KEGG BRITE: KEGG Orthology (KO) - Lingula anatina
K01164 POP1; ribonuclease P/MRP protein subunit POP1 [EC:3.1.26.5] K01164 POP1; ribonuclease P/MRP protein subunit POP1 [EC:3.1.26.5] K14523 RPP38; ribonucleases P/MRP protein subunit RPP38 [EC:3.1.26.5] K14523 RPP38; ribonucleases P/MRP protein subunit RPP38 [EC:3.1.26.5] K03538 POP4; ribonuclease P protein subunit POP4 [EC:3.1.26.5] K03538 POP4; ribonuclease P protein subunit POP4 [EC:3.1.26.5] K03537 POP5; ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5] K14525 RPP25; ribonucleases P/MRP protein subunit RPP25 [EC:3.1.26.5] K14527 RPP20; ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5] K14527 RPP20; ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5] K14529 RPP14; ribonuclease P protein subunit RPP14 [EC:3.1.26.5] K03539 RPP1; ribonuclease P/MRP protein subunit RPP1 [EC:3.1.26.5] K03540 RPR2; ribonuclease P protein subunit RPR2 [EC:3.1.26.5] K03540 RPR2; ribonuclease P protein subunit RPR2 [EC:3.1.26.5] K14530 RPP40; ribonucleases P/MRP protein subunit RPP40 [EC:3.1.26.5] K14530 ...
Transition-state stabilization in Escherichia coli ribonuclease P RNA-mediated cleavage of model substrates
We have used model substrates carrying modified nucleotides at the site immediately 5 of the canonical RNase P cleavage site, the -1 position, to study Escherichia coli RNase P RNA-mediated cleavage. We show that the nucleobase at -1 is not essential but its presence and identity contribute to efficiency, fidelity of cleavage and stabilization of the transition state. When U or C is present at -1, the carbonyl oxygen at C2 on the nucleobase contributes to transition-state stabilization, and thus acts as a positive determinant. For substrates with purines at -1, an exocyclic amine at C2 on the nucleobase promotes cleavage at an alternative site and it has a negative impact on cleavage at the canonical site. We also provide new insights into the interaction between E. coli RNase P RNA and the -1 residue in the substrate. Our findings will be discussed using a model where bacterial RNase P cleavage proceeds through a conformational-assisted mechanism that positions the metal(II)-activated H2O for ...
anti-processing of precursor 1, ribonuclease P/MRP subunit antibody product blog
Blog on anti-processing of precursor 1, ribonuclease P/MRP subunit antibody product: The processing of precursor 1, ribonuclease P/MRP subunit n/a (Catalog #MBS716341) is an Antibody produce...
RPP30 - Wikipedia
Ribonuclease P protein subunit p30 is an enzyme that in humans is encoded by the RPP30 gene. GRCh38: Ensembl release 89: ENSG00000148688 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000024800 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Eder PS, Kekuda R, Stolc V, Altman S (Mar 1997). Characterization of two scleroderma autoimmune antigens that copurify with human ribonuclease P. Proc Natl Acad Sci U S A. 94 (4): 1101-6. doi:10.1073/pnas.94.4.1101. PMC 19751 . PMID 9037013. Stolc V, Altman S (Oct 1997). Rpp1, an essential protein subunit of nuclear RNase P required for processing of precursor tRNA and 35S precursor rRNA in Saccharomyces cerevisiae. Genes Dev. 11 (18): 2414-25. doi:10.1101/gad.11.18.2414. PMC 316520 . PMID 9308968. Entrez Gene: RPP30 ribonuclease P/MRP 30kDa subunit. Maruyama K, Sugano S (1994). Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. Gene. 138 (1-2): 171-4. ...
