Aerococcus viridans ATCC ® 10400™ Designation: TypeStrain=False Application: Enterococco detection Quality control strain Water testing
0010]In an interesting embodiment, the methylotrophic and/or methanotrophic microorganism has been cultured on a substrate comprising as the primary carbon and/or energy source a compound which is partly (compared to a carbohydrate) or fully reduced (or which contains carbon in a lower oxidation state than in carbon dioxide), such as on a substrate that, as the primary carbon and/or energy source, contains a compound having a ratio C/C+O (no. of carbon atoms/{no. of carbon atoms+no. of oxygen atoms}) in the range 0.6-1.0, such as in the range 0.8-1.0 or in the range 0.9-1.0. The substrate can comprise a compound selected from: an alkane, preferably a C1-C6 alkane, such as methane, ethane, propane or n-butane; an alkanol, preferably a C1-C6 alkanol, such as ethanol or methanol; and an alkene, preferably a C2-C6 alkene, such ethylene, propylene, or 1-butylene. Conveniently, the methylotrophic and/or methanotrophic microorganisms have been produced by fermentation on a substrate containing a ...
In investigating influenza in an immunodeficient child in China, in December 2010, we found that the influenza virus showed high sequence identity to that of swine. Serologic evidence indicated that viral persistence in pigs was the source of infection. Continued surveillance of pigs and systemic analysis of swine influenza isolates are needed.
Abiotrophia balaenopterae Lawson et al. 1999, sp. nov. (Part 2) Abiotrophia elegans Roggenkamp et al. 1999, sp. nov. (Part 1) Acidovorax defluvii Schulze et al. 1999, sp. nov. (Part 4) Actinobacillus succinogenes Guettler et al. 1999, sp. nov. (Part 1) Actinobispora alaniniphila Xu et al. 1999, sp. nov. (Part 2) Actinobispora aurantiaca Xu et al. 1999, sp. nov. (Part 2) Actinobispora xinjiangensis Xu et al. 1999, sp. nov. (Part 2) Actinomyces bowdenii Pascual et al. 1999, sp. nov. (Part 4) Aerococcus christensenii Collins et al. 1999, sp. nov. (Part 3) Agrobacterium meteori Rüger and Höfle 1992 is assigned to be a synonym of Agrobacterium atlanticum Rüger and Höfle 1992. (Part 1) Agrococcus citreus Wieser et al. 1999, sp. nov. (Part 3) Ahrensia Uchino et al. 1999, gen. nov. (Part 1) Ahrensia kielensis corrig. (ex Ahrens 1968) Uchino et al. 1999, sp. nov., nom. rev. - Synonym: Agrobacterium kieliense Ahrens 1968. (Part 1) Alterococcus Shieh and Jean 1999, gen. nov. (Part 2) Alterococcus ...
LOPARDO, Horacio A.. Abiotrophia and Granulicatella. Rev. argent. microbiol. [online]. 2006, vol.38, n.3, pp. 164-182. ISSN 1851-7617.. The nutritionally variant streptococci (NVS) belong to two genera: Abiotrophia and Granulicatella. NVS grow in culture media with 0.001% pyridoxal hydrochloride (PHC) and 0.1% cysteine hydrochloride (CysHC). These bacteria need the help of other organisms to grow on common solid media showing the effect known as "satellitism". Both, satellitism and the pyrrolidonilarilamidase test are the key tests for suspecting the presence of NVS. They can grow as a faint haze on blood agar or chocolate agar prepared with the Columbia agar base without adding any other substance. The most frequently documented infections are endocarditis. Among extravascular infections, ocular infections predominate. For antimicrobial susceptibility testing, the Etest and dilution methods with the addition of 0.001% PHC can be used. Whichever the method there does not seem to be much ...
Here you can find the definitions list for the word Gaffkya anaerobia. Also you can find some other opposite words using the online search on our website.
A species of gram-positive, facultatively anaerobic bacteria in the family STREPTOCOCCACEAE. It is a normal inhabitant of the human oral cavity, and causes DENTAL PLAQUE and ENDOCARDITIS. It is being investigated as a vehicle for vaccine delivery ...
