On the fidelity of DNA replication. Isolation of high fidelity DNA polymerase-primase complexes by immunoaffinity chromatography.
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
TY - JOUR. T1 - Molecular basis for maintenance of fidelity during the CCA-adding reaction by a CCA-adding enzyme. AU - Toh, Yukimatsu. AU - Numata, Tomoyuki. AU - Watanabe, Kazunori. AU - Takeshita, Daijiro. AU - Nureki, Osamu. AU - Tomita, Kozo. PY - 2008/7/23. Y1 - 2008/7/23. N2 - CCA-adding enzyme builds the 3′-end CCA of tRNA without a nucleic acid template. The mechanism for the maintenance of fidelity during the CCA-adding reaction remains elusive. Here, we present almost a dozen complex structures of the class I CCA-adding enzyme and tRNA mini-helices (mini-D 73 N 74 , mini-D 73 N 74 C 75 and mini-D 73 C 74 N 75 ; D 73 is a discriminator nucleotide and N is either A, G, or U). The mini-D 73 N 74 complexes adopt catalytically inactive open forms, and CTP shifts the enzymes to the active closed forms and allows N 74 to flip for CMP incorporation. In contrast, unlike the catalytically active closed form of the mini-D 73 C 74 C 75 complex, the mini-D 73 N 74 C 75 and mini-D 73 C 74 N 75 ...
TY - JOUR. T1 - 7 tRNA Nucleotidyltransferase. AU - Deutscher, Murray P. PY - 1982/12/1. Y1 - 1982/12/1. UR - http://www.scopus.com/inward/record.url?scp=77956942628&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=77956942628&partnerID=8YFLogxK. U2 - 10.1016/S1874-6047(08)60279-6. DO - 10.1016/S1874-6047(08)60279-6. M3 - Article. AN - SCOPUS:77956942628. VL - 15. SP - 183. EP - 215. JO - Enzymes. JF - Enzymes. SN - 0423-2607. IS - C. ER - ...
The fission yeast genome, which contains numerous short introns, is an apt model for studies on fungal splicing mechanisms and splicing by intron definition. Here we perform a domain analysis of the evolutionarily conserved Schizosaccharomyces pombe pre-mRNA-processing factor, SpPrp18. Our mutational and biophysical analyses of the C-terminal alpha-helical bundle reveal critical roles for the conserved region as well as helix five. We generate a novel conditional missense mutant, spprp18-5. To assess the role of SpPrp18, we performed global splicing analyses on cells depleted of prp18(+) and the conditional spprp18-5 mutant, which show widespread but intron-specific defects. In the absence of functional SpPrp18, primer extension analyses on a tfIId(+) intron 1-containing minitranscript show accumulated pre-mRNA, whereas the lariat intron-exon 2 splicing intermediate was undetectable. These phenotypes also occurred in cells lacking both SpPrp18 and SpDbr1 (lariat debranching enzyme), a genetic ...
CCA-adding enzyme; Catalyzes the addition and repair of the essential 3- terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in the order of C, C, and A to the tRNA nucleotide-73, using CTP and ATP as substrates and producing inorganic pyrophosphate (443 aa ...
A method for separating a target allele from a mixture of nucleic acids by (a) providing a mixture of nucleic acids in fluidic contact with a stabilized ternary complex that is attached to a solid support, wherein the stabilized ternary complex includes a polymerase, primed nucleic acid template, and next correct nucleotide, wherein the template has a target allele, wherein the next correct nucleotide is a cognate nucleotide for the target allele, and wherein the stabilized ternary complex is attached to the solid support via a linkage between the polymerase and the solid support or via a linkage between the next correct nucleotide and the solid support; and (b) separating the solid support from the mixture of nucleic acids, thereby separating the target allele from the mixture of nucleic acids.