The ancient history of the structure of ribonuclease P and the early origins of Archaea | BMC Bioinformatics | Full Text
Ribonuclease P is an ancient endonuclease that cleaves precursor tRNA and generally consists of a catalytic RNA subunit (RPR) and one or more proteins (RPPs). It represents an important macromolecular complex and model system that is universally distributed in life. Its putative origins have inspired fundamental hypotheses, including the proposal of an ancient RNA world. To study the evolution of this complex, we constructed rooted phylogenetic trees of RPR molecules and substructures and estimated RPP age using a cladistic method that embeds structure directly into phylogenetic analysis. The general approach was used previously to study the evolution of tRNA, SINE RNA and 5S rRNA, the origins of metabolism, and the evolution and complexity of the protein world, and revealed here remarkable evolutionary patterns. Trees of molecules uncovered the tripartite nature of life and the early origin of archaeal RPRs. Trees of substructures showed molecules originated in stem P12 and were accessorized with a
Structure of the Specificity Domain of Bacterial RNase P
In our work, we report the crystal structure of the 154 nucleotide long S-domain of Bacillus subtilis RNase P at 3.15 resolution (Krasilnikov et al., 2003). This is the second largest atomic resolution structure of an RNA molecule solved so far that is not in complex with proteins. Solving this structure involved paying meticulous attention to all aspects of the structure elucidation process, from the way the crystals were grown and handled, to the way data were processed and analyzed. The S-domain crystals are very sensitive to any environmental changes, and hence it was crucial to develop a protocol for handling and cryo-cooling the crystals that preserved isomorphism among them. Additionally, as the crystals diffracted very weakly, all data collection was done at a synchrotron source. In order to solve the structure, we had to screen for heavy atom derivatives as we could not easily incorporate an anomalous scatterer into the structure. Although the final data sets were collected at DND CAT ...
ribonuclease P/MRP 30 subunit ELISA Kits | Biocompare.com
Compare ribonuclease P/MRP 30 subunit ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
Distinct modes of mature and precursor tRNA binding to Escheri...
Distinct modes of mature and precursor tRNA binding to Escherichia coli RNase P RNA revealed by NAIM analyses.: We have analyzed by nucleotide analog interferen
한국과학기술원 도서관
M1 RNA, the catalytic component of Escherichia coli RNase P, is derived by 3` processing from pM1 RNA, a major transcript of the rnpB gene. This 3` processing occurs by two pathways involving multiple steps. The pM1 RNA molecule has an rne-dependent site downstream of the processing site, GAUUU, whose sequence variation affects the processing efficiency. In this thesis, first, roles of the sequence of the rne-dependent site on the pathways of 3` processing of M1 RNA were examined. The results showed that the primary sequence itself of the rne-dependent site possessed the ability to determine the processing pathways. Therefore, the sequence of the rne-dependent site seems not only to affect the processing efficiency, but also to guide the RNA metabolic pathway. The sequence of the rne-dependent site also affected the substrate specificity by generating the processing products at one nucleotide upstream or downstream from the normal cleavage sites. Interestingly, in case of the variants involving ...
HIPHOP chemogenomics database
Subunit of both RNase MRP and nuclear RNase P; RNase MRP cleaves pre-rRNA, while nuclear RNase P cleaves tRNA precursors to generate mature 5 ends and facilitates turnover of nuclear RNAs; binds to the RPR1 RNA subunit in RNase P. Zygosity: Heterozygous strain ...
OriGene - RPP14 (NM 001098783) cDNA Clone
RPP14 - RPP14 (untagged)-Human ribonuclease P/MRP 14kDa subunit (RPP14), transcript variant 1 available for purchase from OriGene - Your Gene Company.
Ribonuclease P | Springer for Research & Development
Altman, S., Baer, M.F., Bartkiewicz, M., Gold, H., Guerrier-Takada, C., Kirsebom, L.A., Lumelsky, N., Peck, K.: Gene, 82, 63-64 (1989) (Review)PubMedCrossRefGoogle Scholar ...
Brevet US20030134295 - Method for detection of pathogenic organisms - Google Brevets
A method for detection of pathogenic organisms wherein the method includes differentiation between species. The method is especially suitable to detect and to diagnose infection by pathogenic organisms which are hard and/or laborious to detect with conventional methods. The method relies upon analysis of specific variable regions of the RNase P RNA gene, namely the P3 and/or P19 region(s).
POP1 Gene - GeneCards | POP1 Protein | POP1 Antibody
Complete information for POP1 gene (Protein Coding), POP1 Homolog, Ribonuclease P/MRP Subunit, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
OriGene - POP1 (NM 015029) cDNA Clone
POP1 - POP1 (untagged)-Human processing of precursor 1, ribonuclease P/MRP subunit (S. cerevisiae) (POP1), transcript variant 3 available for purchase from OriGene - Your Gene Company.
