2.1.2 - RuBP regeneration | Plants in Action
[[{fid:101,view_mode:default,fields:{format:default,field_file_image_alt_text[und][0][value]:,field_file_image_title_text[und][0][value]:,field_caption[und][0][value]:%3Cp%3EFigure%202.2.%26nbsp%3BA%20simplified%20(above)%20and%20detailed%20(below)%20description%20of%20the%20photosynthetic%20carbon%20reduction%20(PCR)%20cycle.%20The%20fixation%20of%20CO%3Csub%3E2%3C%2Fsub%3E%20by%20Rubisco%20to%20the%20acceptor%20molecule%20RuBP%20initiates%20the%20cycle%20with%20the%20production%20of%20two%20molecules%20of%20PGA.%20The%20subsequent%2C%20enzyme%20catalysed%2C%20gene
Search Results
Several hits in gapped BLAST to lacA-related proteins, e.g. residues 4-150 are 43% similar to the enzyme from M.tuberculosis. Residues 5-151 are 40% similar to MG396, a predicted lacA/rpiB galactoside acetyltransferase. Other similarities involve hypothetical proteins and predicted phosphoriboisomerase B proteins (rpiB), e.g. residues 2-153 are 36% similar to RPIB_ECOLI. No significant similarities to T.pallidum or C.trachomatis ...
KAKEN - Researchers | KUBOTA Fumitake (50136602)
Affiliation:九大,(連合)農学研究科(研究院),教授, Research Field:作物学,作物,Crop science/Weed science, Keywords:光合成,水稲,光合成速度,水ストレス,クロロフィル蛍光,RuBPオキシゲナーゼ,ヘテロシス,RuBPカルボキシラーゼ,蒸散速度,光化学系, # of Research Projects:12, # of Research Products:4
Methylthioribose-1-phosphate isomerase
This enzyme functions in the methionine salvage pathway by catalyzing the interconversion of methylthioribose-1-phosphate and methythioribulose-1-phosphate. Elevated expression of the encoded protein is associated with metastatic melanoma and this protein promotes melanoma cell invasion independent of its enzymatic activity. Mutations in this gene may be associated with vanishing white matter disease (VMWD). [provided by RefSeq, Jul 2016 ...
RCA - Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic precursor - Arabidopsis thaliana (Mouse-ear cress) -...
Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.
HOGENOM: AEPER1 1 PE483
ID AEPER1_1_PE483 STANDARD; PRT; 370 AA. AC AEPER1_1_PE483; Q9YE84; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE RecName: Full=Putative methylthioribose-1-phosphate isomerase; DE Short=M1Pi; Short=MTR-1-P isomerase; EC=5.3.1 23;AltName: Full=MTNA-like DE protein; Short=aMTNA;AltName: Full=S-methyl-5-thioribose-1-phosphate DE isomerase; (AEPER1_1.PE483). GN OrderedLocusNames=APE_0686; OS AEROPYRUM PERNIX K1. OC Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales; OC Desulfurococcaceae; Aeropyrum. OX NCBI_TaxID=272557; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS AEPER1_1.PE483. CC Aeropyrum pernix K1, complete genome. CC annotated by Ensembl Genomes CC -!- ANNOTATIONS ORIGIN:MTNA_AERPE CC -!- FUNCTION: Catalyzes the interconversion of methylthioribose-1- CC phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P) CC (By similarity). CC -!- CATALYTIC ACTIVITY: ...
S. aureus Expression Data Browser
Carbohydrates,One-carbon Metabolism,Formaldehyde assimilation Ribulose monophosphate pathway,6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44 ...
rbcL - Ribulose bisphosphate carboxylase - Aciduliprofundum boonei (strain DSM 19572 / T469) - rbcL gene & protein
Catalyzes the addition of molecular CO(2) and H(2)O to ribulose 1,5-bisphosphate (RuBP), generating two molecules of 3-phosphoglycerate (3-PGA). Functions in an archaeal AMP degradation pathway, together with AMP phosphorylase and R15P isomerase.