In a classic experiment, [Sol] Spiegelman ... showed what happens to a molecular replicating system in a test tube, without any cellular organization around it. The replicating molecules (the nucleic acid templates) require an energy source, building blocks (i.e., nucleotide bases), and an enzyme to help the polymerization process that is involved in self-copying of the templates. Then away it goes, making more copies of the specific nucleotide sequences that define the initial templates. But the interesting result was that these initial templates did not stay the same; they were not accurately copied. They got shorter and shorter until they reached the minimal size compatible with the sequence retaining self-copying properties. And as they got shorter, the copying process went faster. So what happened with natural selection in a test tube: the shorter templates that copied themselves faster became more numerous, while the larger ones were gradually eliminated. This looks like Darwinian ...
Q-PCR (quantitative PCR) is used to determine the quantity of starting nucleic acid template. There are 2 main methods: PCR with dsDNA dyes and PCR with probes. dsDNA dyes and probes allow measurement while the PCR is running, i.e. in real-time, and are therefore often named real-time PCR (see below). Probes are superior to dsDNA dyes but also more expensive. DNA can also be quantified with a simple PCR followed by agarose gel electrophoresis (qPCR end-point assay). If done properly with serial dilutions of starting DNA template to establish a linear relationship between band intensity and starting material, this approach is also quantitative ...
Q-PCR (quantitative PCR) is used to determine the quantity of starting nucleic acid template. There are 2 main methods: PCR with dsDNA dyes and PCR with probes. dsDNA dyes and probes allow measurement while the PCR is running, i.e. in real-time, and are therefore often named real-time PCR (see below). Probes are superior to dsDNA dyes but also more expensive. DNA can also be quantified with a simple PCR followed by agarose gel electrophoresis (qPCR end-point assay). If done properly with serial dilutions of starting DNA template to establish a linear relationship between band intensity and starting material, this approach is also quantitative ...
1. The two subunits α and β of Halobacterium cutirubrum DNA-dependent RNA polymerase are required in equimolar amounts for RNA synthesis to occur in vitro at the maximum rate. 2. In the absence of bivalent cations no interaction occurs between α and β subunits or between the subunits and DNA. 3. Mn2+ causes the subunits to form a 1:1 complex that still does not bind to the template. 4. Mg2+ permits binding of the Mn2+-mediated complex to DNA. 5. The complete enzyme, αβ, is inhibited by rifampicin and only the β subunit relieves the inhibition when added in excess. 6. Rifampicin-insensitive, template-dependent RNA synthesis occurs in the presence of protein α alone provided an oligonucleotide with a 5′-purine terminus is supplied as primer. 7. In the primed reaction with the α protein and an oligonucleotide, the template specificity is independent of the ionic strength, in contrast with the marked effect of salt concentration on the template specificity of the complete enzyme. 8. It is ...
TY - JOUR. T1 - Missense mutations in the 3 end of the Escherichia coli dnaG gene do not abolish primage activity but do confer the chromosome-segregation-defective (par) phenotype. AU - Versalovic, James. AU - Lupski, James R.. PY - 1997/1/1. Y1 - 1997/1/1. N2 - Isogenic dnaG strains of Escherichia coli with the parB and dnaG2903 alleles in the MG1655 chromosomal background displayed the classic par phenotype at the nonpermissive temperature of 42°C. These strains synthesized DNA at 42°C, but remained chromosome segregation defective as determined by cytology. A strain with the dnaG2903 allele was tested for its ability to support DNA replication of a primase-dependent G4ori(c)-containing M13 phage derivative by quantitative competitive PCR (QC-PCR). The dnaG2903 strain converted the single-stranded DNA into double-stranded replicative form DNA at 42°C. These results indicate that DnaG2903 retains primase activity at the restrictive temperature. Nucleoids remained unsegregated in the ...
