All the major androgen-regulated secretory proteins of rat seminal vesicles have been purified in high yield from polyacrylamide gels using electroelution. In the process a sixth previously undocumented protein has been identified. Amino acid compositions of all the proteins are very similar and highly unusual, being high in lysine and arginine, and with 40-50% of the residues accounted for by serine, glycine and glutamate/glutamine. N-Terminal amino acid sequences for 3 of the proteins show that they are clearly the products of related genes. At least one of the other proteins is N-terminally blocked in vivo. Antibodies specific for each protein have been raised and provide evidence of structural similarity between the proteins. The antibodies were also used in immunofluorescence histochemistry with the rat copulatory plug, showing for the first time that all the major proteins of seminal vesicle secretion are components of this reproductive structure.. ...
TY - JOUR. T1 - Embryological and diagnostic aspects of seminal vesicle cysts associated with upper urinary tract malformation. AU - Roehrborn, Claus. AU - Schneider, H. J.. AU - Rugendorff, E. W.. AU - Hamann, W.. PY - 1986/1/1. Y1 - 1986/1/1. N2 - Congenital seminal vesicle cysts represent a rare but illustrative type of embryological malformation. They often are combined with ipsilateral upper urinary tract abnormalities. In most of the cases described in the literature the diagnosis has been made with rather invasive procedures. On the basis of our experience with 3 cases we recommend pelvic ultrasonography as the initial study in patients in whom such a malformation is suspected. Although other radiological procedures may be required to confirm the diagnosis, this approach appears to be cost-effective and accurate in most instances. The treatment of such malformations should be restricted to symptomatic cases and usually consists of vesiculectomy with or without removal of the ipsilateral ...
TY - JOUR. T1 - An experimental model to evaluate the in vivo response of rat seminal vesicle to electrical stimulation. AU - Hsieh, Ju Ton. AU - Chien, Chiang Ting. AU - Liu, Shih Ping. AU - Chen, Chau Fong. AU - Lai, Ming Kuen. PY - 1996/2/9. Y1 - 1996/2/9. N2 - This investigation demonstrated a good model to record the pressure change of rat seminal vesicle (SV) in response to electrical stimulation (ES) of lesser splanchnic nerve (LSN) in vivo. LSN was easily identified and isolated grossly. Antegrade catheterization via the SV tail to the main lumen was performed similar to the technique of i.v. catheterization, and the pressure recording was quite satisfactory. The vesicle response to ES was frequency-dependent and reproducible. Under the conditions of 10 V and 1 ms, the maximal vesicle pressure was 81.7 ± 2.8 mmHg with 80 Hz of ES. The inhibitory response of SV to ES by clomipramine was concentration-dependent. Clomipramine (3 mg/kg) could inhibit 53% of control responses (n = 7). This ...
Accepted name: prostaglandin-endoperoxide synthase. Reaction: arachidonate + reduced acceptor + 2 O2 = prostaglandin H2 + acceptor + H2O. Other name(s): prostaglandin synthase; prostaglandin G/H synthase; (PG)H synthase; PG synthetase; prostaglandin synthetase; fatty acid cyclooxygenase; prostaglandin endoperoxide synthetase. Systematic name: (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoate,hydrogen-donor:oxygen oxidoreductase. Comments: This enzyme acts both as a dioxygenase and as a peroxidase.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, PDB, CAS registry number: 39391-18-9. References:. 1. DeWitt, D.L. and Smith, W.L. Primary structure of prostaglandin G/H synthase from sheep vesicular gland determined from the complementary DNA sequence. Proc. Natl. Acad. Sci. USA 85 (1988) 1412-1416. [PMID: 3125548]. 2. Ohki, S., Ogino, N., Yamamoto, S. and Hayaishi, O. Prostaglandin hydroperoxidase, an integral part of prostaglandin endoperoxide synthetase from bovine vesicular gland microsomes. ...