CP000859.PE590 Location/Qualifiers FT CDS 660321..661238 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Dole_0590" FT /product="peptidase U61 LD-carboxypeptidase A" FT /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG: FT sth:STH2808 putative muramoyltetrapeptide carboxypeptidase" FT /db_xref="EnsemblGenomes-Gn:Dole_0590" FT /db_xref="EnsemblGenomes-Tr:ABW66400" FT /db_xref="GOA:A8ZU88" FT /db_xref="InterPro:IPR003507" FT /db_xref="InterPro:IPR027461" FT /db_xref="InterPro:IPR027478" FT /db_xref="InterPro:IPR029062" FT /db_xref="InterPro:IPR040449" FT /db_xref="InterPro:IPR040921" FT /db_xref="UniProtKB/TrEMBL:A8ZU88" FT /protein_id="ABW66400.1" FT /translation="MDLAPMSKIKPRALAFGDTIGIAAPAGAFDADRLEKGLSVLQAMG FT FLVRLPDGTHASQRYLAGTDEHRAAMFNNLFADPEIKAVACARGGFGALRMAPLLDMDA FT ITRHPKIFLGFSDISVLLSILGRKAGLITFHGPVVTSLADADDATIASLADALTTTEPL FT RIDLAEGMSLVPGTAQGPVAGGNLASLCQMIGTPWQPAFDGCILFLEETSEPAYRVDRM FT LTQMRLAGCLAGVAGVALGRFDRCGHMDVIFEIVREHLPEGVPVLAGFPVGHNGTNRTL FT PLGVWASLDAENRFLEYHEPALAR" ...
Data for the Middletown Area Studies were collected every year from 1978 to 1998. The purpose of these studies was to assess the views and lifestyles of citizens on a diverse range of subjects. The major topics included questions on life satisfaction, education, income, family, religion, and politics. The 1998 study was designed to assess the nature of congregations, the unchurched, and caregiving in Middletown.
TY - JOUR. T1 - MALDI-TOF-MS fingerprinting provides evidence of urosepsis caused by Aerococcus urinae. AU - Kim, Jieun. AU - Hong, Sung Kuk. AU - Kim, Myungsook. AU - Yong, Dongeun. AU - Lee, Kyungwon. PY - 2017/1/1. Y1 - 2017/1/1. N2 - Urosepsis due to Aerococcus urinae is rare in clinical settings with only a few of reported cases worldwide by 16S rRNA sequencing. Here we report a case of sepsis caused by A. urinae in a 86 year-old male with complicated urinary tract infection which was confirmed through peptide mass fingerprinting of matrix-assisted laser desorption ionization time of flight mass spectrometry.. AB - Urosepsis due to Aerococcus urinae is rare in clinical settings with only a few of reported cases worldwide by 16S rRNA sequencing. Here we report a case of sepsis caused by A. urinae in a 86 year-old male with complicated urinary tract infection which was confirmed through peptide mass fingerprinting of matrix-assisted laser desorption ionization time of flight mass ...
Aerococcus is a genus in the phylum Firmicutes (Bacteria). The genus was first identified in 1953 from samples of air and dust as a catalase-negative, Gram-positive coccus that grew in small clusters. They were subsequently found in hospital environments and meat-curing brines. It has been difficult to identify as it resembles alpha-hemolytic Streptococcus on blood agar plates and is difficult to identify by biochemical means. Sequencing of 16S rRNA has become the gold standard for identification, but other techniques such as MALDI-TOF have also been useful for identifying both the genus and species. The name Aerococcus derives from the Greek aer, aeros (ἀήρ, ἀέρος), air; New Latin coccus (from Greekkokkos (κόκκος)), a berry; New Latin Aerococcus, air coccus. The name was given based on its round shape and that it was first discovered in air samples. The genus contains these species: A. christensenii Collins et al., 1999, named after the Danish microbiologist Jens J. Christensen ...
I am just taking a stab at this!* I have no experience with this but have been thinking about it! Ive done a little bit of research on aerococcus viridans and it seems as though its not only an airborne bacteria but is normally confused with Streptococcus and Staphylococcus as they have a lot of the same characteristics. Baytril doesnt kill either of these, but Septrin (Bactrim) does. How long was he on Bactrim? 10-14 days is normal to clear up. But if its something worse, it can be given up to 6 weeks! Which Im in the process of now ...