Different pri1 and pri2 conditional mutants of Saccharomyces cerevisiae altered, respectively, in the small (p48) and large (p58) subunits of DNA primase, show an enhanced rate of both mitotic intrachromosomal recombination and spontaneous mutation, to an extent which is correlated with the severity of their defects in cell growth and DNA synthesis. These effects might be attributable to the formation of nicked and gapped DNA molecules that are substrates for recombination and error-prone repair, due to defective DNA replication in the primase mutants. Furthermore, pri1 and pri2 mutations inhibit sporulation and affect spore viability, with the unsporulated mutant cells arresting with a single nucleus, suggesting that DNA primase plays a critical role during meiosis. The observation that all possible pairwise combinations of two pri1 and two pri2 alleles are lethal provides further evidence for direct interaction of the primase subunits in vivo. Immunopurification and immunoprecipitation studies on wild
We provided in vivo and in vitro data indicating that D5 is a DNA primase. First, a D5 ts mutant complementation assay (13) demonstrated the importance of conserved amino acids in the predicted primase active site for DNA replication. Furthermore, purified recombinant D5 exhibited primase activity that depended on conserved amino acids in the predicted active site.. Primases are DNA-dependent RNA polymerases that synthesize oligoribonucleotides 2-15 nt or longer, usually starting with ATP or GTP (18). Generally, any single-stranded DNA can serve as a template, although there may be preferential usage of some sequences. D5 primase activity was demonstrated by using single-stranded circular φX174 and M13 phage templates. A discrete RNase-sensitive band migrated near the 14-nt marker. We cannot be sure of the actual length of this oligoribonucleotide, because the markers were phosphorylated, and small oligonucleotides migrate anomalously in high percentage polyacrylamide gels (33). However, the ...
TY - JOUR. T1 - Primase structure and function.. AU - Griep, M. A.. PY - 1995/8. Y1 - 1995/8. N2 - Primase is the ssDNA-dependent RNA polymerase that synthesizes RNA primers during DNA replication. In common with all DNA and RNA polymerases, primase has structural and functional features involved in polymer elongation. As RNA polymerase, it has structural and functional features for initiating chain synthesis. As a primase, it has structural and functional features for initiating chain synthesis on ssDNA. Using amino acid sequence analysis the structure of Escherichia coli primase responsible for binding zinc, at least three magnesium, and DnaB helicase has been identified. One of the magnesium binding motifs resembles the ¿active magnesium¿ motif found in all DNA and RNA polymerases. This motif can be considered to be involved in phosphodiester bond formation. The region with the putatuve zinc binding motif is the most highly conserved portion, including more than 25% of identical residues ...
DNA primases DNA templates. Bacterial DNA primases (DnaG enzymes) and DNA templates are available for HTS applications.. E. coli primase E. coli DnaG-DnaB complex, 10 µM for 100 assays.. DNA template for E. coli DNA primase assay. DNA template for E. coli DNA primase assay, 1000 assays. DNA template for S. aureus DNA primase assay DNA template for S. aureus DNA primase assay-1000 assays For other bacterial DNA primases and DNA templates including DNA primases from S. aureus, S. pneumonia. and H. influenza, please contact ProFoldin.. ...
Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Nature 387:78-81.9169868 ...
Amplifies nucleic acid templates using antibody-mediated hot-start, a blend of Taq DNA Polymerase and a proofreading enzyme, and AccuPrime accessory proteins for improved PCR fidelity, yield, and specificity over other hot-start DNA polymerases. AccuPrime Taq DNA Polymerase High Fidelity, 1000reactions ...
Methods are disclosed for producing libraries of nucleic acid molecules which libraries are derived from a nucleic acid template. The libraries comprise variant nucleic acids which are produced from a mutagenesis strategy using, e.g., a plurality of defined mutagenic and/or non-mutagenic primers and specific reaction conditions which favor the production of varied combinatorial mutants.
SWISS-MODEL Template Library (SMTL) entry for 4ud4.1. Structural Plasticity of Cid1 Provides a Basis for its RNA Terminal Uridylyl Transferase Activity
This gene encodes a DNA primase-polymerase that belongs to a superfamily of archaeao-eukaryotic primases. Members of this family have primase activity, catalyzing the synthesis of short RNA primers that serve as starting points for DNA synthesis, as well as DNA polymerase activity. The encoded protein facilitates DNA damage tolerance by mediating uninterrupted fork progression after UV irradiation and reinitiating DNA synthesis. An allelic variant in this gene is associated with myopia 22. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016 ...