Question - Have grade -II prostatomegaly and small seminal vesicle cyst. Do I need urgent medical cure?. Ask a Doctor about Prostate, Ask a Urologist
After castration, treatment with 17 beta-estradiol (20 micrograms/kg.day) for 3 days induced the LF mRNA in the seminal vesicle of both control and prenatally DES-exposed mice; however, the levels in DES-treated tissues were approximately 6-fold higher than those in control tissue.. This report describes the presence of LF in seminal vesicle tissues and secretions of prenatally DES-exposed mice, as determined by immunohistochemistry and Western blot analysis.. Further, these data are correlated with immunolocalization of the estrogen receptor in the seminal vesicle tissue.. We conclude that the seminal vesicle of prenatally DES-exposed male mice has acquired two key characteristics of female tissues, namely LF production/regulation and estrogen receptor localization/distribution similar to that in uterine tissues.. ...
In this report we determined that the level of LTF mRNA is minimal in the seminal vesicles of normal mice.. In contrast, expression of LTF mRNA in the seminal vesicles of developmentally estrogenized males was both constitutive and estrogen inducible.. The mRNA for the major estrogen-inducible uterine secretory protein, lactoferrin (LF), was constitutively expressed in the seminal vesicle of male mice exposed prenatally to DES, but not in the seminal vesicle of control mice. The results suggested that this alteration may be an example of atypical gene expression after hormonal manipulation early in development.. ...
Ectopic prostatic tissue and seminal vesicle at pericolic fat is extremely rare. The nodules in the pericolic fat could raise a dilemma of metastatic deposits in cases of rectal adenocarcinoma. A 61 years old male underwent abdomino-perineal resection for rectal carcinoma. Nodules along with lymph nodes from pericolic fat were sampled to assess the spread. Histopathological and immunohistochemical staining of one nodule confirmed it to be the prostatic tissue while another nodule to be seminal vesicle. Seminal vesicle and prostatic heterotopia is significant in several respects, either symptomatic or asymptomatic, as the ectopic tissue can be endoscopically and histologically confused with malignancy of urinary or lower gastrointestinal system and may reflect divergent differentiation or a malformative process. ...
CT and MRI of Congenital Anomalies of the Seminal Vesicles Current Issue · All Issues · Collections; Information For ... CT and MRI can both accurately show renal and seminal vesicle anomalies. Seminal vesicle anomalies often occur concurrently with renal and vasal defects. MRI is a better tool for ... ...
Gallic acid esters possessing a varying chain length of their alcohol moiety were tested for their inhibitory potencies on 15-lipoxygenase from rabbit reticulocytes and prostaglandin H synthase from sheep vesicular glands. Octyl gallate and decyl gal
TY - JOUR. T1 - Clear cell primary seminal vesicle carcinoma in a young male-a rare case report. AU - Gaur, Saurabh. AU - Pillai, Sunil B.. AU - Hegde, Padmaraj. AU - Chawla, Arun Kumar. AU - Kapadia, Aseem. PY - 2018/2/1. Y1 - 2018/2/1. N2 - Primary malignancies of Seminal Vesicle (SV) are rare. When involved, it is most commonly due to secondaries or by contiguous spread from adjacent organs. Primary tumours that can arise in SV can be epithelial and mesenchymal. Adenocarcinoma is most common epithelial tumour, and the Clear Cell variant of Adenocarcinoma (CCA) so far has not been reported in literature. Primary SV malignancies like adenocarcinoma pose a diagnostic dilemma as it becomes difficult to differentiate it from secondaries or as involvement from other adjacent organs even with imaging, histopathology and Immunohistochemistry (IHC). Here we present a case of 34-year-old male who presented with occasional total painless haematuria for four years and was evaluated by Contrast Enhanced ...
The seminal vesicle is a gland located behind the bladder in males. Humans have two seminal vesicles, which make seminal fluid and...
It is very significant that these two apertures should be so extremely small, much smaller than the two seminal ducts. Because the two seminal vesicles are only laterally attached to their ducts it may happen (in contradistinction to the urinary apparatus, in which both the ureters discharge into the bladder itself), that sperm cells simply pass by the seminal vesicle without entering it. In this manner it might only too easily happen that semen would escape with urine unnoticed, without exercising its fertilising function, as is sometimes the case in serious paralytic conditions (spermator-rhea seminal emission without erection). But the extreme fineness of the two apertures in itself causes a resistance as elastic as the best occlusory muscle. So the antagonism in connection with the secretion of semen is unmistakable, even for those sperm-cells which have not penetrated into the seminal vesicles.. The problem of the ejaculation of the semen is rendered very much more difficult, because on ...