ANKRD20A4-ANKRD20A20P Gene - GeneCards | ANKRD20A4-ANKRD20A20P RNA Gene
Complete information for ANKRD20A4-ANKRD20A20P gene (RNA Gene), ANKRD20A4-ANKRD20A20P Readthrough, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
A view of RNase P - Molecular BioSystems (RSC Publishing)
Major progress in the study of RNase P has resulted from crystallography of bacterial catalytic subunits and the discovery of catalytic activity in eukaryotes. Several new substrates have also been identified, primarily in bacteria but also in yeast. Our current world should be called the
Author Search Results
Abstract:. The dissemination of AAC(6)-I-type acetyltransferases have rendered amikacin and other aminoglycosides all but useless in some parts of the world. Antisense technologies could be an alternative to extend the life of these antibiotics. External guide sequences are short antisense oligoribonucleotides that induce RNase P-mediated cleavage of a target RNA by forming a precursor tRNA-like complex. Thirteen-nucleotide external guide sequences complementary to locations within five regions accessible for interaction with antisense oligonucleotides in the mRNA that encodes AAC(6)-Ib were analyzed. While small variations in the location targeted by different external guide sequences resulted in big changes in efficiency of binding to native aac(6)-Ib mRNA, most of them induced high levels of RNase P-mediated cleavage in vitro. Recombinant plasmids coding for selected external guide sequences were introduced into Escherichia coli harboring aac(6)-Ib, and the transformant strains were ...
Nobel :: 1989 - Sidney Altman
Sidney Altman (1939 - present) was awarded half the 1989 Nobel Prize in Chemistry for his discovery of catalytic properties of RNA. Working separately from fellow Nobel Laureate Thomas R. Cech, Altman experimented with ribonuclease P (RNase P), an enzyme that catalyzes the breakdown of RNA into smaller components, and showed that the RNA component of RNase P was sufficient for its observed catalytic activity. This meant that the RNA itself had catalytic properties. Before this finding, it was believed that that protein subunit of RNase P was responsible for catalysis. RNase P also exists in eukaryotic organisms, and Altman later discovered that the protein subunits of eukaryotic Rnase P are essential to its catalytic activity, in contrast to the bacterial RNase P. ...
Biomolecules | Free Full-Text | Sequence Analysis and Comparative Study of the Protein Subunits of Archaeal RNase P
RNase P, a ribozyme-based ribonucleoprotein (RNP) complex that catalyzes tRNA 5′-maturation, is ubiquitous in all domains of life, but the evolution of its protein components (RNase P proteins, RPPs) is not well understood. Archaeal RPPs may provide clues on how the complex evolved from an ancient ribozyme to an RNP with multiple archaeal and eukaryotic (homologous) RPPs, which are unrelated to the single bacterial RPP. Here, we analyzed the sequence and structure of archaeal RPPs from over 600 available genomes. All five RPPs are found in eight archaeal phyla, suggesting that these RPPs arose early in archaeal evolutionary history. The putative ancestral genomic loci of archaeal RPPs include genes encoding several members of ribosome, exosome, and proteasome complexes, which may indicate coevolution/coordinate regulation of RNase P with other core cellular machineries. Despite being ancient, RPPs generally lack sequence conservation compared to other universal proteins. By analyzing the relative
RNase P as a tool for disruption of gene expression in maize cells | Biochemical Journal
RNase P, a ribonucleoprotein responsible for the 5´ maturation of precursor tRNAs (ptRNAs) in all organisms, can be enticed to cleave any target mRNA that forms a ptRNA-like structure and sequence-specific complex when bound to an RNA, termed the EGS (external guide sequence). In the present study, F3H (flavanone 3-hydroxylase), a key enzyme in the flavonoid biosynthetic pathway that participates in the formation of red-coloured anthocyanins, was used as a target for RNase P-mediated gene disruption in maize cells. Transient expression of an EGS complementary to the F3H mRNA resulted in suppression of F3H to 29% of the control, as indicated by a reduced number of anthocyanin-accumulating cells. This decrease was not observed in experiments where a disabled mutant EGS was expressed. Our results demonstrate the potential of employing plant RNase P, in the presence of an appropriate gene-specific EGS, as a tool for targeted degradation of mRNAs.. ...
Structural insight into the human mitochondrial tRNA purine N1-methyltransferase and ribonuclease P complexes. - Nuffield...