Rubisco enzyme molecule - Stock Image F006/9776 - Science Photo Library
Rubisco. Molecular model of the enzyme rubisco (ribulose bisphosphate carboxylase oxygenase) complexed with 2-carboxyarabinitol biphosphate. Rubisco is thought to be the most abundant and important protein found in nature. It occurs in all plants and fixes carbon dioxide during photosynthesis. - Stock Image F006/9776
Photorespiration and RuBisCO | Hydrobates
The enzyme at the centre of the fixation of carbon in photosynthesis (which is the ultimate source of our food) is RuBisCO (Ribulose Bisphosphate Carboxylase Oxygenase). It is sometimes called the lazy enzyme because it works so slowly. This is unjust since the process is so difficult that RuBisCO is the only enzyme that can…
Genatlas sheet
involvement of APIP in the methionine salvage pathway, which plays a key role in many biological functions like cancer, apoptosis, microbial proliferation and inflammation ...
March | 2018 | Microrna Library
Given that the Calvin-Benson-Bassham (CBB) cycle enzymes downstream of RuBisCO require reducing equivalents, it is an advantage that Hg2+ inhibits RuBisCO, shutting GKT137831 nmr down the CBB cycle, making reducing equivalents available to mercuric reductase. We anticipate that enzymes of the Quayle pathway were inhibited (given the lack of carbon assimilation), forcing oxidation. of formaldehyde and formate to CO2 to generate reducing equivalents to meet requirements of the detoxification. It should be noted that hexulose-3-phosphate synthase (EC 4.1.2.43) - a key enzyme in the Quayle pathway - in M. capsulatus (Bath) is inhibited by Hg2+ at 100 μM (Ferenci et al., 1974). Cytochrome c oxidase was unable to reduce Hg2+ under the assay conditions employed PFT�� cost - either with cytochrome c550 or with ferrocyanide as the cofactor. - the specific activities were zero in both cases. The specific activity of an apparent mercuric reductase (± SEM; n = 7) was 352 (±18) nmol NADH oxidized ...
Effect of Mg2+on the Structure and Function of Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase | SpringerLink
Mg2+ in various concentrations was added to purified Rubisco in vitro to gain insight into the mechanism of molecular interactions between Mg2+ and Rubisco. The enzyme activity assays showed that the
VIGGS:Automatic updates
Glycine max Ribulose bisphosphate carboxylase small chain 1, chloroplastic (RBCS-1), mRNA; nuclear gene for chloroplast product ...
RCSB PDB - Protein Feature View - Ribulose bisphosphate carboxylase large chain - P0C512 (RBL ORYSJ)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Structures: Phosphoribulokinase (IPR006082) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Characteristics of ribulose-1,5-bisphosphate carboxylase/oxygenase degradation by lysates of mechanically isolated chloroplasts...
TY - JOUR. T1 - Characteristics of ribulose-1,5-bisphosphate carboxylase/oxygenase degradation by lysates of mechanically isolated chloroplasts from wheat leaves. AU - Miyadai, Kenji. AU - Mae, Tadahiko. AU - Makino, Amane. AU - Ojima, Kunihiko. PY - 1990/4. Y1 - 1990/4. N2 - The lysate from intact chloroplasts mechanically isolated from primary leaves of 9 day old seedlings of wheat (Triticum aestivum L. var Aoba) was incubated in the pH range of 5.5 to 8.5 at 37°C for 5 hours. Proteolytic activity against ribulose-1.5-bisphosphate carboxylase/oxygenase (Rubisco, EC 4.1.1.39) was estimated by disappearance of the large subunit of Rubisco or the appearance of its degradation products. Although the activity in lysates was weak, the products were detected by applying Western blotting. The degradation products were similar to those obtained when Rubisco was incubated with the lysate of vacuoles isolated from like leaves. Although some of the products were similar to those from vacuole lysates, ...
Plus it
C4 photosynthesis is based on the division of labor between two distinct photosynthetically active cell types: mesophyll and bundle sheath cells. After conversion to HCO3−CO2 is initially fixed in mesophyll cells by phosphoenolpyruvate carboxylase in the form of either malate or Asp and then transported into bundle sheath cells. There CO2 is released, refixed by ribulose-1,5-bis-phosphate carboxylase/oxygenase (Rubisco), and finally enters the Calvin-Benson cycle as it occurs in C3 plants. As a bifunctional enzyme, Rubisco is able to catalyze the carboxylation as well as the oxygenation of its substrate ribulose 1,5-bisphosphate. The fixation of O2 leads to accumulation of phosphoglycolate, which is toxic for plant cells. To regenerate phosphoglycerate from phosphoglycolate, photorespiration is essential. However, this metabolic pathway leads to the loss of previously fixed CO2 and thus decreases the efficiency of photosynthesis. The high concentration of CO2 in the bundle sheath cells, caused ...
