Apparent conformational transitions induced in chicken liver pyruvate carboxylase by substrates, KHCO3 and MgATP, and the allosteric effector, acetyl-CoA, were studied by using the fluorescent probe, 8-anilinonaphthalene-1-sulphonic acid and c.d. Fluorescence measurements were made with both conventional and stopped-flow spectrophotometers. Additions of acetyl-CoA and/or ATP to the enzyme-probe solutions quenched fluorescence of the probe by the following cumulative amounts regardless of the sequence of additions: acetyl-CoA, 10-13%; ATP, 21-24%; acetyl-CoA plus ATP, about 35%. Additions of KHCO3 had no effect on the fluorescence. The rates of quenching by acetyl-CoA and MgATP (in the presence of acetyl-CoA) were too rapid to measure by stopped-flow kinetic methods, but kinetics of the MgATP effect (in the absence of acetyl-CoA) indicate three unimolecular transitions after the association step. The negligible effect of the probe on enzyme catalytic activity, a preservation of the near-u.v. c.d. ...
AIMS/HYPOTHESIS: The molecular mechanisms of insulin release are only partially known. Among putative factors for coupling glucose metabolism to insulin secretion, anaplerosis has lately received strong support. The anaplerotic enzyme pyruvate carboxylase is highly expressed in beta cells, and anaplerosis influences insulin secretion in beta cells. By inhibiting pyruvate carboxylase in rat islets, we aimed to clarify the hitherto unknown metabolic events underlying anaplerotic regulation of insulin secretion. METHODS: Phenylacetic acid (5 mmol/l) was used to inhibit pyruvate carboxylase in isolated rat islets, which were then assessed for insulin secretion, fuel oxidation, ATP:ADP ratio, respiration, mitochondrial membrane potential, exocytosis and ATP-sensitive K(+) channel (K(ATP)-channel) conductance. RESULTS: We found that the glucose-provoked rise in ATP:ADP ratio was suppressed by inhibition of pyruvate carboxylase. In contrast, fuel oxidation, respiration and mitochondrial membrane ...
Pyruvate carboxylase catalyzes the carboxylation of pyruvate to oxaloacetate. Pyruvate carboxylase is a mitochondrial protein that has a biotin prosthetic group that requ
1. The metabolism of L-alanine was studied in isolated guinea-pig kidney-cortex tubules. 2. In contrast with previous conclusions of Krebs [(1935) Biochem. J. 29, 1951-1969], glutamine was found to be the main carbon and nitrogenous product of the metabolism of alanine (at 1 and 5 mM). Glutamate and ammonia were only minor products. 3. At neither concentration of alanine was there accumulation of glucose, glycogen, pyruvate, lactate, aspartate or tricarboxylic acid-cycle intermediates. 4. Carbon-balance calculations and the release of 14CO2 from [U-14C]alanine indicate that oxidation of the alanine carbon skeleton occurred at both substrate concentrations. 5. A pathway involving alanine aminotransferase, glutamate dehydrogenase, glutamine synthetase, pyruvate dehydrogenase, pyruvate carboxylase and enzymes of the tricarboxylic acid cycle is proposed for the conversion of alanine into glutamine. 6. Strong evidence for this pathway was obtained by: (i) suppressing alanine removal by ...
View Notes - Fall 08 Exam 2 from MCDB 310 at University of Michigan. e. Phosphopentose isomerase a. Pyruvate carboxylase b. Pyruvate kinase c. PEP carboxykinase d. Glucose 6-phosphatase e. Fructose
View Notes - mcb100ExamIIISolutions from MCB 100 at Berkeley. GAP dehydrogenase - NADH b) pyruvate carboxylase c) biotin d) carbon dioxide or bicarbonate 5. a) phosphate + glycogen(n) ÅÆ
4HNV: Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
4HNU: Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
rendered the lactate and alanine the two largest metabo-lite peaks in the MRS spectrum (Fig. 2A). PDH fluxcould be assessed by the changes in [1-13C]bicarbonate levels (Fig. 2A,B). The anaplerotic role of pyruvate was Mice on Prolonged HFD Develop Hepatic Steato- observed by its conversion into OAA, a vital intermedi- sis, Glucose Intolerance, and Insulin Resistance. We ate metabolite involved in gluconeogenesis and oxidative first defined the pathophysiological effect of prolonged phosphorylation. [1-13C]OAA can be rapidly converted HFD feeding. HFD-fed mice developed hepatic steato- sis, with more than an 8-fold higher IHTG level than [1-13C]aspartate, and [6-13C]citrate, catalyzed by Chow-fed mice (Table 1). HFD mice were also hyper- PEPCK, malate dehydrogenase (MDH), aspartate trans- glycemic and hyperinsulinemic. Hematoxylin and eo- aminase (AST), and citrate synthase, respectively. In the sin and Oil Red O histology revealed massive lipid MRS spectra, we were able to detect [1-13C]malate ...
