone abscisic acid (ABA) plays pivotal roles in plants adaptive responses to adverse environments. Molybdenum cofactor sulfurases influence aldehyde oxidase activity and ABA biosynthesis. In this study, we isolated a novel EsMcsu1 gene encoding a molybdenum cofactor sulfurase from Eutrema salsugineum. EsMcus1 transcriptional patterns varied between organs, and its expression was significantly upregulated by abiotic stress or ABA treatment.
Sabinet | Current knowledge of the effect of tibolone on the breast and uterus : an extract from the guidelines for the use of...
Tibolone is an analogue of the progestin, norethynodrel. After ingestion, it is converted to three metabolites, namely 3 alpha and 3 beta hydroxytibolone which have oestrogenic effects, and delta 4 isomerase, which has progestogenic and androgenic properties. Both the oestrogenic metabolites bind to the alpha oestrogen receptor, but not the beta oestrogen receptor, whilst the delta 4 isomer binds to the alpha and beta oestrogen, the progestogen and the androgen receptors. Tibolone also is a sulphatase inhibiter, blocking conversion of oestrone sulphate to oestrone, as well as stimulating local sulphotransferase activity. In contrast to other forms of postmenopausal hormonal therapy, it decreases sex hormone binding globulin and hence increases circulating free testosterone, and thereby further adding to its androgenicity. Tibolone significantly decreases vasomotor symptoms, mood disorders, insomnia, bone loss, vaginal atrophy. It has a favourable impact on the cardiovascular system and minimal impact on
Results for Cystathionine γ-lyase : Scipedia
Abstract. Traditionally, hydrogen sulfide (H2S) was simply considered as a toxic and foul smelling gas, but recently H2S been brought into the spot light of cardiovascular research and development. Since the 1990s, H2S has been mounting evidence of physiological properties such as immune modification, vascular relaxation, attenuation of oxidative stress, inflammatory mitigation, and angiogenesis. H2S has since been recognized as the third physiological gaseous signaling molecule, along with CO and NO [65, 66]. H2S is produced endogenously through several key enzymes, including cystathionine β-lyase (CBE), cystathionine γ-lyase (CSE), and 3-mercaptopyruvate sulfurtransferase (MST)/cysteine aminotransferase (CAT). These specific enzymes are expressed accordingly in various organ systems and CSE is the predominant H2S-producing enzyme in the cardiovascular system. The cystathionine γ-lyase (CSE)/H2S pathway has demonstrated various cardioprotective effects, including anti-atherosclerosis, ...
Results for Ischemia-reperfusion injury : Scipedia
Abstract. Traditionally, hydrogen sulfide (H2S) was simply considered as a toxic and foul smelling gas, but recently H2S been brought into the spot light of cardiovascular research and development. Since the 1990s, H2S has been mounting evidence of physiological properties such as immune modification, vascular relaxation, attenuation of oxidative stress, inflammatory mitigation, and angiogenesis. H2S has since been recognized as the third physiological gaseous signaling molecule, along with CO and NO [65, 66]. H2S is produced endogenously through several key enzymes, including cystathionine β-lyase (CBE), cystathionine γ-lyase (CSE), and 3-mercaptopyruvate sulfurtransferase (MST)/cysteine aminotransferase (CAT). These specific enzymes are expressed accordingly in various organ systems and CSE is the predominant H2S-producing enzyme in the cardiovascular system. The cystathionine γ-lyase (CSE)/H2S pathway has demonstrated various cardioprotective effects, including anti-atherosclerosis, ...
GTOP nfar0:bioD
GT:ID BAD56666.1 GT:GENE bioD GT:PRODUCT putative dethiobiotin synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1987153..1987884 GB:FROM 1987153 GB:TO 1987884 GB:DIRECTION + GB:GENE bioD GB:PRODUCT putative dethiobiotin synthetase GB:PROTEIN_ID BAD56666.1 LENGTH 243 SQ:AASEQ MNTLLVTGTSTDVGKTVVTAALTALARAEALPVAVCKPAQTGVAPGEPGDLAEVRRLAGPVPTLELARYPEPLAPDTAARRCGAPLLTLDETATAVRGLDAELTVVEGAGGLLVRIGEFTLLDLARELDAPVLVVAAAGLGTLNHTELTIRALDAAGVRCAGVVIGAWPAEPDLASVCNREDLPRLTGVPIVGAVPAGVGAWDHDRFTAAVPGWFAPGWSPRLPFNSDSPPSTWGFDTSQSGT GT:EXON 1,1-243:0, SW:ID BIOD_NOCFA SW:DE RecName: Full=Dethiobiotin synthetase; EC=6.3.3.3;AltName: Full=Dethiobiotin synthase;AltName: Full=DTB synthetase; Short=DTBS; SW:GN Name=bioD; OrderedLocusNames=NFA_18200; SW:KW ATP-binding; Biotin biosynthesis; Complete proteome; Ligase;Magnesium; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1-,243,BIOD_NOCFA,e-114,100.0,243/243, GO:SWS:NREP 4 GO:SWS GO:0005524,GO:ATP ...
Neonatal hypoglycaemia in severe succinyl-CoA: 3-oxoacid CoA-transferase deficiency. - PubMed - NCBI
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Developmental changes in the isoelectric variants of rat hepatic hydroxysteroid sulphotransferase | Biochemical Journal |...