The pentose phosphate pathway is a process of glucose turnover that produces NADPH as reducing equivalents and pentoses as essential parts of nucleotides. There are two different phases in the pathway. One is irreversible oxidative phase in which glucose-6P is converted to ribulose-5P by oxidative decarboxylation, and NADPH is generated [MD:M00006]. The other is reversible non-oxidative phase in which phosphorylated sugars are interconverted to generate xylulose-5P, ribulose-5P, and ribose-5P [MD:M00007]. Phosphoribosyl pyrophosphate (PRPP) formed from ribose-5P [MD:M00005] is an activated compound used in the biosynthesis of histidine and purine/pyrimidine nucleotides. This pathway map also shows the Entner-Doudoroff pathway where 6-P-gluconate is dehydrated and then cleaved into pyruvate and glyceraldehyde-3P [MD:M00008 ...
ID PRSA_LACLC Reviewed; 299 AA. AC P0C2B5; P14308; P15294; Q53962; Q9AIQ3; DT 09-JAN-2007, integrated into UniProtKB/Swiss-Prot. DT 09-JAN-2007, sequence version 1. DT 22-NOV-2017, entry version 59. DE RecName: Full=Foldase protein PrsA; DE EC=5.2.1.8; DE AltName: Full=Protease maturation protein PrtM; DE Flags: Precursor; GN Name=prsA; Synonyms=prtM; OS Lactococcus lactis subsp. cremoris (Streptococcus cremoris). OG Plasmid pLP763, Plasmid pWV05, and Plasmid pHP003. OC Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; OC Lactococcus. OX NCBI_TaxID=1359; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC STRAIN=Wg2; RX PubMed=2708318; DOI=10.1128/jb.171.5.2789-2794.1989; RA Haandrikman A.J., Kok J., Laan H., Soemitro S., Ledeboer A.M., RA Konings W.N., Venema G.; RT "Identification of a gene required for maturation of an extracellular RT lactococcal serine proteinase."; RL J. Bacteriol. 171:2789-2794(1989). RN [2] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC STRAIN=NCDO 763 / ML3; ...
ID STRP0_1_PE1279 STANDARD; PRT; 87 AA. AC STRP0_1_PE1279; D6ZSB8; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE SubName: Full=Plasmid stabilization system protein; (STRP0_1.PE1279). GN OrderedLocusNames=HMPREF0837_11279; OS STREPTOCOCCUS PNEUMONIAE TCH8431/19A. OC Bacteria; Firmicutes; Lactobacillales; Streptococcaceae; Streptococcus. OX NCBI_TaxID=525381; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS STRP0_1.PE1279. CC Streptococcus pneumoniae TCH8431/19A chromosome, complete genome. CC chromosome 1, complete sequence. CC -!- ANNOTATIONS ORIGIN:D6ZSB8_STRP0 CC -!- GENE_FAMILY: HOG000219995 [ FAMILY / ALN / TREE ] DR UniProtKB/Swiss-Prot; D6ZSB8; -. DR EMBL; CP001993; ADI69507.1; -; Genomic_DNA. DR RefSeq; YP_003724721.1; NC_014251.1. DR ProteinModelPortal; D6ZSB8; -. DR EnsemblBacteria; EBSTRT00000097823; EBSTRP00000091918; EBSTRG00000097194. DR GeneID; 9344537; -. DR ...
Biohazard level, growth media and temperature, gram stain, industrial applications and more information for Aerococcus urinaehominis.
Lineage: cellular organisms; Bacteria; Terrabacteria group; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus ...
Lineage: cellular organisms; Bacteria; Terrabacteria group; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus ...
Pediococcus pentosaceus ATCC ® 25745D-5™ Designation: Genomic DNA from Pediococcus pentosaceus strain 183-1w TypeStrain=False Application:
Sodenominato no Yu Dormy Inn PREMIUM Hakata Canal City is located a 10-minute walk from the Hakataguchi Exit of JR Hakata Station. Situated right in front of Canal City Hakata, a large shopping and entertainment complex, the hotel offers high quality accommodation in a convenient location. The hotel features large communal baths and saunas. Semi-buffet breakfast is served in the restaurant on the 1st floor. Western, Japanese-Western and Japanese-style rooms are available as well as wheelchair-friendly rooms. WiFi and high-speed wired Internet is available in guest rooms.