mention the role of the following organs of human male reproductive system testes seminal vesicles - Biology - TopperLearning.com | efi8m2qq
Rats can be used as a model organism to teach physiological concepts in a laboratory setting. This article describes a two-part laboratory that introduces students to hypothesis testing, experimental design, the appropriate use of controls and surgical techniques. Students perform both a castration and sham-control surgery on male rats and test the effects of reduced testosterone due to castration on the weight and histology of seminal vesicles. After performing the surgeries and collecting the data, students learn histological techniques, as well as empirical data collection, analysis and interpretation. Demonstrating the effects of testosterone through castration surgery bridges concepts learned in a traditional physiology class setting with data gleaned from research in a laboratory. Overall, the male castration surgery provides students with hands-on skills and an understanding of the work done by scientific researchers and health care professionals.
Brauer, C.; Scheit, K. H.: Characterization of the gene for the bovine seminal vesicle secretory protein SVSP109. Biochimica et Biophysica Acta 1090 (2), pp. 259 - 260 (1991 ...
BioAssay record AID 54289 submitted by ChEMBL: Compound was tested at 1 nM for the inhibition of ADP-induced (20 uM) platelet aggregation in bovine seminal vesicle microsomes; NI=No inhibition.
Unilateral agenesis of seminal vesicle as seen in this case, is a documented cause of male infertility and abnormal semen analysis. It may be associated with unilateral renal agenesis, however correlative USG (not shown) showed normal kidneys in ...
Irreversible androgen induced growth in seminal vesicle smooth muscle.: The dihydrotestosterone (DHT)-sustained normal pubertal development of the guinea pig se
Bartke, A, "Influence of pituitary homografts on the weight of seminal vesicles in castrated mice." (1967). Subject Strain Bibliography 1967. 562 ...
Results: The mean age was 64 years (range: 50-76 years) with mean and median PSA of 17.98 ng/ml (range: 0.3-68.3 ng/ml) and 12.1 ng/ml, respectively. With increase in preoperative Gleason score, chance of organ confinement decreases (P=0.002) and capsular penetration increases (P=0.004) linearly. With increasing serum PSA, there is linear decrease in trend of organ-confined disease (P=0.03) and increased chances of seminal vesicle involvement (P=0.02). Patients with higher clinical stage have less probability of localized disease (P=0.007) and more chances of capsular penetration (P=0.04) and seminal vesicle involvement (P=0.004). Conclusion: Our data suggest that patients with higher preoperative serum PSA, Gleason score, and clinical stage have more chances of advanced pathological stage following RARP ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
A: The seminal vesicles are not only warehouse store tags Ahoinat sperm after the arrival of the testis, but it is a very important source for the production of fruit sugar (fructose), which is an indispensable element to feed Ahoinat sperm. The percentage of the sugar concentration of 120-200 mg per cent of the semen, is this amount of sugar to give enough power for about one hundred million sperm Hoin for twenty hours. Therefore, if I said the proportion of fructose in the semen than normal (as sometimes occurs in inflammatory seminal vesicles) that lead to abnormal phenomena on the one hand Ahoinat sperm count, or the movement or shapes. This may be a cause of infertility. ...
To understand how reproductive hazards affect a mans ability to have healthy children, it is important to understand how the male reproductive system works.. The testicles have two important functions: (1) they produce the hormone testosterone, which produces the deep male voice, beard, and sex drive; and (2) they produce sperm.. After the sperm are made (in about 72 days), they are stored in the epididymis, the outer structure of the testicles. The sperm remain in the epididymis for about 15 to 25 days. While there, they mature and develop the ability to swim. If the sperm are not ejaculated, they eventually die and are absorbed by the body.. When a man ejaculates, the mature sperm cells move through the vas deferens (the tube cut in a vasectomy) and past the seminal vesicles and prostate gland. The seminal vesicles and the prostate provide most of the liquid in semen.. The semen is deposited in the vagina and the sperm must then swim through the cervix into the uterus and up into the ...
The motivation behind the organs of the male conceptive framework is to play out the accompanying capacities: To deliver, keep up, and transport sperm (the male regenerative cells) and defensive liquid (semen) To release sperm inside the fe...