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
Chapter 16 (Part 3). Fatty acid Synthesis. ACP vs. Coenzyme A. Citrate Lyase. Citrate synthase. Malate dehydrogenase. Pyruvate carboxylase. Malate Enzyme. Fatty Acid Synthesis Occurs in the Cytosol. Acetyl-CoA Carboxylase. Acetyl-CoA + HCO 3 - + ATP  malonyl-CoA + ADP. Slideshow...
Liver mRNA expression of gluconeogenic and glycolytic enzymes.Liver mRNA expression of dams on d9 of lactation of pyruvate carboxylase (PC), phosphoenolpyruvate
... On-line free medical diagnosis assistant. Ranked list of possible diseases from either several symptoms or a full patient history. A similarity measure between symptoms and diseases is provided.
Biotin (vitamin H or vitamin B7) is the essential cofactor of biotin-dependent carboxylases, such as pyruvate carboxylase and acetyl-CoA carboxylase. Mammals cannot synthesize biotin, while in bacteria, fungi, and plants it is synthesized from pimelate thioester through different pathways. In E. coli and many organisms, pimelate thioester is derived from malonyl-ACP. The pathway starts with the methylation to malonyl-ACP methyl ester, followed by the fatty acid chain elongation cycle to form pimeloyl-ACP methyl ester, which is then demethylated to form pimeloyl-ACP [MD:M00572]. Pimeloyl-ACP is converted to biotin through the final four steps in the biotin bicyclic ring assembly, which are conserved among biotin-producing organisms [MD:M00123]. In B. subtilis, biotin is derived from pimeloyl-ACP formed by oxidative cleavage of long-chain acyl-ACPs [MD:M00573]. Some bacteria synthesize biotin from pimeloyl-CoA derived from pimelate [MD:M00577]. Biotin is covalently attached to biotin-dependent ...
Biotin (vitamin H or vitamin B7) is the essential cofactor of biotin-dependent carboxylases, such as pyruvate carboxylase and acetyl-CoA carboxylase. Mammals cannot synthesize biotin, while in bacteria, fungi, and plants it is synthesized from pimelate thioester through different pathways. In E. coli and many organisms, pimelate thioester is derived from malonyl-ACP. The pathway starts with the methylation to malonyl-ACP methyl ester, followed by the fatty acid chain elongation cycle to form pimeloyl-ACP methyl ester, which is then demethylated to form pimeloyl-ACP [MD:M00572]. Pimeloyl-ACP is converted to biotin through the final four steps in the biotin bicyclic ring assembly, which are conserved among biotin-producing organisms [MD:M00123]. In B. subtilis, biotin is derived from pimeloyl-ACP formed by oxidative cleavage of long-chain acyl-ACPs [MD:M00573]. Some bacteria synthesize biotin from pimeloyl-CoA derived from pimelate [MD:M00577]. Biotin is covalently attached to biotin-dependent ...
Acetyl-CoA carboxylase (ACC) is a biotin carboxylase that catalyzes the ATP-dependent condensation of acetyl-CoA and carbonate to form malonyl-CoA. The malonyl-CoA produced by ACC serves two major physiologic functions. It is an essential and rate-limiting substrate for de novo lipogenesis (DNL), and it acts as an allosteric inhibitor of the enzyme carnitine-palmitoyl transferase I (CPT-1). Acetyl-CoA carboxylase (ACC) inhibitors offer significant potential for the treatment of type 2 diabetes mellitus (T2DM), hepatic steatosis, and cancer. Acetyl-CoA carboxylase (ACC) in mammals is encoded by two related enzymes ACC1 and ACC2, which catalyze the ATP dependent carboxylation of acetyl-CoA to form malonyl-CoA. ACC1 encodes a cytoplasmic isoform that is thought to be the predominant isoform controlling FASyn, whereas ACC2 is tethered to the mitochondrial outer membrane, where localized malonyl-CoA production blocks CPT-1 function to prevent fatty acids from entering the mitochondria to undergo ...