UCL Discovery is UCLs open access repository, showcasing and providing access to UCL research outputs from all UCL disciplines.
bcv:Bcav_0491 no KO assigned , (GenBank) DNA primase small subunit (A) MARAQTPPVELDVAGRTVKVSSPDKVLFAGVGDGVTKLDVVRYFISVGEGILAALKERPT TLERWPQGYADGMKLTTRQGAKGDGFYSKRVPQYAPDWVEPVEITFPSGRTAEEVCPSEL AVVAWAAQQGTLTFHPWPVRRPEVDSPDQLRIDLDPQPGTDYVDSARLAPLVREVAAEAG LTAVPKTSGGRGVHVFAPIEPRWSFVEARRAVIALGREVERRAPEQVTTNWWKEERGERV FIDFNQMARDRTIASAYSIRANVRATVSAPLRWDEVDQVQPDDFTVLTMPDRFAEVGDLF AGANGDADHPAGSLDVLLEWAARDERDHGLGDLPYPPEYPKMPGEPKRVQPSRDRDRPRD D ...
A carboxy-terminal peptide of the poliovirus replicase protein (p63) was chemically synthesized, coupled to bovine serum albumin carrier, and injected into rabbits. The resulting antisera reacted with six virus-specific proteins from HeLa cells infected with poliovirus: NCVP 0b, NCVP 1b, NCVP 2, a protein of about 60,000 daltons, p63, and NCVP 6b. The identity of the 60,000-dalton protein is not known, but the other results were consistent with previous experimental approaches which demonstrated that p63 and the other four polypeptides have common coding sequences. An amino-terminal peptide of p63 failed to elicit an immune response in rabbits. Antibodies raised against the p63 carboxy-terminal peptide inhibited poliovirus replicase and polyuridylic acid polymerase activities in vitro, providing strong support for earlier suggestions that these activities are a property of a single virus-specific polypeptide. ...
Multifunctional ATP-dependent RNA helicase. The ATPase activity can be stimulated by various ribo- and deoxynucleic acids indicative for a relaxed substrate specificity. In vitro can unwind partially double-stranded DNA with a preference for 5-single-stranded DNA overhangs. Is involved in several steps of gene expression, such as transcription, mRNA maturation, mRNA export and translation. However, the exact mechanisms are not known and some functions may be specific for a subset of mRNAs. Involved in transcriptional regulation. Can enhance transcription from the CDKN1A/WAF1 promoter in a SP1-dependent manner. Found associated with the E-cadherin promoter and can down-regulate transcription from the promoter. Involved in regulation of translation initiation. Proposed to be involved in positive regulation of translation such as of cyclin E1/CCNE1 mRNA and specifically of mRNAs containing complex secondary structures in their 5UTRs; these functions seem to require RNA helicase activity. ...
Toone W.M., Rudd K.E., Friesen J.D.. We have cloned and sequenced a new gene from Escherichia coli which encodes a 64-kDa protein. The inferred amino acid sequence of the protein shows remarkable similarity to eIF4A, a murine translation initiation factor that has an ATP-dependent RNA helicase activity and is a founding member of the D-E-A-D family of proteins (characterized by a conserved Asp-Glu-Ala-Asp motif). Our new gene, called deaD, was cloned as a gene dosage-dependent suppressor of temperature-sensitive mutations in rpsB, the gene encoding ribosomal protein S2. We suggest that the DeaD protein plays a hitherto unknown role in translation in E. coli.. J. Bacteriol. 173:3291-3302(1991) [PubMed] [Europe PMC] ...
Buy DBP8 recombinant protein, ATP-dependent RNA helicase DBP8 (DBP8) Recombinant Protein-XP_001525308.1 (MBS1038466) product datasheet at MyBioSource, Recombinant Proteins
ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), DEAD box protein 6, EC 3.6.4.13, EC 3.6.1, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, ...
ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity (PubMed:20059948, PubMed:28633017). Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons (PubMed:20059948, PubMed:28633017). Acts downstream of piRNA biogenesis: exclusively required for transposon silencing in the nucleus, suggesting that it acts as a nuclear effector in the nucleus together with PIWIL4 (PubMed:28633017).
Effect of depurination location on replicase activity in vitro. Regions of RNA3 were treated with PAP and then ligated to the remaining RNA to regenerate full-l
DNA polymerase alpha subunit B; May play an essential role at the early stage of chromosomal DNA replication by coupling the polymerase alpha/primase complex to the cellular replication machinery (679 aa ...