Diversity of Sulfate-Reducing Bacteria in Oxic and Anoxic Regions of a Microbial Mat Characterized by Comparative Analysis of...
Lineage F.Lineage F is deeply diverging and defined by two highly similar DSR sequences not closely related to any available pure culture sequence. It demonstrates a weak specific association withDesulfotomaculum ruminis by KITCH analysis but forms an independent lineage by all other applied treeing methods.. There is a general need in microbial ecology to more directly relate community structure to community functions. Within the analytical framework of comparative gene sequencing, the most direct linkages are provided by genes encoding key physiological attributes. Several genes have been used in this way, including those for nitrogenase (3, 52-54), [NiFe] hydrogenase (48), ribulose bisphosphate carboxylase/oxygenase (33), methane monooxygenase (30), and ammonia monooxygenase (36, 37). However, with the possible exception of ammonia monooxygenase (restricted to two well-defined lineages within the proteobacteria), none of these genes provide fully comprehensive or consistent coverage. The DSR ...
VUB Biology Notes 10/22
Background on plant strategies under high heat/light low water conditions. C4 Plants: These plants thrive in environments with high temperatures and low humidities where the stomata in the leaves must be closed. Under these circumstances carbon dioxide concentrations fall in the leaves while oxygen rises, favoring photorespiration over photosynthesis and greatly reducing productivity. (In photorespiration oxygen binds competitively with carbon dioxide at the active site of RuBisCo: the net result is that Ru-1,5-bis P is oxidized and energy and carbon are lost instead of gained.) In C4 plants the photosynthesizing cells are protected from the atmosphere by a layer of mesophyll cells. In these cells the PEP carboxylase reaction is used to capture carbon dioxide, with the resulting oxaloacetate carbons transported to the photosynthesizing cell. [Figure 10.17, p 183] {overhead, H} The first compound incorporating the carbon dioxide thus has four carbons and hence the name (unlike in the Calvin cycle ...
Acireduktonska sintaza - Wikipedia
Myers, R.W., Wray, J.W., Fish, S. and Abeles, R.H. (1993). Purification and characterization of an enzyme involved in oxidative carbon-carbon bond cleavage reactions in the methionine salvage pathway of Klebsiella pneumoniae. J. Biol. Chem. 268: 24785-24791. PMID 8227039. ...
Plantae | Diversity of CO2 concentrating mechanisms and responses to CO2 concentration in marine and freshwater diatoms ($) |...
The CO2-fixing enzyme ribulose bisphosphate carboxylase (Rubisco) works most efficiently at high concentrations of CO2. Many organisms have evolved…
SSDB Motif Search Result: pmc:P9515 06141
K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] , (GenBank) rbcL; Ribulose bisphosphate carboxylase, large ...
Sequence Similarity Search - BLAST
csg:Cylst_2043 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) ribulose bisphosphate carboxylase small subunit (A) MQTLPKERRYETLSYLPPLSDAQIAKQIQYILNQGYIPAIEFNETSEPTELYWTMWKLPL FGAKSTQEVLGEVQGCRSQFNNCYIRVVGFDNIKQCQVLSFLVHKPNKY ...
Sequence Similarity Search - BLAST
syc:syc0129_c K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) rbcS; ribulose bisphosphate carboxylase small subunit (A) MSMKTLPKERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKL PLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRPGRY ...
SSDB Motif Search Result: brs:S23 53960
K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) cbbS; ribulose bisphosphate carboxylase small ...
Publikationen der Gruppe | Max-Planck-Institut für Molekulare Pflanzenphysiologie
Heineke, D.; Sonnewald, U.; Buessis, D.; Guenter, G.; Leidreiter, K.; Wilke, I.; Raschke, K.; Willmitzer, L.; Heldt, H.-W.: Apoplastic Expression of Yeast-Derived Invertase in Potato - Effects on Photosynthesis, Leaf Solute Composition, Water Relations, and Tuber Composition. Plant Physiology 100 (1), S. 301 - 308 (1992 ...