Two stable cell lines expressing the hBMP2 gene, CHO-BMP2 and HEK-BMP2, were cultured in the presence of IND-1 in short-term (24 h, multi-well) and long-term (two-month, perfusion flasks) cultures. The rhBMP-2 produced was characterized by Western blot and its activity assessed using the C2C12 cell-based assay. The amount of proBMP-2 and mature BMP-2 produced was quantified by ELISA. The mRNA level of BMP-2 and furin in cells treated with or without IND-1 was compared by real-time RT-PCR. Cellular uptake of IND-1 was estimated by measuring the fluorescence of cell lysates following incubation with FITC labeled IND-1. Cellular PC activity post IND-1 incubation was measured using the Boc-RVRR-AMC substrate. Furin-specific siRNA was used to knock down the furin expression in CHO-BMP2 cells and its effect on the rhBMP-2 production was determined. ...
In Vivo Hyperpolarized Carbon-13 Magnetic Resonance Spectroscopy Reveals Increased Pyruvate Carboxylase Flux in an Insulin-Resistant Mouse Model Philip Lee,1,2 Waifook Leong,1,3 Trish Tan,1,3 Miangkee Lim,1 Weiping Han,1,3,4 and George K. Radda1 The pathogenesis of type 2 diabetes is characterized by impaired insulin action andincreased hepatic glucose production (HGP). Despite the importance of hepatic metabolicaberrations in diabetes development, there is currently no molecular probe that allows mea-surement of hepatic gluconeogenic pathways in vivo and in a noninvasive manner. In thisstudy, we used hyperpolarized carbon 13 (13C)-labeled pyruvate magnetic resonance spec-troscopy (MRS) to determine changes in hepatic gluconeogenesis in a high-fat diet (HFD)-induced mouse model of type 2 diabetes. Compared with mice on chow diet, HFD-fed micedisplayed higher levels of oxaloacetate, aspartate, and malate, along with increased 13C labelexchange rates between hyperpolarized [1-13C]pyruvate and its ...
Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503 ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
... ,Acetyl CoA Carboxylase Antibody,biological,biology supply,biology supplies,biology product
Amos Bairoch (born 22 November 1957) is a Swiss bioinformatician and Professor of Bioinformatics at the Department of Human Protein Sciences of the University of Geneva where he leads the CALIPHO group at the Swiss Institute of Bioinformatics (SIB) combining bioinformatics, curation, and experimental efforts to functionally characterize human proteins. His first project, as a Ph.D. student was the development of PC/Gene, an MS-DOS based software package for the analysis of protein and nucleotide sequences. PC/Gene was commercialized, first by a Swiss company (Genofit) then by Intelligenetics in the US which was later bought by Oxford Molecular.[citation needed] His main work is in the field of protein sequence analysis and more particularly in the development of databases and software tools for this purpose. His most important contribution is the input of human knowledge by careful manual annotation in protein-related data. While working on PC/Gene he started to develop an annotated protein ...
Acetyl-CoA Carboxylase 1 antibody (acetyl-CoA carboxylase alpha) for ICC/IF, IHC-P, WB. Anti-Acetyl-CoA Carboxylase 1 pAb (GTX132081) is tested in Human, Mouse, Rat samples. 100% Ab-Assurance.
The phosphoenolpyruvate carboxylase (PEPC) gene family of Arabidopsis is composed of four genes. Based on sequence analysis it was deduced that Atppc1, Atppc2 and Atppc3 genes encode plant-type PEPCs,
Acetyl-CoA Carboxylase alpha/ACACA products available through Novus Biologicals. Browse our Acetyl-CoA Carboxylase alpha/ACACA product catalog backed by our Guarantee+.
M.R. Munday; Regulation of mammalian acetyl-CoA carboxylase. Biochem Soc Trans 1 October 2002; 30 (5): A101. doi: https://doi.org/10.1042/bst030a101c. Download citation file:. ...