The coordination of primase function within the replisome is an essential but poorly understood feature of lagging strand synthesis. By using crystallography and small-angle X-ray scattering (SAXS), we show that functional elements of bacterial primase transition between two dominant conformations: …
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked (DDX3X) is a gene that encodes a protein that belongs to the large DEAD-box protein family. The protein functions in the in the nucleus and the cytoplasm of the cell and exhibits ATP-dependent RNA helicase activity and RNA-independent ATPase activity. Missense mutations, nonsense mutations, silent mutations, and frameshift deletions are observed in cancers such as endometrial cancer, skin cancer, and stomach cancer.. DDX3X is altered in 0.14% of all cancers. The most common alterations in DDX3X are DDX3X D506G (0.00%) and DDX3X Mutation (0.00%) [3]. ...
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of…
The human primosome is a 340-kilodalton complex of primase (DNA-dependent RNA polymerase) and DNA polymerase α, which initiates genome replication by synthesizing chimeric RNA-DNA primers for DNA polymerases δ and ϵ. Accumulated biochemical and structural data reveal the complex mechanism of concerted primer synthesis by two catalytic centers. First, primase generates an RNA primer through three steps: initiation, consisting of dinucleotide synthesis from two nucleotide triphosphates; elongation, resulting in dinucleotide extension; and termination, owing to primase inhibition by a mature 9-mer primer. Then Polα, which works equally well on DNA:RNA and DNA:DNA double helices, intramolecularly catches the template primed by a 9mer RNA and extends the primer with dNTPs. All primosome transactions are highly coordinated by autoregulation through the alternating activation/inhibition of the catalytic centers. This coordination is mediated by the small C-terminal domain of the primase accessory subunit,
CP000675.RHLE Location/Qualifiers FT CDS complement(351367..352611) FT /codon_start=1 FT /transl_table=11 FT /gene=rhlE FT /locus_tag=LPC_0327 FT /product=ATP-dependent RNA helicase, DEAD box family FT /db_xref=EnsemblGenomes-Gn:LPC_0327 FT /db_xref=EnsemblGenomes-Tr:ABQ54322 FT /protein_id=ABQ54322.1 FT /translation=MSFKQLALIEPLNRAVSELGYTNPTSIQLKAIPLILNGHDLLGSA FT QTGTGKTASFVLPILQKASQQTQTSRNRVKVLILTPTRELAIQVHESIIQYGKYLTLRS FT AVIYGGVKSHNQIKQLDSGLEILVATPGRLLDLYQQGAVKFDEIDTLVLDEADRMLDMG FT FIHDIKKIIKLLPLKRQNLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTV FT YSVDRNHKLALLSHLLHKNNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQ FT RTKALADFKSGKVQTLIATDIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGAS FT GLAVSLVSTEEIKLLLSIEKLINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYK FT GNISRKSRTAFNKSA MSFKQLALIE PLNRAVSELG YTNPTSIQLK AIPLILNGHD LLGSAQTGTG KTASFVLPIL 60 QKASQQTQTS RNRVKVLILT PTRELAIQVH ESIIQYGKYL TLRSAVIYGG VKSHNQIKQL 120 DSGLEILVAT PGRLLDLYQQ GAVKFDEIDT LVLDEADRML DMGFIHDIKK IIKLLPLKRQ 180 NLLFSATFTP EVRTLARNIL ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
pfo:Pfl01_1211 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] , (GenBank) putative ATP-dependent DNA ligase (A) MKDFAGLYAELDATTSSNAKLAAMQTYFAQAQPQDAAWAVYFLSGGRPRQLVPVRILRDL AVEMSGLAPWLFEESYQAVGDLAETISLVLPEHPYTSEAGLAEWIEDKLLPLRGETPEYL AHQLPALWAQLDRPSLMLCIKLITGSFRVGVSKLLVTRALASMAGLDSKRVAQRLVGYTD LSNRPNAASYLKLIAPESSDEHAQRGGQPYPFFLAHALAQPVETFEALLGPASNWQVEWK WDGIRAQVVKRDGKLWVWSRGEELVTERFPELDTLVHGLPDGTVIDGEIVVWKNRRPVTE DAFDPQSTEAPAVQPFALLQQRIGRKSLDRKILEDAPVVVLAYDLLEWQGEDWRNQPQAR RREQLEQVIARCNNPVLLPSPILTGDDWFDLARQREASRRLGVEGMMLKARDAMYGVGRT KDMGVWWKWKVDPFSVDAVLIYAQRGHGRRASLYSDYTFAVWDGPPGASARALVPFAKAY SGLTDAEMREVDSIVRKTTVEKFGPVSSVKPSLVFELGFEGIALSRRHKSGIAVRFPRML RWRQDKTVDEADSLATLQNLLV ...