Mitochondrial tRNAs are transcribed as long polycistronic transcripts of precursor tRNAs and undergo posttranscriptional modifications such as endonucleolytic processing and methylation required for their correct structure and function. Among them, 5-end processing and purine 9 N1-methylation of mitochondrial tRNA are catalyzed by two proteinaceous complexes with overlapping subunit composition. The Mg2+-dependent RNase P complex for 5-end cleavage comprises the methyltransferase domain-containing protein tRNA methyltransferase 10C, mitochondrial RNase P subunit (TRMT10C/MRPP1), short-chain oxidoreductase hydroxysteroid 17β-dehydrogenase 10 (HSD17B10/MRPP2), and metallonuclease KIAA0391/MRPP3. An MRPP1-MRPP2 subcomplex also catalyzes the formation of 1-methyladenosine/1-methylguanosine at position 9 using S-adenosyl-l-methionine as methyl donor. However, a lack of structural information has precluded insights into how these complexes methylate and process mitochondrial tRNA. Here, we used a
Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human...
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
Ribonuclease P | Harvard Catalyst Profiles | Harvard Catalyst
Morinishi Y, Imai K, Nakagawa N, Sato H, Horiuchi K, Ohtsuka Y, Kaneda Y, Taga T, Hisakawa H, Miyaji R, Endo M, Oh-Ishi T, Kamachi Y, Akahane K, Kobayashi C, Tsuchida M, Morio T, Sasahara Y, Kumaki S, Ishigaki K, Yoshida M, Urabe T, Kobayashi N, Okimoto Y, Reichenbach J, Hashii Y, Tsuji Y, Kogawa K, Yamaguchi S, Kanegane H, Miyawaki T, Yamada M, Ariga T, Nonoyama S. Identification of severe combined immunodeficiency by T-cell receptor excision circles quantification using neonatal guthrie cards. J Pediatr. 2009 Dec; 155(6):829-33 ...
Robert L. | Smith College
Zhang, J.*, Huang, J.*, Say, C. T.*, Dorit, R. L., Queeney, K. T., Deconvoluting the effects of surface chemistry and nanoscale topography: Pseudomonas aeruginosa biofilm nucleation on Si-based substrates, J. Colloid Interface Sci. 2018, 519, 203-213.. Dorit, R, S. Roy, M. Riley, eds. 2016. The Bacteriocins: Current Knowledge and Future Prospects. Caister Academic Press.. Dorit, R. 2015. How Ebola Breached Its Ecological Barriers. American Scientist 103 (5): 256-259.. J. L. Loveland, J. Rice, P. Turrini, M. Lizotte-Waniewski, R. L. Dorit. 2014. Essential is not Irreplaceable: The Fitness Dynamics of Experimental E. coli RNase P RNA Heterologous Replacement. Journal of Molecular Evolution 79 (3-4):143-52.. R.L. Dorit, C. M. Roy, S. M. Robinson, M.A. Riley (2013) The Evolutionary Histories of Clinical and Environmental SHV β-Lactamases are Intertwined. Journal of Molecular Evolution 76 (6). ...
SWISS-MODEL Repository | C6A460
SWISS-MODEL Repository entry for C6A460 (RNP2_THESM), Ribonuclease P protein component 2. Thermococcus sibiricus (strain DSM 12597 / MM 739)
Comparison of HER2:RNase P ratio in breast cancer cell | Open-i
Comparison of HER2:RNase P ratio in breast cancer cell line genomic DNA using digital and quantitative real-time PCR. (a) Software-generated heat map showing a
DeCS Ingl s+escopo
RNA that has catalytic activity. The catalytic RNA sequence folds to form a complex surface that can function as an enzyme in reactions with itself and other molecules. It may function even in the absence of protein. There are numerous examples of RNA species that are acted upon by catalytic RNA, however the scope of this enzyme class is not limited to a particular type of substrate. . ...
Smok Rpm 80 PRO - Thanet vape co
The new pod mod ERA is upon us with the RPM80 series, featuring the newly developed IQ-80 Chipset, the RPM80 Series stands out among all pod mods. It offers a variety of intelligent features and functional protection, becoming a mighty game-changer in the pod mod category. Not only has the Chipset been newly developed
RENCANA PELAKSANAAN PEMBELAJARAN ( RPP ) BERKARAKTER EXPLORASI, ELABORASI, KONFIRMASI
APLIKASI Koreksi SOAL - *LJK dan Koreksi dengan KAMERA HP Via Aplikasi Zipgrade* *LJK dan Koreksi dengan KAMERA HP Via Aplikasi Zipgrade* Guru sering membuat tes kepada siswa d... ...
