TY - JOUR. T1 - Integrin-mediated membrane blebbing is dependent on sodium-proton exchanger 1 and sodium-calcium exchanger, 1 activity. AU - Yi, Yung Hsiang. AU - Chang, Yu Sun. AU - Lin, Chi Hung. AU - Lew, Tien Shen. AU - Tang, Chih Yung. AU - Tseng, Wei Lien. AU - Tseng, Ching Ping. AU - Lo, Szecheng J.. PY - 2012/3/23. Y1 - 2012/3/23. N2 - Integrin signaling and membrane blebbing modulate cell adhesion, spreading, and migration. However, the relationship between integrin signaling and membrane blebbing is unclear. Here, we show that an integrin-ligand interaction induces both membrane blebbing and changes in membrane permeability. Sodium-proton exchanger 1 (NHE1) and sodium-calcium exchanger 1 (NCX1) are membrane proteins located on the bleb membrane. Inhibition of NHE1 disrupts membrane blebbing and decreases changes in membrane permeability. However, inhibition of NCX1 enhances cell blebbing; cells become swollen because of NHE1 induced intracellular sodium accumulation. Our study found ...
The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22. [provided by RefSeq, Mar 2016 ...
sodium-hydrogen exchanger regulatory factor: a protein cofactor that mediates protein kinase A regulation of the renal brush border membrane Na+-H+ exchanger; 358 amino acids, MW 55 kDa; partial amino acid sequence given in first source
GT:ID BAD55196.1 GT:GENE BAD55196.1 GT:PRODUCT putative sodium/proton antiporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(362840..364090) GB:FROM 362840 GB:TO 364090 GB:DIRECTION - GB:PRODUCT putative sodium/proton antiporter GB:PROTEIN_ID BAD55196.1 LENGTH 416 SQ:AASEQ MITRVRSELTRYLRTETVGGAILLVAAAIALLWVNSPWGDSYLRMTETVLAIEPLHLELTLADWTKDGLLAVFFFVAGLELKRELVVGELADPKRAALPIIAAVGGVVTPALIAAVIGHGAPGMDKGWAIPVATDIAFALGVLALTGSRIPATARVFLLSLAVVDDLLAIILIAVLFTVGVSLLWLLAAAACMAGWWLAQRRRLRTPLVYVPLALVTWYALHEAGVHPTLAGVALGLLTRVRPDPDEEWAPAARLEHLIQPVSAGICVPLFALFAAGVPLNATVFGELFTDRLALAVMLGLLLGKTIGIFGISWVAIRFGLATRPSGLGYRDMFALSVLGAIGFTVSLLVAELALPDGDTVELAKAAVLITSLAASLAGSALLLRRGRVHQARQDALELQPDEGDASDPSEGGSLR GT:EXON 1,1-416:0, SW:ID NHAA_NOCFA SW:DE RecName: Full=Na(+)/H(+) antiporter nhaA;AltName: Full=Sodium/proton antiporter nhaA; SW:GN Name=nhaA; OrderedLocusNames=NFA_3540; SW:KW Antiport; Cell membrane; Complete proteome; Ion transport; Membrane;Sodium; Sodium transport; ...
Sodium-hydrogen antiporter 3 also known as sodium-hydrogen exchanger 3 (NHE3) or solute carrier family 9 member 3 (SLC9A3) is a protein that in humans is encoded by the SLC9A3 gene. SLC9A3 is a sodium-hydrogen antiporter. It is found on the apical side of the epithelial cells of the tubulus proximal of the nephron of the kidney, in the apical membrane of enterocytes of the intestine, as well as the basolateral side of both duodenal and pancreatic cells responsible for the release of HCO−3 into the duodenal lumen. It is primarily responsible for maintaining the balance of sodium. It is also indirectly linked to buffering of blood pH. The NHE3 antiporter imports one sodium ion into the cytosol of a tubule cell as it ejects one hydrogen ion from the cell into the lumen of the proximal tubule. The sodium within the tubule cell may then be retained by the body rather than excreted in the urine. The NHE3 antiporter indirectly contributes to blood buffering capacity because hydrogen ions that are ...