Publikationen von Lothar Willmitzer | Max-Planck-Institut für Molekulare Pflanzenphysiologie
Heineke, D.; Sonnewald, U.; Buessis, D.; Guenter, G.; Leidreiter, K.; Wilke, I.; Raschke, K.; Willmitzer, L.; Heldt, H.-W.: Apoplastic Expression of Yeast-Derived Invertase in Potato - Effects on Photosynthesis, Leaf Solute Composition, Water Relations, and Tuber Composition. Plant Physiology 100 (1), S. 301 - 308 (1992 ...
Phospho-4EBP1 (Thr36, Thr45), eFluor 660, clone: V3NTY24, eBioscience™ 100 Tests; eFluor 660 Phospho-4EBP1 (Thr36, Thr45),...
Phospho-4EBP1 (Thr36, Thr45), eFluor 660, clone: V3NTY24, eBioscience™ 100 Tests; eFluor 660 Phospho-4EBP1 (Thr36, Thr45), eFluor 660, clone: V3NTY24,...
What Are the Three Stages of Photosynthesis? | Reference.com
Photosynthesis has two main stages: light reactions and the Calvin cycle; the Calvin cycle has three stages called carbon fixation, reduction and regeneration of RuBP. Photosynthesis is a chemical...
Emendation of Methylobacillus Yordy and Weaver 1977, a Genus for Methanol-Utilizing Bacteria | Microbiology Society
The group 1 methanol-utilizing bacteria examined in this study are gram-negative, nonsporeforming, rod-shaped organisms which use the ribulose monophosphate pathway for methanol utilization. These organisms are generally motile by means of a single polar flagellum, but a small number of strains are nonmotile, and although most are obligately methylotrophic, several strains utilize D-fructose in addition to methanol. Their deoxyribonucleic acid base composition ranges from 50.0 to 56.0 mol% guanine plus cytosine. Their cellular fatty acids consist predominantly of large amounts of straight-chain saturated C16:0 acid and unsaturated C16:1 acid. The major ubiquinone is Q-8, and Q-7 and Q-9 are present as minor components. Type strain TK 0113 (= Yordy and Weaver T-11 = ATCC 29475 = JCM 2850 = NCIB 11375) of Methylobacillus glycogenes is included in this group. The genus Methylobacillus was established based on the description of only one nonmotile strain, which does not utilize D-fructose. Therefore, we
Variations in subunit amino acid compositions and kinetics of ruBP carboxylase among cassava cultivars | ScholarBank@NUS
Variations were observed in the large and small subunit amino acid compositions of RuBP carboxylase of 15 cassava cultivars. The Km (CO2) values ranged from 12.2 to 18.7 μM, while the Km (RuBP) values ranged from 11.8 to 55.6 μM. © 1989 ...
Formaldehyde Fixation | ISB Server Wahoo
Remember to wear gloves and be very careful of the fixatives!!! Remember which side of the coverslip has the cells. Remember to discard used fix into the appropriate hazardous waste container in the chemical hood in the main lab.. Paraformaldehyde fixation. Fixative Stocks: 32% Paraformaldehyde: bottle under chemical hood in main lab. Detergent: 10% triton X 100. To make 10 mls of fixative: Paraformaldehyde: 1 mL stock 10% triton: 0.5 ml 10X PBS -/- 1 mL add water make 10 mL (8.5 mL). Use same method as Formaldehyde fixation.. ...
area and changes in photosynthetic CO 2 flux in arctic ecosystems? - PDF
Journal of Ecology 2007 What is the relationship between changes in canopy leaf Blackwell Publishing Ltd area and changes in photosynthetic CO 2 flux in arctic ecosystems? L. E. STREET, G. R. SHAVER, M.
Effects of season-long elevated CO2 concentration and temperature on photosynthesis and rubisco activity and amount in field...
Effects of season-long elevated CO2 concentration and temperature on photosynthesis and rubisco activity and amount in field sown ...