Identification of 43 Streptococcus species by pyrosequencing analysis of the rnpB gene.
Bacterial Typing Techniques, Base Sequence, Blood/microbiology, Comparative Study, Culture Media, Humans, Molecular Sequence Data, RNA; Bacterial/genetics, Reagent Kits; Diagnostic, Reproducibility of Results, Ribonuclease P/chemistry/*genetics, Sequence Analysis; DNA/*methods, Species Specificity, Streptococcus/*classification/enzymology/genetics, Variation (Genetics ...
RNase P in Archaea webinar
So the subject of this lecture is RNase P in the other branch of life on Earth; the Archaea. The Archaea are a group of prokaryotic organisms that are really independent of the Bacteria, and if anything are more closely related geneologically to the eukaryotes (Eukarya) than to the Bacteria. In addition to being a distinct group, they are generally primative. In many ways, the molecular biology of the Archaea probably resembles those of the ancestors of the eukaryotes, and have proven to be very useful in sorting out the simpler roots of modern eukaryotic complexity.. ...
CRISPR Targets Track Settings
The entire human (hg38) genome was scanned for the -NGG motif. Flanking 20mer guide sequences were aligned to the genome with BWA and scored with MIT Specificity scores using the command-line version of crispor.org. Non-unique guide sequences were skipped. Flanking sequences were extracted from the genome and input for Crispor efficiency scoring, available from the Crispor downloads page, which includes the Doench 2016, Moreno-Mateos 2015 and Bae 2014 algorithms, among others.. Note that the Doench 2016 scores were updated by the Broad institute in 2017 (Azimuth update). As a result, earlier versions of the track show the old Doench 2016 scores and this version of the track shows new Doench 2016 scores. Old and new scores are almost identical, they are correlated to 0.99 and for more than 80% of the guides the difference is below 0.02. However, for very few guides, the difference can be bigger. In case of doubt, we recommend the new scores. Crispor.org can display both scores and many more ...
CRISPR Targets Track Settings
The entire human (hg38) genome was scanned for the -NGG motif. Flanking 20mer guide sequences were aligned to the genome with BWA and scored with MIT Specificity scores using the command-line version of crispor.org. Non-unique guide sequences were skipped. Flanking sequences were extracted from the genome and input for Crispor efficiency scoring, available from the Crispor downloads page, which includes the Doench 2016, Moreno-Mateos 2015 and Bae 2014 algorithms, among others.. Note that the Doench 2016 scores were updated by the Broad institute in 2017 (Azimuth update). As a result, earlier versions of the track show the old Doench 2016 scores and this version of the track shows new Doench 2016 scores. Old and new scores are almost identical, they are correlated to 0.99 and for more than 80% of the guides the difference is below 0.02. However, for very few guides, the difference can be bigger. In case of doubt, we recommend the new scores. Crispor.org can display both scores and many more ...
A protein subunit from an enzyme is part of a research study and needs to be
A protein subunit from an enzyme is part of a research study and needs to be characterized. A total of 0.135g of this subunit was dissolved in enough water to produce 2.00 mL of solution. At 28 ∘C the osmotic pressure produced by the solution was 0.138 atm. What is the molar mass of the protein? ...
Enzyme Gene | Semantic Scholar
Enzyme Genes encode Enzymes, biological molecules (usually proteins) that possess catalytic activity. Catalytic RNA and catalytic DNA molecules have also been identified. (NCI)
Different cleavage sites are aligned differently in the active site of M1 RNA, the catalytic subunit of Escherichia coli RNase...
Base Sequence, Binding Sites, Catalysis, Cations; Divalent, Endoribonucleases/genetics/*metabolism, Escherichia coli/*enzymology, Escherichia coli Proteins, Hydrolysis, Molecular Sequence Data, Nucleic Acid Conformation, RNA; Catalytic/genetics/*metabolism, RNA; Messenger/chemistry/*metabolism, RNA; Transfer/chemistry/metabolism, Ribonuclease P ...