Aging-associated changes in the heart contribute to a wide variety of cardiovascular diseases. The aging atrium becomes increasingly more susceptible to development of atrial fibrillation, and even its pharmacological response to therapeutic drugs alters over time. Changes in structure, function, and pharmacology of the heart can potentially be tied to specific changes in gene expression with aging. Here, seeking molecular correlates of myocardial aging processes, we performed global "whole transcript" analysis of 25,388 genes using 572,667 probes to compare the left atrium (LA) transcriptomes of young adult (9 months old) versus elderly (10 years old) female Sinclair swine. The two genes exhibiting the largest increase in LA expression with aging were NHE2 (9.2-fold; n = 3-4; P = 0.00001) and KCNIP2 (3.8-fold; n = 3-4; P = 0.0002). Real-time qPCR recapitulated the NHE2 results and revealed strongest upregulation with aging in LA, and age-independent expression in the ventricles. NHE2 encodes ...
Background A T cell costimulatory molecule with dipeptidyl peptidase IV (DPPIV) activity in its extracellular area, Compact disc26 is a multifunctional molecule connected with various protein such as for example adenosine deaminase, caveolin-1, CXCR4, collagen, and fibronectin, while using a significant function in the regulation of inflammatory tumor and replies biology. molecule in the formalin-fixed paraffin-embedded tissue is critical. SOLUTIONS TO develop book anti-CD26 mAbs with the capacity of binding towards the denatured Compact disc26, we immunized mice with Compact disc26 proteins denatured in urea buffer. Following the fusion of myeloma and splenocytes cells, the mAbs had been screened for particular reactivity with individual Compact disc26 by stream cytometry, enzyme-linked immunosorbent assay, and immunohistochemistry. The binding competitiveness of novel anti-CD26 mAbs using the humanized anti-CD26 mAb YS110 was also analyzed. Results Weve been successful in developing book ...
Rabbit polyclonal Sodium / Hydrogen Exchanger 1 antibody validated for WB, IHC, ICC/IF and tested in Human, Mouse and Rat. Referenced in 4 publications…
Goat polyclonal Sodium / Hydrogen Exchanger 1 antibody validated for WB and tested in Human. Immunogen corresponding to synthetic peptide
TY - JOUR. T1 - Expression of Na+-H+ exchanger isoforms NHE1 and NHE3 in kidney and blood cells of rabbit and rat. AU - Rutherford, P. A.. AU - Pizzonia, J. H.. AU - Biemesderfer, D.. AU - Abu-Alfa, A.. AU - Reilly, R.. AU - Aronson, P. S.. PY - 1997/11. Y1 - 1997/11. N2 - Increased peripheral blood cell Na-H exchange (NHE) and erythrocyte Na- Li countertransport activity have been reported in hypertension and diabetic nephropathy and correlated with increased activity of the renal brush border Na-H exchanger. A relationship between cation exchange activities of blood cells and renal brush border membranes might exist if both were mediated by the same NHE isoform. We generated isoform-specific antibodies to compare the expression of NHE1 and NHE3 in peripheral blood cell membranes and renal cortical membrane vesicles. An NHE1-specific monoclonal antibody reacted with a 199- to 110-kD protein in basolateral membrane fractions isolated from rabbit and rat kidney. NHE1 protein expression was also ...