Undergraduate Publications - 2004
Zhang Y, Heinsen MH, Kostic M, Pagani GM, Riera TV, Perovic I, Hedstrom L, Snider BB, Pochapsky TC. Analogs of 1-phosphonooxy-2,2-dihydroxy-3-oxo-5-(methylthio)pentane, an acyclic intermediate in the methionine salvage pathway: a new preparation and characterization of activity with E1 enolase/phosphatase from Klebsiella oxytoca. Bioorg Med Chem. 2004;12(14):3847-55. ...
CO2-Responsive Expression and Gene Organization of Three Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase Enzymes and...
FIG. 3. Immunoblot analyses of CbbLS-1, CbbLS-2, and CbbM RubisCOs. CFE (3 μg) were resolved on an SDS-15% polyacrylamide gel and transferred to a polyvinylidene difluoride membrane. An anti-CbbLS-1 oligopeptide antibody (a), an anti-CbbLS-2 oligopeptide antibody (b), and an anti-form II RubisCO antibody raised against CbbM from H. marinus (c) were used. CFE were prepared from 15% (lane 1), 2% (lane 2), 0.15% (lane 3), or 0.03% (lane 4) CO2 cultures. ...
The isolation, purification, and characterization of ribulose-1, 5-bisphosphate carboxylase/oxygenase from comfrey
This volume was digitized and made accessible online due to deterioration of the original print copy. If you are the author of this work and would like to have online access removed, please contact the Library Administration Office, 785-532-7400, [email protected] ...
early sandgrass - Encyclopedia of Life
Definition: one of three metabolic pathways for carbon fixation in photosynthesis, along with C4 and CAM. This process converts carbon dioxide and ribulose bisphosphate (RuBP, a 5-carbon sugar) into 3-phosphoglycerate through the following reaction: CO2 + H2O + RuBP → (2) 3-phosphoglycerate This reaction occurs in all plants as the first step of the Calvin-Benson cycle ...
Vantanea parviflora Lam. data - Encyclopedia of Life
Definition: one of three metabolic pathways for carbon fixation in photosynthesis, along with C4 and CAM. This process converts carbon dioxide and ribulose bisphosphate (RuBP, a 5-carbon sugar) into 3-phosphoglycerate through the following reaction: CO2 + H2O + RuBP → (2) 3-phosphoglycerate This reaction occurs in all plants as the first step of the Calvin-Benson cycle ...
Mint - Encyclopedia of Life
Definition: one of three metabolic pathways for carbon fixation in photosynthesis, along with C4 and CAM. This process converts carbon dioxide and ribulose bisphosphate (RuBP, a 5-carbon sugar) into 3-phosphoglycerate through the following reaction: CO2 + H2O + RuBP → (2) 3-phosphoglycerate This reaction occurs in all plants as the first step of the Calvin-Benson cycle ...
Internal structure of Chloroplast - HourlyBook
Electron microscopy shows the chloroplast to consist of an envelope enclosing a complex of membranes, the thylakoid system often joined or stacked into grana; the lipid membranes, contrast with the background when stained with lipophilic electron dense osmium. The space between the envelope and thylakoid membranes is the chloroplast stroma. The envelope is composed of two membranes each about 5.6 nm thick separated by the intra envelope space (10 nm) with areas of high electron density which are possibly contact points between the membranes; they may be involved in transport, i.e., of proteins between cytosol and stroma. The membranes are lipid bilayers, of galactosyl glycerides and phosphatidyl choline, containing carotenoids but no chlorophyll.. The stroma contains indistinct granules and particles, mainly of proteins; the enzyme ribulose bisphosphate carboxylase (Rubisco) is the major soluble protein and may crystallize in unfavorable conditions such as water stress or air pollution. Other ...
Home - Galdieria sulphuraria 074W
Galdieria sulphuraria is a unicellular red alga found in hot sulphur springs. It is acido-thermophilic and can grow both autotrophically and heterotrophically in the dark. Other than living in extreme conditions of temperature and acidity, it can also tolerate high concentrations of metal ions. All these characteristics make it an ideal organism for genome sequencing and understanding the process of adaptation to extreme conditions and also genome evolution.The estimates for the genome size of Galdieria sulphuraria vary, depending on the method used, around 10 Mbp (Muravenko et al. 2001; Moreira et al., 1994) and 17 Mbp. There are also conflicting reviews on the chromosome number, ranging from 2 (Muravenko et al., 2001) to 40 (Moreira et al., 1994). ...