Sodenominato no Yu Dormy Inn PREMIUM Hakata Canal City is located a 10-minute walk from the Hakataguchi Exit of JR Hakata Station. Situated right in front of Canal City Hakata, a large shopping and entertainment complex, the hotel offers high quality accommodation in a convenient location. The hotel features large communal baths and saunas. Semi-buffet breakfast is served in the restaurant on the 1st floor. Western, Japanese-Western and Japanese-style rooms are available as well as wheelchair-friendly rooms. WiFi and high-speed wired Internet is available in guest rooms.
You can find the restaurant near your accommodation,by major sightseeing spots and area, narrow down by cuisine type, price bracket or other preference.
Looking for online definition of detrusor urinae in the Medical Dictionary? detrusor urinae explanation free. What is detrusor urinae? Meaning of detrusor urinae medical term. What does detrusor urinae mean?
We have profiled the effects of PPI use on the gut microbiome in by far the largest study to date, and considered a number of possible confounders including host genetics. We have demonstrated that PPI use is associated with an altered composition of the gut microbiota, and a moderately lower diversity. In all three analyses, the large observational study, between discordant twins, and the interventional replication, PPI use was associated with increases in the Lactobacillales order, and in particular the family Streptococcaceae. Further, we show these effects could result from downward movement of upper tract commensals.. We observed a significant reduction in microbial diversity with PPIs. However, it was a small difference and became non-significant after adjusting for covariates. This may be due to confounding effects and/or reduced power of the smaller sample. Variables we found to associate with PPIs, such as BMI, frailty, and antibiotic use, are also known to reduce diversity.24 ,26 ,40 ...
The urinary microbiota was shown to contain: a total of 217 bacterial isolates from 77 different genera were isolated from OAB patients, while 66 bacterial isolates from 33 different genera were isolated from control patients. Organisms isolated solely from OAB patient urines included Actinobaculum schaalii, Aerococcus urinae, Arthrobacter cumminsii, and Oligella urethralis; each has been reported to cause UTI ...
A 56-year-old man presented with acute amaurosis in his left eye (OS) associated with temperature and malaise. He was under antibiotic treatment for a urinary infection secondary to phimosis. Ophthalmologist exploration revealed: Visual acuity in his right eye (OD)=1 and amaurosis in his OS. Fundoscopy examination showed yellowish-white retinal foci around the macula in his OD and cherry red spot in his OS. The patient was suspected of having a systemic infection with septic emboli in both eyes. Clinical evaluation was completed by an internist with diagnosis of IE. The patient underwent heart surgery with mitral valve replacement. The microbiologist culture of the valve revealed an infection due to aerococcus urinae. All blood tests performed presented normal ranges. The patient has been monitorized from the time of referral to the present day. Fluorescein angiography revealed macular ischaemia in his OS without ischaemic foci in his OD. Visual fields (VF) showed a total central loss of ...
The peripheral resistance to flow through each arterial bed (in actuality, the entire pathway from the heart back to the pericardial sinus) and the mechanical properties of the seven arteries leaving the lobster heart are measured and compared. Resistance is inversely proportional to artery radius and, for each pathway, the resistance falls non-linearly as flow rate increases. The resistance of the hepatic arterial system is lower than that predicted on the basis of its radius. Body-part posture and movement may affect the resistance to perfusion of that region. The total vascular resistance placed on the heart when each artery is perfused at a rate typical of in vivo flow rates is approximately 1.93 kPa s ml-1. All vessels exhibit adluminal layers of fibrils and are relatively compliant at pressures at or below heart systolic pressure. Arteries become stiffer at pressures greater than peak systolic pressure and at radii greater than twice the unpressurized radius. The dorsal abdominal artery ...
Hi Folks, Just a quick update on Noddy. The rodentologist has tested his urine and there was loads of protein in it, and also a lot of ketones. This is obviously a sign his kidneys are failing and would account for the weight loss. She also felt he was very dehydrated (which has made me feel a really bad Mum and very neglectful, although theres always water available), this was indicated by the ketones in his urine. The only other reason I can think of for there being ketones would be diabetes, but there was no glucose, which would have supported that argument ...