0044]The (4-methyl-thiophen-3-yl)-carbamic acid tert-butyl ester was then selectively chlorinated with a chlorinating agent such as N-chlorosuccinimide (NCS) and catalytic hydrochloric acid (HCl) or alternatively, by metalation with N-butyl lithium and reaction with hexachloroethane (Cl3C2Cl3) to form 2-chloro-4-methyl-thiophen-3-yl)-carbamic acid tert-butyl ester. This ester is then treated with hydrogen chloride gas to remove the protecting group so as to form the 3-amino-2-chloro-4-methylthiophene hydrochloride. In step 3, the 3-amino-2-chloro-4-methylthiophene hydrochloride is activated for coupling by treatment with phenyl chlorothionoformate and sodium bicarbonate. This intermediate was subsequently treated with 1,2-phenylenediamine and triethylamine to afford N-(2-aminophenyl)-N-(2-chloro-4-methyl-3-thienyl)thiourea. The thiourea was cyclized utilizing an alkyl or arylsulfonyl chloride such as p-toluenesulfonyl chloride or benzenesulfonyl chloride together with an alkali metal base such ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Protein names and data: SL9B2_HUMAN, Full=Mitochondrial sodium/hydrogen exchanger 9B2, Full=Mitochondrial Na(+)/H(+) exchanger NHA2;Full=Na(+)/H(+) exchanger-like domain-containing protein 2;Short=NHE domain-containing protein 2;Full=Sodium/hydrogen exchanger-like domain-containing protein 2;Full=Solute carrier family 9 subfamily B member 2; Length: 537 a.a., Mass: 57564 Da ...
RecName: Full=Ezrin-radixin-moesin-binding phosphoprotein 50; Short=EBP50; AltName: Full=Na(+)/H(+) exchange regulatory cofactor NHE-RF; AltName: Full=NHERF-1; AltName: Full=Regulatory cofactor of Na(+)/H(+) exchanger; AltName: Full=Sodium-hydrogen exchanger regulatory factor 1; AltName: Full=Solute carrier family 9 isoform A3 regulatory factor 1 ...
Shop Vacuolar cation/proton exchanger ELISA Kit, Recombinant Protein and Vacuolar cation/proton exchanger Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Author Summary Myocardial ischemia, commonly observed when arteries supplying the heart become occluded, results when cardiac tissue receives inadequate blood perfusion. In order to minimize the amount of cardiac damage, ischemic tissue must be reperfused. However, reperfusion can result in deleterious effects that leave the heart muscle sicker than if the ischemia had been allowed to continue. Examples of these reperfusion injuries include lethal arrhythmias and an increased region of cell death. Some of the early events that result in reperfusion injury include changes in pH and an overload of sodium inside the cell. During reperfusion, the sodium-proton exchanger (NHE) removes protons from the cell in an effort to restore normal pH, in turn importing sodium ions. Many strategies have been attempted to prevent reperfusion injury, including inhibition of the NHE, with little clinical effect. Using a mathematical model that we developed to study ischemia and reperfusion in cardiac cells, we found that
NHERF2 (isoform b) antibody, Internal (solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2) for WB. Anti-NHERF2 (isoform b) pAb (GTX89484) is tested in Human samples. 100% Ab-Assurance.
NHERF1 antibody [EBP-10] (solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1) for IHC-P, IP, WB. Anti-NHERF1 mAb (GTX29526) is tested in Human samples. 100% Ab-Assurance.
Rohloff, P., Miranda, K., Rodrigues, J.C.F., Fang, J., Plattner, H., Hentschel, J., Galizzi, M. and Moreno, S.N.J. (2011) Calcium uptake and proton transport by acidocalcisomes of Toxoplasma gondii. Plos One. 2011 6(4):e18390.. Moreno, S.N.J., Ayong L. and Pace, D.A. Calcium storage and function in apicomplexan parasites. (2011). Invited chapter. Essays in Biochem. 51:97-110.. Nair, S., Brooks, C.F., Goodman, C.D., Strurm, A., McFadden, G.I., Sundriyal, S., Anglin, J.L., Song,Y., Moreno, S.N.J. and Striepen B. (2011) Apicoplast isoprenoid precursor synthesis and the molecular basis of fosmidomycin resistance. J. Exp. Med. 208:1547-1559. Francia, M.E. Wicher, S., Pace, D.A., Moreno, S.N.J., Arrizabalaga, G. (2011) A Toxoplasma protein with homology to intracellular type Sodium Hydrogen Exchangers is required for osmotolerance and protein processing. Exp. Cell Res. 317:1382. Pace, D.A., Fang, J., Cintron, R., Docampo, M.D., Moreno, S.N.J. (2011) Overexpression of a cytosolic pyrophosphatase ...