tr:I3E9F3_BACMT] ykoU; putative ATP-dependent DNA ligase YkoU; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] ...
Buy Yon-Ka Paris Skincare Alpha Complex online at SkinStore with free shipping! We have a great range of Yon-Ka Paris Skincare Skin Care products available.
Human DBR1 partial ORF ( NP_057300.2, 445 a.a. - 538 a.a.) recombinant protein with GST-tag at N-terminal. (H00051163-Q01) - Products - Abnova
Structural biologists at CSHL shed light on how a family of enzymes called TUTases regulate let-7, an essential regulator of development that is dyregulated in lung and kidney cancers, among others.
The putative ATP-dependent RNA helicase LGP2 is encoded by the DHX58 gene in humans. LGP2 is also known as DEXH (Asp-Glu-X-His) box polypeptide 58; probable ATP-dependent RNA helicase DHX58, DHX58, protein D11Lgp2 homolog, RIG-I-like receptor LGP2, RLR, RLR3, D11LGP2, and D11LGP2E. LGP2 was first identified in mammary tissue, but its function was subsequently found to be more relevant in innate antiviral immunity. It is essential for producing effective antiviral responses against many viruses that are recognized by the receptors DDX58/RIG-I and IFIH1/MDA5. This role of LGP2, which can have both positive and negative regulatory effects, is complex and depends on the characteristics of the infecting virus and the target cells. It is suggested that its positive regulatory role may involve unwinding or stripping nucleoproteins of viral RNA, thereby facilitating their recognition by viral receptors. LGP2 binds to ds RNA with high affinity, but it can also bind ss RNA.. ...
The putative ATP-dependent RNA helicase LGP2 is encoded by the DHX58 gene in humans. LGP2 is also known as DEXH (Asp-Glu-X-His) box polypeptide 58; probable ATP-dependent RNA helicase DHX58, DHX58, protein D11Lgp2 homolog, RIG-I-like receptor LGP2, RLR, RLR3, D11LGP2, and D11LGP2E. LGP2 was first identified in mammary tissue, but its function was subsequently found to be more relevant in innate antiviral immunity. It is essential for producing effective antiviral responses against many viruses that are recognized by the receptors DDX58/RIG-I and IFIH1/MDA5. This role of LGP2, which can have both positive and negative regulatory effects, is complex and depends on the characteristics of the infecting virus and the target cells. It is suggested that its positive regulatory role may involve unwinding or stripping nucleoproteins of viral RNA, thereby facilitating their recognition by viral receptors. LGP2 binds to ds RNA with high affinity, but it can also bind ss RNA.. ...
Haemophilus influenzae ATP-dependent RNA helicase SrmB homolog (srmB) datasheet and description hight quality product and Backed by our Guarantee
301167776 - EP 0624641 B1 2000-12-13 - Thermostable nucleic acid polymerase - [origin: EP0624641A2] The invention relates to purified thermostable DNA polymerases from Pyrodictium species, such as Pyrodictium occultum or Pyrodictium abyssi, which polymerases catalyze the combination of nucleoside triphosphates to form a nucleic acid strand complementary to a nucleic acid template strand. The preferred polymerases are characterized by their ability to function efficiently in a polymerase chain reaction, wherein said reaction includes repeated exposure to a denaturation temperature of about 100 DEG C. Most preferably the polymerases display 5 - 3 exonuclease activity, i.e. are proofreading enzymes. The invention also provides DNAs encoding the DNA polymerase activity of the said Pyrodictium species, which DNAs can be used to construct recombinant vectors and transformed host cells for production of polypeptides having said activity. The invention also relates to the preparation of said thermostable DNA
ATP-dependent RNA helicase DDX39 is an enzyme that in humans is encoded by the DDX39 gene. This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. GRCh38: Ensembl release 89: ENSG00000123136 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000005481 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Peelman LJ, Chardon P, Nunes M, Renard C, Geffrotin C, Vaiman M, Van Zeveren A, Coppieters W, van de Weghe A, Bouquet Y, et al. (Aug 1995). The BAT1 gene in the MHC encodes ...