Jewett waves brachial autonomic plexus expiration lateral aspect bacterial encephalitis chorioallantoic Cheyne-Stokes psychosis dofn extrinsic color inferior articular process lamina suprachoroidea choroidea kinetochore fibers CT scan Aerococcus lateral nasal process ...
Casares F, McElroy A, Mantione K, Baggermann G, Zhu W, Stefano G. The American lobster, Homarus americanus, contains morphine that is coupled to nitric oxide release in its nervous and immune tissues: Evidence for neurotransmitter and hormonal signaling. Neuro Endocrinol Lett. 2005 Apr; 26(2): 89-97 ...
ive had headaches more than usual, upset stomach,not wanting to eat, more frequent urination and when i urinae there is a clear oderless mucas-like dis charge. Could i be pregnant?
Streptococcus dysgalactiae is a gram positive, beta-haemolytic, coccal bacterium belonging to the family Streptococcaceae. It is capable of infecting both humans and animals, but is most frequently encountered as a commensal of the alimentary tract, genital tract, or less commonly, as a part of the skin flora. The clinical manifestations in human disease range from superficial skin-infections and tonsillitis, to severe necrotising fasciitis and bacteraemia. The incidence of invasive disease has been reported to be rising. Several different animal species are susceptible to infection by S.dysgalactiae, but bovine mastitis and infectious arthritis in lambs (joint ill) have been most frequently reported. Streptococcus dysgalactiae is currently divided into the subspecies Streptococcus dysgalactiae subspecies equisimilis (SDSE) and Streptococcus dysgalactiae subspecies dysgalactiae (SDSD); the former mostly associated with human disease, and the latter almost exclusively encountered in veterinary ...
Leuconostoc mesenteroides (Tsenkovskii) van Tieghem 1878, Leuconostoc dextranicum (Beijerinck) Hucker and Pederson 1930, and Leuconostoc cremoris (Knudsen and Sørensen) Garvie 1960 belong to a single deoxyribonucleic acid homology group. These three organisms have similar lactate dehydrogenases and glucose-6-phosphate dehydrogenases. Because of these common properties, these organisms are here regarded as subspecies within a single species, Leuconostoc mesenteroides. The names of the subspecies are Leuconostoc mesenteroides subsp. mesenteroides, Leuconostoc mesenteroides subsp. dextranicum (Beijerinck) comb. nov., and Leuconostoc mesenteroides subsp. cremoris (Knudsen and Sørensen) comb. nov. The type strains of these subspecies are ATCC 8293, NCDO 529, and NCDO 543, respectively.
Wiwatpanit, T, *Powers, B., and Dickinson, PS. (2012). INter-animal variability in the effects of C-type allatostatin on the cardiac neuromuscular system in the lobster Homarus americanus. Journal of Experimental Biology 215, 2308-18.. Christie, AE, Stemmler EA, Dickinson PS (2010). Crustacean neuropeptides. Dell Mol Life Sci. 2010 Dec; 67(24):4135-69.. Christie, AE, *JS Stevens, *MR Bowers, MC Chapline, DA Jensen, K Schregg, *J Goldwaser, *MA Kwiatkowski, *TK Pleasant Jr, *L Shoenfeld, *LK Tempest, *CR Williams, *T Wiwatpanit, *ER Gabranski, CM Smith, KM Beale, DW Towle, DA Schooley and PS Dickinson (2010). Identification of a calcitonin-like diuretic hormone that functions as an intrinsic modulator of the American lobster, Homarus americanus, cardiac neuromuscular system. Journal of Experimental Biology 213, 118-127.. *Stevens, JS., *CR. Cashman, CM. Smith, KM, Beale, DW. Towle, AE. Christie and PS. Dickinson (2009). The peptide hormone pQDLDHVFLRFamide (crustacean myosuppressin) modulates the ...
Definition of Family micrococcaceae with photos and pictures, translations, sample usage, and additional links for more information.
Looking for online definition of S.viridans in the Medical Dictionary? S.viridans explanation free. What is S.viridans? Meaning of S.viridans medical term. What does S.viridans mean?