Sparrho | Light modulation of Rubisco in Arabidopsis requires a capac
The light activation of ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) in vivo requires the presence of Rubisco activase, a nuclear-encoded chloropla
ribulose 1,5-bisphosphate carboxylase, large subunit [Oscillatoria acu - Protein - NCBI
This record was replaced or removed. The sequence YP_007084606 is 100% identical to WP_015147336.1 over its full length. Be aware that a NCBI nonredundant RefSeq protein (WP_) can be annotated on large numbers of bacterial genomes that encode that identical protein.. Old YP_007084606.1 New WP_015147336.1 Identical proteins Re-annotation project. ...
eScienceCommons: 2016
DNA barcoding is a way to identify species via their species-specific genetic signatures. To do this for pollen, scientists sequence the DNA from a genetic region known to occur in all plants, but which varies from species to species. There are two parts to the standardized sequence we use for plant DNA barcoding. One is a section of the large subunit of a gene called ribulose-1,5-bisphosphate carboxylase/oxygenase (rbcL for short). The other is a gene called maturase-K (matK). These genes are both essential for a plant to survive, and are thus present in all plants. Once an investigator sequences these gene regions from a sample, they can be compared to a database containing all the known DNA sequences of rbcL and matK to identify the species ...
PDB 3rub structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBI
3rub: Crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase/oxygenase from tobacco refined at 2.0-A resolution.
When does the Calvin cycle of photosynthesis begin? | Reference.com
The Calvin cycle of photosynthesis begins after light energy is transformed into chemical energy by the cells of plants. The adenosine triphosphate, or ATP, molecules created power the Calvin cycle....
Immunohistochemistry - Leakage of protein from nucleus?
Also, are you *sure* that you can trust the authors re: location of your protein ? Could *they* have created an artifact somehow ? Could this protein be nuclear-localized in certain types of cells or under specific conditions, and cytoplasm-localized under other conditions or in other cells ? A. Paul ,pd1 at mole.bio.cam.ac.uk, wrote in message news:3BBC9CFA.FEF22A0A at mole.bio.cam.ac.uk... , , , Melissa Greeve wrote: , , , Is this a logical explanation? Why would one protein act like this , , when fixed in 95% ethanol and not the other (both have similar , , cellular functions)? Can a PhD get any more complicated?? , , , , , , You could try formaldehyde fixation. 4% formaldehyde in PBS for 20 min , at RT , works well for a wide variety of antigens and cell types and in my hands , give sensible results for various nuclear antigens. , , Paul , , , , ...
Tissue expression of MRI1 - Staining in kidney - The Human Protein Atlas
Expression of MRI1 (MGC3207, MRDI, mtnA, Ypr118w) in kidney tissue. Antibody staining with HPA042744 and CAB045988 in immunohistochemistry.
SAUSA300 0504 - AureoWiki
Staphylococcus aureus; strain: USA300_FPR3757; locus tag: SAUSA300_0504 (SAUSA300_RS02700); symbol: pdxS; product: pyridoxal biosynthesis lyase PdxS
Biology-Online • View topic - calvin cycle question
If were supposed to have the same amount of Calvin cycle-chemicals before and after, then how many C3 molecules can you make from 48 C1 molecules? If you calculate this, you should be able to get the rest ...
Refresh, Reboot and Recharge- YPR Atlanta GA (Virtual) | YPR - Young People In Recovery
A virtual event for participants to recharge in preparation for the upcoming week and connect with one another to support each other on our recovery journeys! Tentative launch date is August ...
Natures smallest factory: The Calvin cycle - Cathy | TED-Ed
A hearty bowl of cereal gives you the energy to start your day, but how exactly did that energy make its way into your bowl? It all begins with photosynthesis,
Calvin and Hobbes: The Series (Fanfic) - TV Tropes
Calvin and Hobbes: The Series is a Fan Fic series co-authored by Swing 123 and garfieldodie. It is perhaps the main installment in what is unofficially …