TY - JOUR. T1 - DNA primase polypeptide 1 (PRIM1) involves in estrogen-induced breast cancer formation through activation of the G2/M cell cycle checkpoint. AU - Lee, Wei-Hwa. AU - Chen, Li-Ching. AU - Lee, Chia-Jung. AU - Huang, Chi-Cheng. AU - Ho, Yuan-Soon. AU - Yang, Po-Sheng. AU - Ho, Chi-Tang. AU - Chang, Hang-Lung. AU - Lin, I-Hsuan. AU - Chang, Hui-Wen. AU - Liu, Yun-Ru. AU - Wu, Chih-Hsiung. AU - Tu, Shih-Hsin. N1 - © 2018 UICC.. PY - 2019/2/1. Y1 - 2019/2/1. N2 - The DNA primase polypeptide 1 (PRIM1) is responsible for synthesizing small RNA primers for Okazaki fragments generated during discontinuous DNA replication. PRIM1 mRNA expression levels in breast tumor samples were detected by real-time PCR analysis. Xenografted tumor model was established to study the carcinogenic role of PRIM1 and its potential therapeutic applications. The average PRIM1 mRNA (copy number × 10 3/μg) expression was 4.7-fold higher in tumors than in normal tissue (*p = 0.005, n = 254). PRIM1 was detected ...
Nowadays modern biology aims at unravelling the strands of complex biological structures such as the protein-protein interaction (PPI) networks. A key concept in the organization of PPI networks is the existence of dense subnetworks (functional modules) in them. In recent approaches clustering algorithms were applied at these networks and the resulting subnetworks were evaluated by estimating the coverage of well-established protein complexes they contained. However, most of these algorithms elaborate on an unweighted graph structure which in turn fails to elevate those interactions that would contribute to the construction of biologically more valid and coherent functional modules. In the current study, we present a method that corroborates the integration of protein interaction and microarray data via the discovery of biologically valid functional modules. Initially the gene expression information is overlaid as weights onto the PPI network and the enriched PPI graph allows us to exploit its
RefSeq Summary (NM_001164239): DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009 ...
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene ...
Background Probable ATP-dependent RNA helicase. Plays a role in ribosome biogenesis and TP53/p53 regulation through its interaction with NPM1 (PubMed23019224). Description DDX31 Polyclonal Antibody, Biotin Conjugated. Biotin....
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Complete information for TRNT1 gene (Protein Coding), TRNA Nucleotidyl Transferase 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for TRNT1 gene (Protein Coding), TRNA Nucleotidyl Transferase 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
By submitting you agree to receive email from TechTarget and its partners. If you reside outside of the United States, you consent to having your personal data transferred to and processed in the United States. Privacy. ...
Host factor for Q beta, Host factor for Q beta, Host factor for Q beta, Host factor for Q beta, Host factor for Q beta, Host factor for Q beta, 5-R(*AP*UP*UP*UP*UP*UP*G)-3 ...
DDX58, 0.1 ml. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases which are implicated in a number of cellular processes involving R binding and alteration of R secondary structure.
436 Seventh Avenue, Suite 2800. Pittsburgh, PA 15219-1818. -. Phone: 412.227.2800. Toll Free: 888.227.0913. Fax: 412.227.2805 ...
G53.1* Ochrnutie viacerých hlavových nervov pri infekčných a parazitárnych chorobách zatriedených inde (A00 - B99†). ...