I am sorry to hear about this new PSA test, even though it is much lower than the other two. And thank you for your kind words about my surgery. In may case, I had no ECE, seminal vesicle invasion, nodal involvement, or positive surgical margins, so I stand a good chance at cure, but as you can tell, nothing is certain when it comes to cancer (I was forced not to participate in the test for circulating tumor cells based on the chance of infection, since prior to surgery they use needle aspiration of the bone marrow for that test). Anyway, I just posted a reply on a case of biochemical recurrence. I mention CellSearchTM there. It would prove useful if your father had this test done, for at least it would lend some indication if he is in real trouble. Read what I posted there (I wrote about other ways to control the cancer, at least a little bit, for the time being). Although I have no answer for why the PSA is bouncing around like this (consistent with radiotherapy but not surgery), the good news ...
This 43-year-old man noticed slight protuberance of the lower abdomen that increased over several months. Otherwise , he was asymptomatic. Ultrasound, CT and MRI scans of the pelvis revelaed a complex mass suspicious for sarcoma arising from the prostate. Surgical exploration showed an origin from the seminal vesicles but the tumor was separate from the prostate. The tumor as removed togeter with a cystoprostatectomy. Gross findings: A 16 cm tumor weighing 587 grams with a homogenous grey cut surface was received. Areas of hemorrhage and necrosis were evident. The surface was smooth and mainly covered by a layer of intact peritoneum. An area of irregularity was present corresponding to the site of removal from the area of the seminal vesicles ...
The Orthopedics PERL Channel contains hundreds of items, including full-color medical illustrations, medical animations and patient education articles. The Orthopedics Channel covers topics relevant to skeletal and muscular anatomy, orthopedic injury and repair, and general sports medicine. Health Animation channels are produced by Nucleus Medical Media, Inc.
All the information, content and live chat provided on the site is intended to be for informational purposes only, and not a substitute for professional or medical advice. You should always speak with your doctor before you follow anything that you read on this website. Any health question asked on this site will be visible to the people who browse this site. Hence, the user assumes the responsibility not to divulge any personally identifiable information in the question. Use of this site is subject to our Terms & Conditions ...
Dr. Proffitt responded: Interesting question. The majority of ejaculate is made up of prostatic fluid, seminal vesicle fluid and just 1/2-1 cc from |a href="/topics/sperm" track_data="{
Health Care of children is a major problem in almost all the parents around the world. The accessory glands, including the seminal vesicles and the prostate
1/08: Biopsy 1 of 12 cores with 10% involvement, T1c, Gleason 3+3=6. 4/08/08: Da Vinci Rad. prostectomy @ Banner Thunderbird, 5 hrs.. Advised both nerve bundles spared. Post Op Pathology Report: Tumor confined w/in prostate, pT2c, NX, DX Gleason is 3+3=6, bilateral with 15% total involvement near apex. Margins and Seminal Vesicles negative!!!. 4/18/08: Staples and Catheter removed. Drip, drip, drip, drip.... 5/23/08: Dry!!!!. ...
In spawning Clarias gariepinus from the Hula Nature Reserve in Northern Israel, the mean value for the seminal vesicle somatic index (SVSI) had decreased as compared with that in prespawning fish, due to loss of seminal vesicle fluid. Mean gonadosomatic index (GSI), however, had increased, probably as a result of ... read more hydration, 3α-Hydroxysteroid dehydrogenase (3αHSD), 3βHSD and uridine diphosphoglucose dehydrogenase (UDPGD) reactions were demonstrated in interstitial cells of both testis and seminal vesicle. UDPGD reactions were also found in the epithelium of the seminal vesicle tubules. Quantitative determination of the enzyme reactions with a computerized image analysis system revealed that total activity of all three enzymes in interstitial cells of the seminal vesicle was distinctly stronger in spawning fish. Prespawning and spawning fish did not differ in total UDPGD activity in the epithelium lining the seminal vesicle tubules. In the testes of spawning fish, total 3βHSD ...
Looking for online definition of Ducts of the seminal vesicles in the Medical Dictionary? Ducts of the seminal vesicles explanation free. What is Ducts of the seminal vesicles? Meaning of Ducts of the seminal vesicles medical term. What does Ducts of the seminal vesicles mean?