TY - JOUR. T1 - Estrogen action and male fertility. T2 - Roles of the sodium/hydrogen exchanger-3 and fluid reabsorption in reproductive tract function. AU - Zhou, Qing. AU - Clarke, Lane. AU - Nie, Rong. AU - Carnes, Kay. AU - Lai, Li Wen. AU - Lien, Yeong Hau H.. AU - Verkman, Alan. AU - Lubahn, Dennis. AU - Fisher, Jane S.. AU - Katzenellenbogen, Benita S.. AU - Hess, Rex A.. PY - 2001/11/20. Y1 - 2001/11/20. N2 - Estrogen receptor α (ERα) is essential for male fertility. Its activity is responsible for maintaining epithelial cytoarchitecture in efferent ductules and the reabsorption of fluid for concentrating sperm in the head of the epididymis. These discoveries and others have helped to establish estrogens bisexual role in reproductive importance. Reported here is the molecular mechanism to explain estrogens role in fluid reabsorption in the male reproductive tract. It is shown that estrogen regulates expression of the Na+/H+ exchanger-3 (NHE3) and the rate of 22Na+ transport, ...
Purpose: To test a hypothesis that sodium/proton exchanger 8 (NHE8) plays an essential role in controlling pH homeostasis in the secretory pathway of retinal pigment epithelium (RPE).. Methods: Histology and immunohistochemical analysis were performed to study the molecular and cellular alterations in mutant mice; in vitro cell transfection assay and live cell confocal imaging were used to characterize the behavior and subcellular localization of wild-type and mutant NHE8 proteins and their pH regulation; and the in vivo functions of these proteins were investigated by an approach using recombinant adeno-associated virus (r-AAV).. Results: We have found that NHE8, one of the organellar NHEs that regulate medial/trans-Golgi pH and intracellular trafficking and control sodium uptake in the kidney and intestine, is essential for the function of the retina. Both NHE8 knockout and NHE8-M120K point mutant mice develop aberrant RPE with disrupted cell polarity prior to the loss of photoreceptor cells. ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Research Summary: The report presents detailed overview of the Sodium Hydrogen Carbonate market in the world and regions (CIS countries in particular) by contemplating and analyzing its various parameters. Firstly, brief introduction is provided. Thus, sodium hydrogen carbonate properties, application areas and manufacturing technologies are considered. Further goes the analysis of global sodium hydrogen carbonate market with […].... ...
Read "Two Endosomal NHX-Type Na+/H+ Antiporters are Involved in Auxin-Mediated Development in Arabidopsis thaliana, Plant and Cell Physiology" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
China Sodium Hydrogen Sulfite Pressure Drying Machine, Find details about China Pressure Spray Dryer, Madecine Spray Dryer from Sodium Hydrogen Sulfite Pressure Drying Machine - Jiangsu Yutong Drying Engineering Co., Ltd.
Among high-risk patients undergoing CABG, the use of perioperative acadesine for 7 hours was not beneficial. This agent did not reduce all-cause mortality, nonfatal stroke, or need for mechanical support compared with placebo. This contrasts the results of five previous studies in over 4,000 patients, which suggested benefit with acadesine. This medication joins the list of other disproven cardioprotective drugs during CABG: sodium-proton exchange inhibitor, purinergic receptor antagonist, and complement activation inhibitor.. ...