RNAi as a potential new therapy for HIV infection<...
TY - JOUR. T1 - RNAi as a potential new therapy for HIV infection. AU - Wheeler, Lee A.. AU - Dykxhoorn, Derek M.. PY - 2008/12/1. Y1 - 2008/12/1. N2 - Controlling HIV infection continues to be a major clinical and scientific challenge. Despite the therapeutic benefits associated with HAART, the need for novel treatment approaches to combat HIV-1 remains. Effective inhibition of HIV-1 infection has been achieved by harnessing the endogenous RNAi pathway in a variety of cell types, including primary T cells and macrophages. Here we discuss the opportunities and challenges associated with translating these findings into clinically relevant therapeutic approaches.. AB - Controlling HIV infection continues to be a major clinical and scientific challenge. Despite the therapeutic benefits associated with HAART, the need for novel treatment approaches to combat HIV-1 remains. Effective inhibition of HIV-1 infection has been achieved by harnessing the endogenous RNAi pathway in a variety of cell types, ...
RNA STRAND molecule page
I.LI DE LA SIERRA-GALLAY,N.MATHY,O.PELLEGRINI, C.CONDON. STRUCTURE OF THE UBIQUITOUS 3 PROCESSING ENZYME RNASE Z BOUND TO TRANSFER RNA.. NAT.STRUCT.MOL.BIOL. V. 13 376 2006 US ISSN 1545-9993 ...
Tröegs Hopback Amber Ale | Tröegs Brewing Company | BeerAdvocate
Tröegs Hopback Amber Ale is a American Amber / Red Ale style beer brewed by Tröegs Brewing Company in Hershey, PA. 3.97 average with 3106 ratings, reviews and opinions.
Tröegs DreamWeaver Wheat | Tröegs Brewing Company | BeerAdvocate
Tröegs DreamWeaver Wheat is a Hefeweizen style beer brewed by Tröegs Brewing Company in Hershey, PA. 3.72 average with 1968 ratings, reviews and opinions.
Sodba Splošnega sodišča (tretji senat) z dne 6. februarja 2014.#Arkema France in CECA SA proti Evropski komisiji.#Konkurenca -...
4 notranja politika Evropske unije * 4.08 EGS/ESKonkurenca * Konkurenca * 4.08.03 Izvajanje pravil konkurence * 4.08.03.02 Postopek uporabe pravil konkurence s strani Komisije * 4.08.03.02.08 Postopek uporabe pravil konkurence - Sklep Komisije * Sklep Komisije * 4 notranja politika Evropske unije * 4.08 EGS/ESKonkurenca * Konkurenca * 4.08.03 Izvajanje pravil konkurence * 4.08.03.02 Postopek uporabe pravil konkurence s strani Komisije * 4.08.03.02.02 Postopek uporabe pravil konkurence - Prenehanje kršitev: pooblastila Komisije * Prenehanje kršitev: pooblastila Komisije * 4 notranja politika Evropske unije * 4.08 EGS/ESKonkurenca * Konkurenca * 4.08.03 Izvajanje pravil konkurence * 4.08.03.02 Postopek uporabe pravil konkurence s strani Komisije * 4.08.03.02.08 Postopek uporabe pravil konkurence - Sklep Komisije * Sklep ...
Products of the Benzene + O(3P) Reaction
Author(s): Osborn, David L. | Abstract: The gas-phase reaction of benzene with O(3P) is of considerable interest for modeling of aromatic oxidation, and also because there exist fundamental questions concerning the prominence of intersystem crossing in the reaction. While its overall rate constant has been studied extensively, there are still significant uncertainties in the product distribution. The reaction proceeds mainly through the addition of the O atom to benzene, forming an initial triplet diradical adduct, which can either dissociate to form the phenoxy radical and H atom, or undergo intersystem crossing onto a singlet surface, followed by a multiplicity of internal isomerizations, leading to several possible reaction products. In this work, we examined the product branching ratios of the reaction between benzene and O(3P) over the temperature range of 300 to 1000 K and pressure range of 1 to 10 Torr. The reactions were initiated by pulsed-laser photolysis of NO2 in the presence of benzene and
BioProduct: Chemicals & Compounds: Gefitinib: Gefitinib
MCF10A cells are nontransformed breast epithelial cells that require EGF to proliferate.The monolayer growth of these EGF-driven untransformed cells is inhibited by ZD1839 with an IC50 of 20 nM, similar to its IC50 in vitro for EGFR and consistent with effective inhibition of EGFR in vivo. Cell line characteristics and sensitivity to ZD1839 at 1uM are 59% inhibition for MDA-MB-231,74% inhibition for A431, 81% inhibition for SKBr3,60% inhibition for SKOV3, 33% inhibition for BT474,52% inhibition for MCF-7, 28% inhibition for T47D, respectively ...