Material & Methods: Using the database of the European study on radical prostatectomy (653(DQG PHQ ZKR XQGHUZHQW UDGLFDO UHWURSXELF SURVWDWHFWRP\ EHWZHHQ DQGDWRWDORISDWLHQWVZHUHLGHQWLᚏHGZKRKDGXQGHUJRQHELODWHUDOQHUYHVSDULQJ and preservation of the tip of the seminal vesicle (GROUP 1). Potency and continence results were compared to a matched group of 1424 men who also underwent a bilateral nerve sparing procedure without preservation of the seminal vesicle tip during the same period (GROUP 2). Results: 2YHUDOOFRQWLQHQFHUDWHSDGDW\HDUZDVZLWKD&,&RQWLQHQFH WLPHNLQHWLFVDWPRDWPRDWPRDQGDWPR$ GLᚎHUHQFHZDVVHHQZKHQFRPSDULQJSK\VLFLDQDQGSDWLHQWJXLGHGTXHVWLRQQDLUHVZLWK respect to continence (physicians judging rates more favourably).A constant relative increase in Nerve-sparing (uni- and bilateral) procedures was observed with highest rates 1998-2000, and reaching a steady state thereafter (at 71,4% of all cases). Potency results and time kinetics in both groups are: Potency GROUP 1* GROUP 2 PR 8-15% ...
View Notes - The male reproductive system from PHRM 3010 at UGA. Epididymis • Vas deferens • Seminal vesicles • Prostate gland • Bulbourethral (cowpers gland)
This fourth series Fascicle in the American Registry of Pathology/Armed Forces Institute of Pathology Atlas of Tumor Pathology series discusses the practical pathologic diagnoses of tumors and tumor-like diseases of the prostate gland, seminal vesicles, penis, and scrotum. The authors follow the tradition of the preceding three Fascicles by emphasizing pathologic gross and light microscopic diagnostic features and differential diagnoses. They also discuss relevant clinical features, including concise sections on the clinical presentation and the clinical meaning of the pathologic diagnosis in terms of prognosis and treatment. The immunohistochemical and molecular pathologic studies that are of current value in diagnosis are clearly presented. The high quality images follow the rich tradition of the previous Fascicles to depict the spectrum of tumor morphology from cases mainly from the files of institutions such as The Johns Hopkins Hospital, Barnes-Jewish Hospital, and Instituto de Patología e ...
Expression of AR (AIS, DHTR, HUMARA, NR3C4, SBMA, SMAX1) in seminal vesicle tissue. Antibody staining with CAB000001 and CAB065764 in immunohistochemistry.
Expression of RNASET2 (bA514O12.3, FLJ10907, RNASE6PL) in seminal vesicle tissue. Antibody staining with HPA029013 and HPA066509 in immunohistochemistry.
R 2956 (17beta-hydroxy-2,2,17-trimethyl-estra-4,9,11-trien-3-one) was tested for antiandrogenic activity in rats (Dorfman test); in dogs; for androgenic activity in female rats (Hershberger); in male rats; for progestagenic activity in rabbits (Clauberg); for uterotrophic activity in mice (Rubin); and for antiestrogenic activity in mice (Dorfman). R 2956 significantly antagonized the hypertrophic effect of .05 mg testosterone propionate on rat seminal vesicles and ventral prostate in proportion to dose from .4-5 mg/day orally. In dogs R 2956 lowered prostate epithelial hyperplasia induced by androstanolone. R 2956 had no androgenic, estrogenic, progestational, or antiestrogenic activities and inhibited development of corpora lutea to an extent comparable with that of norethindrone ...
Provided the above examinations show normal findings, nothing further needs to be done.. Hematospermia usually resolves on its own over time.. In some men, it may be a recurrent problem and develop on an intermittent basis.. Rarely, it may be a steady ongoing problem. In these circumstances, a transrectal ultrasound may be done to evaluate the seminal vesicle and prostate. Prostate ultrasound is done by inserting a small probe into the rectum that takes sonographic pictures of the prostate and seminal vesicles. This is a simple office procedure that is similar to a digital rectal exam. Ultrasound is carried out to make sure there are not abnormalities such as cysts or calcifications in the seminal vesicle or prostate.. If there is a persistent hematospermia, then treatment with Proscar (finasteride) for several months may be recommended. Proscar is a drug that was designed to reduce the size of the prostate in men with BPH (benign prostatic hyperplasia), which is the normal enlargement of the ...