Major isoenzymes of androsterone-sulphating sulphotransferase (AD-ST) were isolated from liver cytosols of weanling and young adult female rats and their isoelectric properties were compared. On chromatofocusing the enzyme activity of young adults was eluted over a wider range of pH than was that of weanling rats. The activity at pH 7.8-7.2 (fraction I) is obvious at both ages, whereas the activity eluted over the pH 6.6-5.5 range (fraction II) is much lower in weanlings than in young adults. The AD-ST activities eluted in fractions I and II were separately purified by 3′-phosphoadenosine 5′-phosphate-agarose affinity chromatography at both ages. Two-dimensional gel electrophoresis of the isolated enzyme revealed several subunits with distinct pI values, but with the same molecular mass, namely 30 kDa. The relative levels of the pI 6.7 and pI 7.2 subunits are high and the relative level of the pI 6.1 is low in fraction I. In fraction II, the levels of pI 6.1 and pI 6.7 subunits are high and ...
RCSB PDB
- 1DAM: DETHIOBIOTIN SYNTHETASE COMPLEXED WITH DETHIOBIOTIN, ADP, INORGANIC PHOSPHATE AND MAGNESIUM...
1DAM: Crystal structure of two quaternary complexes of dethiobiotin synthetase, enzyme-MgADP-AlF3-diaminopelargonic acid and enzyme-MgADP-dethiobiotin-phosphate; implications for catalysis.
Golden Barrel 1 Qt. Sulfur-Free Blackstrap Molasses - 12/Case
Shop Golden Barrel 1 Qt. Sulfur-Free Blackstrap Molasses - 12/Case. In stock at a low price and ready to ship same day from WebstaurantStore.
Sulfur-Free Titanium Standard: Ti @ 5000 µg/g in Hydrocarbon Oil
Buy Sulfur-Free Titanium Standard: Ti @ 5000 µg/g in Hydrocarbon Oil online with LGC Standards, for highly accurate industrial analysis and testing.
MRPL18 - 39S ribosomal protein L18, mitochondrial precursor - Homo sapiens (Human) - MRPL18 gene & protein
Together with thiosulfate sulfurtransferase (TST), acts as a mitochondrial import factor for the cytosolic 5S rRNA. The precursor form shows RNA chaperone activity; is able to fold the 5S rRNA into an import-competent conformation that is recognized by rhodanese (TST). Both the cytoplasmic and mitochondrial forms are able to bind to the helix IV-loop D in the gamma domain of the 5S rRNA.
SWISS-MODEL Repository | P9WHF4
SWISS-MODEL Repository entry for P9WHF4 (THT3_MYCTO), Putative thiosulfate sulfurtransferase SseB. Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
L-carnitine CoA-transferase CaiB (IPR023452) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Lipoic Acid: its antioxidant and anti-inflammatory role and clinical applications
Lipoic acid (LA) is an antioxidant able to produce its effects in aqueous or lipophilic environments. Lipoate is the conjugate base of lipoic acid, and the most prevalent form of LA under physiological conditions. It presents a highly negative reduction potential, increases the expression of antioxi …
Lipoic EF - Tissue Recovery, BioPro Inc.
Lipoic acid is absorbed quickly, but it is also removed quickly by the liver. For lipoic acid to be effective, it needs to reach the tissue it is suppose to protect. Most studies have used a fast release form which is what you find in Lipoic EF. The most commonly used dosage has been 600 mg once or twice daily, which is the same as 2 tablets of Lipoic EF once or twice daily. This dosage allows more of the lipoic acid to reach the target tissue for better results. ...
SAUSA300 RS12475 - AureoWiki
Genetic information processingProtein fateProtein modification and repairglycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 7.2) ...
Taiwan July manufacturing production index up on month, year, says MOEA
Taiwan recorded manufacturing production index (2016 as base year) of 112.20 for July 2019, increasing 5.22% on month and 3.07% on year, according to statistics released by the Ministry of Economic Affairs (MOEA) on August 23.
Test Day:2010-02-04 NFS - Fedora Project Wiki
Basically, this can be tested with both server and client on the same machine, and with different bare-metal or virtual systems. It will need to setup a NFS server, and run some automated NFS testsuites for it from clients. In addition, we will use generic filesystem testsuites to exercise NFS filesystem. An important part of the test event is to make sure everything is working properly after we have switched to NFSv4 by default in F13, http://fedoraproject.org/wiki/Features/NFSv4Default Also, we will test Secure NFS as well. All the results will be reported to the table below. ...
Heartwishes ePUB ¼ Paperback
free Heartwishes, Heartwishes pdf, Heartwishes pdf free,Heartwishes pdf download, Heartwishes epub, Heartwishes ebook, Heartwishes read online, Heartwishes pdf download, Heartwishes epub, Heartwishes kindle, Heartwishes Mobi - Heartwishes ePUB ¼ Gemma Ranford uer tanto obter o emprego oferecido para catalogar os documentos de uma das famílias mais antigas de Edilian a família Frazier ue está disposta a lutar por ele Fascinada por História e desesperada por terminar a sua tese de dissertação Gemma acredita ue aueles papéis lhe fornecerão novas informações essenciais para imprimirem novo fôlego à sua i.
R)-Lipoic Acid | Nutrition Review
Unique Mitochondrial Antioxidant Fights Premature Aging By Jim English Alpha-lipoic acid (ALA) is a unique, vitamin-like antioxidant that can combat radiation
Re: Tracking of NFS artifacts
2011/10/8 Mats Erik Andersson ,[email protected],: , Dear all, , , let me begin a thread tracking issues with NFS, a package , collection in need for better examination, as we were told , a few days ago. Please could you use the BTS? -- Robert Millan ...
LEGO® creations that Delatron 3000 likes : MOCpages.com
MOCs 2012-2014 by Crimso Giger Im not very active here (to say the least) since... well 2011 I think, and thats a long time ! But I still visit the the ... ...