Probable ribonuclease ZC3H12C
MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPWSTVENPSMDT 1 - 70 VNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQLCRSPCLEPHILKRNEILQDF 71 - 140 KPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEADQ 141 - 210 TVSTINTITRETSSLESQRSESPMQEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLER 211 - 280 GHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGII 281 - 350 VSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGK 351 - 420 KCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQ 421 - 490 SDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGQYP 491 - 560 SMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERRFSLDTDYRISSVASDCSSEG 561 - 630 SMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHK 631 - 700 PPLPHLALHLPHSAVGARSSCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSR 701 - 770 QEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREK 771 - 840 ...
Index of /torc/C3/Software/5.1.1/rpm
Release: C3 v5.1.1 MD5SUMs: d6c96bbe4c8eacfc72da459b6815cf83 c3-5.1.1-1.noarch.rpm f52101e84fac38d51e26f5a51ae63ed3 c3-5.1.1-1.src.rpm b7714a0ad1564a06ed4422b65799ce1e c3-c3cmd-filter-5.1.1-1.noarch.rpm 1c1830e8b1dc67ca945068b9beaf165e c3-ckillnode-5.1.1-1.noarch.rpm 062c4afc1f92ed51128dc49d768ff465 c3-contrib-5.1.1-1.noarch.rpm ...
Inactivation of LPS and RNase A on photocatalytically active surfaces
Publikations-Datenbank der Fraunhofer Wissenschaftler und Institute: Aufsätze, Studien, Forschungsberichte, Konferenzbeiträge, Tagungsbände, Patente und Gebrauchsmuster
PQDT Open
Intersections of distinct biological pathways in cells allow for nodes of metabolic regulation. This work describes the discovery of the intersection of two pathways in yeast mitochondria: RNA processing and fatty acid synthesis and attachment. Analysis of the components of the pathways is presented here along with a model illustrating the connection as a potential mode of regulation of mitochondrial gene expression. A genome-wide screen of respiratory-deficient Saccharomyces cerevisiae deletion strains for defects in mitochondrial RNA processing revealed that two novel genes affect processing of mitochondrial tRNAs by RNase P. One gene encodes Htd2, an enzyme in the type II mitochondrial fatty acid synthesis pathway (FAS II). The other gene is described here as encoding Lip3, an enzyme involved in the synthesis and attachment of the co-factor lipoic acid, which is synthesized from a product of the FAS II pathway. RPM1 is the mitochondrial-encoded RNA subunit of mitochondrial RNase P. The ...
Ribonuclease complexed with RNA - Stock Image C035/8314 - Science Photo Library
Ribonuclease Rnase Z complexed with transfer RNA (ribonucleic acid). Computer model showing the structure of bacterial ribonuclease Rnase Z (orange) complexed with synthetic transfer RNA (cyan). From Bacillus subtilis. - Stock Image C035/8314
RCSB PDB - 488D: CATALYTIC RNA ENZYME-PRODUCT COMPLEX Structure Summary Page
488D: Capture and visualization of a catalytic RNA enzyme-product complex using crystal lattice trapping and X-ray holographic reconstruction.
Natural cow Ribonuclease A protein (ab52579) | Abcam
Buy our Natural cow Ribonuclease A protein. Ab52579 is an active full length protein produced in Nativesyntheticaly and has been validated in ChIP. Abcam…
Scientists Aim Gene-Targeting Breakthrough Against COVID-19
Scientists at Berkeley Lab and Stanford have joined forces to aim a gene-targeting, antiviral agent called PAC-MAN against COVID-19.
SMOK RPM160 POD MOD KIT | Vape Kit | Vape Center Uae
SMOK RPM160 Pod Mod Kit is the upgraded version of the extremely popular SMOK RPM80. The RPM 160 features the ability to use dual 18650 batteries...