Enhanced Na+/H+ exchange, measured as amiloride derivative-sensitive Na+ and H+ fluxes in cells with a preliminary acidified cytoplasm (Δμ H+-induced Na+/H+ exchange), is one of the most prominent intermediate phenotypes of altered vascular smooth muscle cell (VSMC) function in spontaneously hypertensive rats (SHR). Analysis of Na+/H+ exchange in F2 hybrids of SHR and normotensive rats seems to be the most appropriate approach in the search for the genetic determinants of abnormal activity of this carrier. However, the measurement of Δμ H+-induced Na+/H+ exchange is hardly appropriate for precise analysis of the carriers activity in VSMC derived from several hundred F2 hybrids. To overcome this problem, we compared the rate of 22Na influx under baseline conditions and in Na+-loaded (ouabain-treated) VSMC. The dose-dependency of the rate of Δμ H+-induced H+ efflux as well as of 22Na influx in control and ouabain-treated cells on ethylisopropylamiloride (EIPA) concentration were not ...
We use cookies to ensure that we give you the best experience on our website. If you click Continue we will assume that you are happy to receive all cookies and you will not see this message again. Click Find out more for information on how to change your cookie settings ...
NHE8, 50 µg. Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+.
Functional studies on neurons have demonstrated the presence of several acid-base transporters, including Na-H exchangers, H+ pumps, Na+-driven Cl-HCO3exchangers, Na+-independent Cl-HCO3 exchangers and Ca-H pumps (for overview, see Bevensee and Boron, 1998). However, there is no functional evidence for a neuronal Na/HCO3 cotransporter.. Against this background, we were surprised to find significant and widespread expression of NBC mRNA and protein in neurons. Four results support this conclusion: (1) strong expression of NBC mRNA is evident in several neuronal populations that are easily identifiable anatomically; these include cortical neurons, granule cells of hippocampal dentate gyrus, and granule cells in the piriform cortex; (2) we frequently find NBC mRNA in cells with a neuronal morphology and that do not label with the mRNA for the astrocytic marker GLT-1; (3) NBC protein co-localizes in some cells with the neuronal marker protein MAP2; and (4) cultured cortical neurons express NBC ...
The trial was discontinued early at the recommendation of the Data Safety Monitoring Board to explore the risks and benefits seen with cariporide therapy. The primary composite endpoint of death or MI at day five was lower in the cariporide arm compared with placebo (16.6% vs. 20.3%, relative risk reduction [RRR] 18.3%, p=0.0002), with similar results at 30 days (18.3% vs. 21.8%, RRR 16.1%, p=0.0009) and six months (20.2% vs. 23.9%, RRR 15.7%, p=0.0006 ...
Autor: Călinescu, Octavian et al.; Genre: Zeitschriftenartikel; Im Druck veröffentlicht: 2014; Keywords: Archaea; Electrophysiology; Membrane Transport; pH Regulation; Sodium Proton Exchange; EcNhaA; MjNhaP1; Cation Proton Antiporter; Solid Supported Membrane; Titel: Keeping It Simple, Transport Mechanism and pH Regulation in Na+/H+
Sodium hydrogen sulfate | NaHSO4 or HNaO4S | CID 516919 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
7% in DCT via Sodium-Chloride exchange. Site Apical Transporter Function. Proximal tubule Na/ CT Na uptake, uptake. Na /P, CT Na- uptake, Pt uptak. Na CT Na uptake, .. uptake. Na/lactate CT Na uptake, lactate uptake. Na/H exchanger Na uptake. H extrusi. CI base exchanger Cl ...
MetabolismTransport and binding proteinsCations and iron carrying compoundssodium/hydrogen exchanger 3 (TIGR00840; HMM-score: 56.7) ...