There is a high relapse rate for patients who have undergone prostatectomy and have pathologic extracapsular prostate extension, positive surgical margins or seminal vesicle involvement (pathologic stage 3 disease). While adjuvant radiation improves progression-free and overall survival, approximately half of these patients will develop recurrence. Similarly, radiation therapy has become the standard salvage therapy for patients with rising PSA ,0.1 - , 2.0 ng/mL. In common solid tumors such as NSCLC, head and neck cancer and upper gastrointestinal cancers, the addition of chemotherapy to radiation improves survival. It is hypothesized that the addition of radiosensitizing chemotherapy to standard adjuvant radiation will improve survival in patients with stage 3 prostate cancer after prostatectomy and patients with rising PSA , 2.0 ng.mL without detectable disease. Taxanes are powerful radiation enhancers since they synchronize tumor cells in G2/M the most radiosensitive phase of the cell ...
Body flaccid, transparent; transversal musculature absent; head of medium width; hooks not serrated. Fin bridge absent. Anterior fins very short, partially rayed, round; posterior fins short, partially rayed, angular. Collarette absent; gut diverticula absent. Small eyes, with small round pigment spot. Seminal vesicles round; position of seminal vesicles: touching tail fin, well separated from posterior fins. Ovaries of medium length, reaching to region of ventral ganglion; ova small. Adhesive papillae and adhesive organs absent. Apical glands absent. Hooks: 7-10; anterior teeth: 3-5; posterior teeth: 0-6 ...
Body firm and muscular; transversal musculature absent; head wide; hooks not serrated. Fin bridge absent. Anterior fins long, fully rayed, rounded; posterior fins of medium length, partially rayed, rounded. Collarette long; gut diverticula present. Small eyes, with T-shaped pigment spot. Seminal vesicles [with] knob and trunk; position of seminal vesicles: touching both posterior fins and tail fin. Ovaries long, reaching to neck region; ova small. Adhesive papillae and adhesive organs absent. Apical glands absent. Hooks: 5-6; anterior teeth: 7-10; posterior teeth: 12-14 ...
Principal Investigator:UEDA Kimiko, Project Period (FY):2015-04-01 - 2018-03-31, Research Category:Grant-in-Aid for Scientific Research (C), Section:一般, Research Field:Orthodontics/Pediatric dentistry
5.3.1 Male Reproductive Tract (Interactive Diagram) -What are the functions of the male reproductive tract? -What are the functional components of the male reproductive tract? -What are the differences between the secretions of the seminal vesicles and the prostate? -What is the usual composition of semen ...
5.3.1 Male Reproductive Tract (Interactive Diagram) -What are the functions of the male reproductive tract? -What are the functional components of the male reproductive tract? -What are the differences between the secretions of the seminal vesicles and the prostate? -What is the usual composition of semen ...
A new topically active non-steroidal antiandrogen, RU 58841 has been synthesized. It displays high affinity for the hamster prostate and flank organ (F.O.) androgen receptors. In vivo, when topically applied, it exerts a potent dose-dependent regression of F.O. area at a dose as low as 1 microgram/animal while being devoid of antiandrogenic activity on deep accessory sex organs and of any effect on testosterone level up to 100 micrograms/animal. In the same species, after subcutaneous administration, it induces at the dose of 300 micrograms/animal, a ...
Similarities and differences between males and females, but same goal: new life Primary sex organs: gonads Testes in males Ovaries in females These produce the gametes (sex cells) Sperm in males Ovum (egg) in females Endocrine function also: secretion of hormones Accessory sex organs Internal glands and ducts External genitalia
As we mentioned on the last page, sperm are made in the testes. During sexual intercourse, smooth muscles contract and propel mature sperm from the end portions of the epididymis through a long tube called the vas deferens, which is inside the body, just beneath the bladder. From there, the sperm get mixed with nutrient-rich fluids from the seminal vesicles and a milky secretion from the prostate gland. This combination of sperm and fluids is called semen. The semen does three things:. ...