Compare & Order Acetyl-CoA Carboxylase beta Proteins from many different species. Find the right product on antibodies-online.com.
Hier sind die besten dokumente um PYC3703 an University of South Africa Unisa zu passieren. Finden PYC3703 Studienzusammenfassungen, Notizen, Aufgaben und vieles mehr.
MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKT 1 - 70 PSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQ 71 - 140 GQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSVAGSSRESTRKGSRASLGALSLEAYLTTGEA 141 - 210 ETRVPTMRPSMSGLHLVKRGREHKKLDLHRDFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIR 211 - 280 RWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAG 281 - 350 WGHASENPKLPELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK 351 - 420 RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQVQSEIPGSPIF 421 - 490 LMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAPLAIFEFMEQCAIRLAKTVGY 491 - 560 VSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGV 561 - 630 TPISFETPSNPPLARGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQF 631 - 700 GHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPD 701 - 770 IMLGVVCGALNVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM 771 - 840 ...
The Colleen Giblin Laboratories, in the context of the Division of Pediatric Neurology at the Columbia University Medical Center, enjoy a distinguished tradition of metabolic disease research and discovery. The Laboratories and the Division also remain at the forefront of investigative and clinical excellence in other areas such as sickle cell encephalopathy, pediatric brain tumors, pediatric epilepsy, storage diseases, fetal neurotoxicity and functional neuroimaging. Diseases like Reye syndrome, glucose transporter deficiency (Glut-1 DS), carnitine deficiency, pyruvate dehydrogenase deficiency and pyruvate carboxylase deficiency, among other mitochondrial disorders, were first identified/treated by members of the Division.. An unusually large patient base comprising referrals from every part of the world is available for metabolic research. A tissue culture bank containing some 1,000 samples with accompanying clinical descriptions has been established by Dr. De Vivo and constitutes a unique ...
Biotin-dependent carboxylases include acetyl-CoA carboxylase (ACC), propionyl-CoA carboxylase (PCC), 3-methylcrotonyl-CoA carboxylase (MCC), geranyl-CoA carboxylase, pyruvate carboxylase (PC), and...
Looking for biotin carboxylase? Find out information about biotin carboxylase. An enzyme which condenses bicarbonate with biotin to form carboxybiotin Explanation of biotin carboxylase
The sulfonyl chlorrde is subsequently condensed with a secondary amine to form a sulfonamide (Fig 8) that is analyzed on an OV-17 column. This procedure appears to be sensmve and specific for Tau. SOCl2 -I-BuOCOCl H2NCH2CH2S03H e A-BuOCONHCH2CH2S03 NaOH -I-BuOCONHCH2CH2SO2Cl Fig. 8 Derwatlzatlon nation, and amldatlon. e A-BuOCONHCH2CH2S02NR2 of Tau by lsobutoxycarbonylatlon, chlon- 8. Choice of Chromatographic Column There have been dramatic changes m the GC analysis of ammo acids over the last 20 yr. 1984) The molecular basis for the two different clmrcal presentations of classical pyruvate carboxylase deficiency Am J+ Human Genef. 36, 283-294. Romshe C A , Hllty M. , Kerzner B. and Remer C. B (1981) Ammo acid pattern m Reyes syndrome. Comparison with clmrcally similar entitles J Pedraf 98, 788-790 Schaffer S. , and Kocsis J J , eds (1981) The Effects of Taurme OM Exckble Tmues Spectrum, New York. 26 Sturman and Applegarth Striver C. , Clow C. L , and Lamm I (1971) Plasma ammo acids Screenmg, ...
Metabolic & Genetic Information Center Inborn erros of metabolism PYRUVATE CARBOXYLASE DEFICIENCY LACTIC ACIDEMIA WITHOUT HYPOXEMIA, LEIGH SYNDROME
Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA.
This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.
