Cardiomyopathy - Hypotonia - Lactic Acidosis Syndrome (Mitochondrial Phosphate Carrier Deficiency): Symptoms, Diagnosis and...
Cardiomyopathy - Hypotonia - Lactic Acidosis Syndrome (Mitochondrial Phosphate Carrier Deficiency): Read more about Symptoms, Diagnosis, Treatment, Complications, Causes and Prognosis.
FUNCTIONAL ANALYSIS OF THE PROMOTER OF THE MITOCHONDRIAL PHOSPHATE CARRIER HUMAN GENE | IRIS Università degli Studi della...
INTRODUCTION: The phosphate carrier (PiC) is a nuclear encoded protein that belongs to the mitochondrial carrier protein family. Its physiological role is to catalyze the transport of inorganic phosphate into the mitochondrial matrix (1). Uptake of phosphate into mitochondria is essential for the oxidative phosphorylation of ADP to ATP. Only one human gene for the PiC, that give rises to two alternatively spliced isoforms (A and B), has been detected.. The recombinant, reconstituted isoforms A and B exhibit similar substrate specificity and inhibitor sensitivity, but differ in their kinetic parameters and tissue distribution (2). We have analyzed the 5-flanking region of the human PiC gene and have identified a single transcriptional initiation site, an activation domain and an inhibition domain (3). MATERIALS AND METHODS: Materilas and methods employed are reported in ref. 3. RESULTS: Through deletion analysis of the 5 flanking regulatory region (-1213/-25 bp) and transient transfection of ...
Expression of the pstS gene of Streptomyces lividans is regulated by the carbon source and is partially independent of the PhoP...
PstS is a phosphate-binding lipoprotein that is part of the high-affinity phosphate transport system. Streptomyces lividans accumulates high amounts of the PstS protein in the supernatant of liquid cultures grown in the presence of different carbon sources, such as fructose or mannose, but not in the presence of glucose or in basal complex medium. Functionality experiments revealed that this extracellular PstS protein does not have the capacity to capture phosphate and transfer it to the cell. Regulation of the pstS promoter was studied with Northern blot experiments, and protein levels were detected by Western blot analysis. We observed that the pstS gene was expressed in cultures containing glucose or fructose, but not in complex basal medium. Northern blot analyses revealed that the pst operon (pstSCAB) was transcribed as a whole, although higher transcript levels of pstS relative to those of the other genes of the operon (pstC, pstA and pstB) were observed. Deletion of the -329/-144 fragment of the
Tandem use of X-ray crystallography and mass spectrometry to obtain ab initio the complete and exact amino acids sequence of...
TY - JOUR. T1 - Tandem use of X-ray crystallography and mass spectrometry to obtain ab initio the complete and exact amino acids sequence of HPBP, a human 38-kDa apolipoprotein. AU - Diemer, Hélène. AU - Elias, Mikael. AU - Renault, Frédérique. AU - Rochu, Daniel. AU - Contreras-Martel, Carlos. AU - Schaeffer, Christine. AU - Van Dorsselaer, Alain. AU - Chabriere, Eric. PY - 2008/6. Y1 - 2008/6. N2 - The Human Phosphate Binding Protein (HPBP) is a serendipitously discovered apolipoprotein from human plasma that binds phosphate. Amino acid sequence relates HPBP to an intriguing protein family that seems ubiquitous in eukaryotes. These proteins, named DING according to the sequence of their four conserved N-terminal residues, are systematically absent from eukaryotic genome databases. As a consequence, HPBP amino acids sequence had to be first assigned from the electronic density map. Then, an original approach combining X-ray crystallography and mass spectrometry provides the complete and a ...
Results for cd03260
ATP-binding cassette domain of the phosphate transport system. Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. PstA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). ...
A new locus in the phosphate specific transport (PST) region of Escherichia coli<...