Streptococcus species answers are found in the Johns Hopkins ABX Guide powered by Unbound Medicine. Available for iPhone, iPad, Android, and Web.
Sigma-Aldrich offers Sigma-D3759, Dextran from Leuconostoc mesenteroides for your research needs. Find product specific information including CAS, MSDS, protocols and references.
Does the Presence of Modulators Alter the Ability of the American Lobster Heart to Generate a Stable Output Pattern Over a Range of Temperatures ...
Located in the Canal City Hakata entertainment and shopping complex. Features 370 guest rooms, restaurants and bars, meeting facilities.
Production of Viscous Dextran-Containing Whey-Sucrose Broths by Leuconostoc mesenteroides ATCC 14935: Viscous broths were produced by growing Leuconostoc mesent
Increasing concentrations of marine plastics and microplastics have been documented in the Gulf of Maine, due to an array of plastic pollution sources. Marine plastics and microplastics are known to be ingested by marine invertebrate species, including lobster, a commercially important species in Maine. Previous research on other invertebrate larvae indicates that the ingestion of microplastics causes decreased mobility, early settlement, slower growth rates, and a reduced feeding rate. This project will examine the effects of microplastic ingestion in lobster larvae and on species survival. Building on a study conducted in 2017 on blue mussels (Mytilus edulis), scientists will focus on the ingestion of microplastic fibers in the American lobster (Homarus americanus) during larval development. This study will look at the survival rates of the larvae, the ingestion and depuration rates (purification of impurities), body size, and any morphological and functional abnormalities. This ...
Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mutans; Streptococcus mutans serotype c (strain ATCC 700610 / UA159 ...
Bilateral asymmetry of the paired claws of the lobster Homarus americanus is determined during the fourth and fifth juvenile stages by differential reflex activity; the side with the greater activity becomes the crusher while the contralateral side becomes the cutter. Juvenile lobsters reared during this critical period with a substratum that could not be grasped or with reduced input from predominantly internal mechanoreceptors (proprioceptors) (achieved by cutting the dactyl and its chordotonal organ or by tenotomizing the claw opener or closer muscles) failed to develop a crusher claw and hence remained bilaterally symmetrical: they developed paired cutter claws. Therefore, the proprioceptive component of the reflex activity is implicated in bringing about the initial lateralization of the claw ganglion into a crusher and a cutter side.. Moreover, lobsters with a single claw reared without a substratum developed a crusher on the intact side only if the intact claw was exercised. In the ...
pab leuconostoc mesenteroides glucose 6 phosphate dehydrogenase rabbit pab against leuconostoc mesenteroides glucose 6 phosphate dehydrogenase | order pab leuconostoc
Supplementary MaterialsAdditional file 1: Physique S1. other images were captured at 40x (scale bars 50?m). Representative scale bars are provided. Physique S2. Venn diagram of the overlap of Tet.HuA and PrP.HuA/PS1 mice analyzed based upon LC-MS/MS analysis of SDS-insoluble proteins. These diagrams are based on the pair-wise statistical analysis combined with the SAINT scoring method […]. ...
Pediococcus pentosaceus clone P16 16S ribosomal RNA gene, partial sequence;16S-23S ribosomal RNA intergenic spacer, complete sequence; and 23Sribosomal RNA gene, partial ...
Suxi X. Huang, Margaret McFall; Artur C. Cegielski, et al.. Multiple Streptococcus species implicated in lameness and central nervous system signs in piglets and sows ...
Everything you need to know about lobsters: Buying and Storing Lobster; Preparing and Cooking Lobster; Disassembling and Dining on Lobster
Downloadable (with restrictions)! Author(s): Papell, David H. & Prodan, Ruxandra. 2006 Abstract: We investigate two alternative versions of Purchasing Power Parity (PPP): reversion to a constant mean in the spirit of Cassel and reversion to a constant trend in the spirit of Balassa and Samuelson, using long-span real exchange rate data for industrialized countries. We develop unit root tests that both account for structural change and maintain a long-run mean or trend. With conventional tests, previous research finds evidence of some variant of PPP for 9 of the 16 countries. With the unit root tests in the presence of restricted structural change, we find evidence of PPP for five additional countries.