WHAT DOES BIOTIN DO FOR US ?. 1. Carboxyle enzymes:. - The first one, Acetyl-CoA carboxylase, starts the process for creating fatty acids. Most of us want beautiful shiny hair and strong healthy fingernails. Biotin is involved in the creation of fatty acids. One group of fatty acids called phospholipids is a necessary part of the structure of cell membranes including those which make up our hair and nails.. - The second one, Pyruvate carboxylase is critical for the process called gluconeogenesis. Gluconeogenesis is the process which creates glucose out of fats and amino acids to use for energy when the body cant get it from carbohydrates. Those low or no carb diets weve all heard about or perhaps have tried, start the process of gluconeogenesis. The fat stores in our bodies and unfortunately some of the proteins we eat are used for energy instead of the carbohydrates we would ordinarily consume.. - The third one, Methylcrotonyl-CoA carboxylase is used in the creation of energy from the ...
Biotin, or vitamin H (MW 244,31), is a small naturally occurring cofactor that is present in every living cell in very minute amounts ( usually less than 0,0001 % ). The biotin molecule normally exists bound to proteins ( such as pyruvate carboxylase ) through its valeric acid carboxylic group by an amide bond to lysine side-chain amines.. Biotin coated surfaces offer a powerful instrument to carry out one of the most useful interactions in immunochemistry that involves the specificity binding of biotin to the avidin or streptavidin. This binding shows a great constant of affinity (10 - 15 M).. The polystyrene optical features dont change, allowing the modified surface to be used as a valid tool to carry out biological tests.. This surface shows its usefulness for these applications:. ...
Acetyl-CoA Carboxylase (ACC) regulates the metabolism of fatty acids. This enzyme catalzes the formation of Malonyl CoA through the irreversible carboxylation of acetyl C
Residues 6 to 308 (E-value = 1.6e-11) place CPn0297 in the Acyl_transf_1 family which is described as Acyl transferase domain (PF00698 ...
putative acyl-CoA carboxylase alpha subunit [putative Acyl-CoA carboxylase] ATGAGCGCCGCCCTCCTAGGCCTCCGTCAGGCCCGCATACGCAAGGTGTTGATCGCCAAC CGTGGCGAAATCGCTGTTCGTGTCGCCCGGGCGTGCCGAGACGCCGGTATCGCGAGCGTG GCGGTGTACGCCGAGCCGGACCGGGACGCACTGCATGTGCGGGCCGCGGACGAGGCGTTC GCGCTGGGCGGTGACACCCCCGCGACCAGCTACCTCGACATGGCCAAGGTGCTGCAGGCC GCCAAGGACTCCGGCGCGGACGCCATCCACCCCGGTTACGGCTTCCTTTCCGAGAACGCC GACTTCGCCCAGGCCGTCCTGGACGCCCAGCTGATCTGGATCGGCCCGCCGCCGCAGGCG ATTCGCGACCTGGGTGACAAGGCCCATATCGCCCAGCGCGCCGGCGCCCCGCTGGTCGCC GGCACCCCCGACCCGGTCTCGGGCTCGGACGAGGTCGTCGCCTTCGCGGAGGAGCACGGG CTGCCGATCGCCATCAAGGCCGCCTTCGGTGGCGGTGGCCGCGGTCTGAAGGTCGCCCGC ACCCTGGAAGAAGTCCCCGAGCTGTACGACTCGGCCGTCCGCGAGGCGGTGGCCGCCTTC GGCCGCGGTGAGTGCTTCGTCGAGCGCTACCTCGACAAGCCCCGGCACGTGGAGACCCAG TGCCTGGCCGACTCCCACGGCAACGTGGTCGTCGTCTCCACCCGCGACTGCTCACTGCAG CGCCGCCACCAGAAGCTGGTCGAGGAGGCGCCCGCGCCGTTCCTCTCCGACGAGCAGGTC GCCGAGCTGTACTCCTCTTCGAAGGCCATCCTCAAGGAGGCCGGCTATGTCGGCGCCGGG ACCGTGGAGTTCCTGGTCGGCACGGACGGCACGATCTCCTTCCTGGAGGTCAACACCCGC ...