TY - JOUR. T1 - A new locus in the phosphate specific transport (PST) region of Escherichia coli. AU - Levitz, Ruth. AU - Klar, Avihou. AU - Sar, Nehemia. AU - Yagil, Ezra. PY - 1984/10/1. Y1 - 1984/10/1. N2 - PhoS64 is a mutation in the Phosphate Specific Transport (PST) region on the E. coli chromosome which lacks the periplasmic phosphate binding protein. In contrast to other phoS mutations (which have the same phenotype) it complements the mutations in phoT and pstB. A detailed genetic map of the PST region constructed by three point transductional crosses has revealed that phoS64 is located distally from other phoS mutations. The genetic order obtained was phoS64-phoU35-pstB401-phoT-phoS-ilvC. The data indicate that phoS64 belongs to a different complementation unit in the PST region not known hitherto. We propose to name it phoV.. AB - PhoS64 is a mutation in the Phosphate Specific Transport (PST) region on the E. coli chromosome which lacks the periplasmic phosphate binding protein. In ...
EMBL: CP000667.PE286
CP000667.PE286 Location/Qualifiers FT CDS_pept 328389..329336 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Strop_0286 FT /product=phosphate binding protein FT /note=TIGRFAM: phosphate binding protein; PFAM: FT extracellular solute-binding protein, family 1 FT /db_xref=EnsemblGenomes-Gn:Strop_0286 FT /db_xref=EnsemblGenomes-Tr:ABP52771 FT /db_xref=GOA:A4X1M1 FT /db_xref=InterPro:IPR011862 FT /db_xref=InterPro:IPR024370 FT /db_xref=UniProtKB/TrEMBL:A4X1M1 FT /protein_id=ABP52771.1 FT /translation=MLSRRILAGTALAALALTGCSSNNNEDADGGEKLSGEVKVNGSST FT VAPLSEAAATFYREVQSGVNVSVGTSGTGGGFERFCKGETDISDASRPIKDSEIEACEA FT AGIQYKELIVANDALTVVVSKDNDWADCLTVDQLKAIWEPNSQITSWNQVDPSFPDEPL FT KLFGPGTDSGTFDYFTDEINGEEGASRTDYTASENDNVVVQGVAGTKGGLGYFGFTYFE FT ENADKLKALKVDGGSGCVEPSLKTAQENTYQPLSRPLFIYVSDSGVKKEQVADFVTFYI FT ERIDDIVTEAQYVPLTEEQKSTLQAEFDALKAAA gtgctttcgc ggcgcatcct cgccggcacc gcgctcgccg cgctcgcgct taccggctgc 60 agcagcaaca acaacgaaga cgccgatggt ggcgagaagc tttcgggtga agtcaaggtc 120 ...
Phosphate Sensor from Invitrogen
Phosphate Sensor from Invitrogen,Phosphate Sensor is a highly sensitive reagent for the detection of inorganic phosphate. This product is a purified form of recombinant E. coli phosphate-binding protein labeled with the fluorophore MDCC, which is sensitive to changes in its environment.How it worksBinding of inorganic phosphate by,biological,biology supply,biology supplies,biology product
Golph3 - Golgi phosphoprotein 3 - Mus musculus (Mouse) - Golph3 gene & protein
Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis (By similarity).
phoU - Phosphate-specific transport system accessory protein PhoU homolog - Aquifex aeolicus (strain VF5) - phoU gene & protein
Plays a role in the regulation of phosphate uptake. In this role, it may bind, possibly as a chaperone, to PhoR, PhoB or a PhoR-PhoB complex to promote dephosphorylation of phospho-PhoB, or inhibit formation of the PhoR-PhoB transitory complex (Probable).