Such complex processors will open a wide variety of possibilities ranging from environmental to medical applications. One of the most important challenges will be to provide a large repertoire of engineered and modular biomolecular-transport and -energy conversion systems for assembly of nanoreactors with diverse functionalities in lipid bilayers and block copolymers. Initially, modules will include light--driven proton pumps and proton-driven solute transporters in the membrane, and metabolizing enzymes inside the container. Next, more complex powering systems will be explored such as combinations of light--driven proton pumps with sodium/proton antiporters with the objective: to energise sodium-driven solute transporters. This will significantly increase the repertoire and specificity of translocating modules. The availability of numerous, highly specialized membrane proteins in milligram amounts offers the unique opportunity to use them as building blocks and toolkit to assemble molecular ...
Shop K(+) efflux antiporter ELISA Kit, Recombinant Protein and K(+) efflux antiporter Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Set2-dependent H3K36 methylation is required for the function of Rpd3S.(A,B) SOM clustering of H4K5ac enrichment (A) and RNAPII occupancy (B) on ORFs of all gen
An isoform of the Na+/H+ exchanger, NHE-1, has been cloned, sequenced and stably expressed in PS120 fibroblast cells. PS120 being
SLC9A1 (NHE1), a member of the Na+/H+ exchanger family, is a ubiquitous membrane protein that regulates intracellular pH and cell volume. Furthermore, SLC9A1 is known to
The goal of our study was to determine whether H3Rs afford cardioprotection in I/R by counteracting the AT1R-mediated stimulation of NHE. We found that activation of neuronal H3R opposes the deleterious effects of locally formed ANG II, not only by inhibiting NHE, but also by reducing the expression of AT1R. This novel phenomenon broadens the known cardioprotective effects of H3R activation (Levi and Smith, 2000; Mackins and Levi, 2000).. We had reported previously that H3Rs are activated in I/R and limit the release of pathological amounts of NE and associated reperfusion arrhythmias by decreasing NHE activation, thus counteracting a pivotal mechanism of nonvesicular, carrier-mediated NE release (Levi and Smith, 2000). Because ANG II is formed locally in the heart during I/R (Mackins et al., 2006) and ANG II is a major NHE activator (Reid et al., 2004), we assumed that in I/R the activation of H3R could counterbalance the NHE-stimulating effect of ANG II. Indeed, we found that pharmacological ...
Sodium Hydrogen Periodate Na3H2IO6 bulk & research qty manufacturer. Properties, SDS, Applications, Price. Free samples program. Term contracts & credit cards/PayPal accepted.
SENYAWA HIDROKARBONDisebut Hidrokarbon : mengandung unsur C dan H Terdiri dari : 1. Alkana (CnH2n+2) 2. Alkena (CnH2n) 3. A...
If you are interested in one of our above services, please fill in the form below and one of our representatives will provide you with a price quote within a few business days ...
MetabolismTransport and binding proteinsCations and iron carrying compoundsNa+/H+ antiporter NhaC (TIGR00931; HMM-score: 434.8) ...
28.02.2020 at 4:39 pm como ganhar na lotofacil acertar na lotofacil ganhar na lotofacil como ganhar na lotofacil de verdade como ganhar na lotofacil sempre como ganhar na lotofacil 2020 como ganhar na lotofacil 100 garantido dicas lotofacil como acertar na lotofacil dicas para ganhar na lotofacil. ...
28.02.2020 at 4:35 pm como ganhar na lotofacil acertar na lotofacil ganhar na lotofacil como ganhar na lotofacil de verdade como ganhar na lotofacil sempre como ganhar na lotofacil 2020 como ganhar na lotofacil 100 garantido dicas lotofacil como acertar na lotofacil dicas para ganhar na lotofacil. ...
... Ponovitev 3. Genetika Povzetek .......................................... V vsaki celici evkariontskega
Vstopna stran namenjena zdravju s pomočjo prehranskih dopolnil, izbojšanju počutja, medsebojnih odnosov, pozitivnemu mišljenju in duhovnosti.
Но он одинаков и для любого иного казино. Вообще, первые бонусы дают не кредиторы, которые сохраняют за собой все права на депозиты, а игроки, которых в казино нет ...