Promotes healthy glucose metabolism and nerve health; helps support healthy nails Biotin is a water-soluble B vitamin that is an essential co-factor for a number of metabolic carboxylation reactions. Biotin forms a covalent bond to the following carboxylase enzymes: pyruvate carboxylase for glucose metabolism, acetyl CoA carboxylase for fatty acid oxidation, and propionyl-CoA carboxylase and methylcrotonyl-CoA carboxylase for amino acid metabolism. A clinical study reported that high dose administration of biotin helped promote healthy glucose metabolism. A number of animal studies support this claim. Biotin may also act to promote transcription and translation of glucokinase, an enzyme found in the liver and pancreas that participates in the metabolism of glucose to form glycogen. Studies have also indicated that biotin is supportive of nervous system health and function. A clinical study revealed that biotin promotes nerve cell health. In addition, a double-blind study reported that biotin
Several catabolic pathways converge on the citric acid cycle. Most of these reactions add intermediates to the citric acid cycle, and are therefore known as anaplerotic reactions, from the Greek meaning to "fill up". These increase the amount of acetyl CoA that the cycle is able to carry, increasing the mitochondrions capability to carry out respiration if this is otherwise a limiting factor. Processes that remove intermediates from the cycle are termed "cataplerotic" reactions. In this section and in the next, the citric acid cycle intermediates are indicated in italics to distinguish them from other substrates and end-products. Pyruvate molecules produced by glycolysis are actively transported across the inner mitochondrial membrane, and into the matrix. Here they can be oxidized and combined with coenzyme A to form CO2, acetyl-CoA, and NADH, as in the normal cycle.[35]. However, it is also possible for pyruvate to be carboxylated by pyruvate carboxylase to form oxaloacetate. This latter ...
Acetyl-CoA carboxylase is an essential enzyme, as it catalyzes the first committed and regulated step in fatty-acid biosynthesis in all organisms excepting few Archaea and Eubacteria. Acetyl-CoA carboxylase from gram-negative and gram-positive bacteria is a multifunctional enzyme composed of three separate proteins. The carboxyltransferase subunit catalyzes the transfer of a carboxyl group from carboxybiotin to acetyl-CoA, forming malonyl-CoA. The crystal structure of the Escherichia coli (E. coli) carboxyltransferase component of acetyl-CoA carboxylase revealed a unique Zn-domain, presumed to mediate nucleic acid binding, that is absent in the eukaryotic enzyme. Notably, the Zn-domain, adjacent to the active site of carboxyltransferase, makes for a unique target in the development of novel antibiotics capable of highly specific binding. Utilizing an Electrophoretic Mobility Shift Assay as part of this study, we investigated the nonspecific nucleic-acid binding and substrate (malonyl-CoA and biocytin)
Sequence searching (5) revealed that 14 of the 39 calmodulin-binding proteins contain a motif whose consensus is (I/L)QXXK(K/X)GB, where X is any residue and B is a basic residue (Fig. 2B). A related sequence in myosins, IQXXXXKXXXR, has been shown previously to bind calmodulin (18). Thus, we demonstrate that the domain is found in many calmodulin-binding proteins. Presumably the other targets that lack this motif have other calmodulin-binding sequences (10).. In addition to the calmodulin-binding targets, we also identified one protein, Pyc1p, that bound Cy3-labeled streptavidin. Pyc1p encodes a pyruvate carboxylase 1 homolog that contains a highly conserved biotin attachment region (19). Thus, as predicted by its sequence, Pyc1p is biotinylated in vivo. With appropriate detection assays, we expect that proteome chips can identify many types of posttranslational modification of proteins.. To test whether proteome chips could be used to identify activities that might not be accessible by other ...
Polyclonal Antibody for studying acetyl-CoA carboxylase 1 (Ser80) phosphate/acetyl-CoA carboxylase 2 (Ser222) phosphate in the Metabolism research area.
References for Abcams Recombinant Human Acetyl Coenzyme A carboxylase alpha protein (ab79625). Please let us know if you have used this product in your…
CoA-3-methylcrontonyl carboxylase 2 deficiency (MCCC2) Test Cost INR 30000.00 Surat Pune Jaipur Lucknow Kanpur Nagpur Visakhapatnam Indore Thane Bhopal Patna Vadodara Ghaziabad Ludhiana Coimbatore Madurai Meerut Ranchi Allahabad Trivandrum Pondicherry Mysore Aligarh best offer discount price
Can biotin, one of the most common supplements used for your skin, hair and nails, mess up your labs? Yep. Its actually pretty alarming how many labs will be skewed from biotin supplementation.
... is ...the hands-down choice for coat, skin and hoof problems - Horse Journal, June 2000 issue. Biotin supplementation has been shown to be helpful in improving hoof qu...