Uptake of Glutamate into Synaptic Vesicles by an Inorganic Phosphate Transporter | Science
Synaptic transmission involves the regulated exocytotic release of neurotransmitter. Because most classical transmitters are synthesized in the cytoplasm, they require transport into the secretory compartment for exocytotic release, and synaptic vesicles exhibit multiple distinct transport activities (1, 2). All of these active transport processes depend on the proton electrochemical gradient (ΔμH+) across the vesicle membrane generated by the vacuolar H+-dependent adenosine triphosphatase (H+-ATPase) (3) and involve the exchange of lumenal protons for cytoplasmic transmitter. In particular, the transport of monoamines and acetylcholine (ACh) depends primarily on the chemical component (ΔpH) of ΔμH+(4, 5), whereas the transport of glutamate depends predominantly on the electrical component (ΔΨ) (6,7). Accumulation of the inhibitory transmitters γ-aminobutyric acid (GABA) and glycine relies on both ΔpH and ΔΨ (8, 9). Consistent with the observed differences in mechanism, the vesicular ...
Slc25a26 (untagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26), nuclear...
Slc25a26 (untagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26), nuclear gene encoding mitochondrial protein, (10ug), 10 µg.
Slc25a24 (untagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24 (Slc25a24), nuclear...
Slc25a24 (untagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24 (Slc25a24), nuclear gene encoding mitochondrial protein, (10ug), 10 µg.
RCSB PDB - 1PC3: Crystal structure of the extracellular phosphate ABC transport receptor (PstS-1) and immunodominant...
1PC3: Crystal structure of M tuberculosis ABC phosphate transport receptor: specificity and charge compensation dominated by ion-dipole interactions.
The role of histone acetylation in phosphate regulated expression from the PHOS gene of Saccharomyces cerevisiae | Biochemical...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
5ijh.1 | SWISS-MODEL Template Library
SWISS-MODEL Template Library (SMTL) entry for 5ijh.1. Structure of the SPX domain of the human phosphate transporter XPR1 in complex with a sulfate ion
Phosphate carrier protein, mitochondrial
The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008 ...
Novel Protein CPTP Offers Hope for Treatment of Cancer and Other Diseases
Posted on 08/07/2013 7:35:02 PM PDT by CutePuppy. The scientists discovered that the ceramide-1 phosphate transport protein (CPTP) regulates levels of biologically active lipids, which are molecules such as fatty acids that often play a role in cell signaling. They found that CPTPs main function is to transport ceramide-1-phosphate (C1P), a lipid that helps regulate cell growth, survival, migration and inflammation. Specifically, C1P increases the production of pro-inflammatory eicosanoids - powerful signaling molecules that contribute to chronic inflammation in diseases such as cancer, asthma, atherosclerosis and thrombosis - and the discovery of CPTP sheds a light on the cellular mechanisms that contribute to these diseases. We may have identified the newest target for treating cancer. Because of the important role this protein plays in a number of cellular functions, it could also have large implications for a variety of diseases like cancer that are caused by inflammation, The team was ...
Addgene: pSTC0r1
Plasmid pSTC0r1 from Dr. Alfonso Jaramillos lab contains the insert pLlacO-1+BBa_B0034+GFP and is published in Proc Natl Acad Sci U S A. 2012 Sep 18;109(38):15271-6. Epub 2012 Sep 4. This plasmid is available through Addgene.
Easy Phos
Oxytechs EASY PHOS is a one step phosphate, degreaser and sealer for bare metal protection. EASY PHOS is specifically formulated as a pre-paint treatment for steel, galvanised steel and aluminium and is easily applied by aerosol, spray gun or brush.. EASY PHOS, when dry, protects the surface from surface rust, fingerprints, etc during temporary indoor storage (usually for 6 months or more).. EASY PHOS performs a conversion of the metal surface by the deposition of a phosphate layer, which is then sealed with a purpose-formulated organic polyphosphate. Most powder coatings and solvent based paints used to coat steel and/or aluminium are compatible with EASY PHOS.. ...
September 2017 - Identification of a second aryl phosphate-binding site in protein-tyrosine phosphatase 1B
We demonstrate the application and comparative interpretations of three tree-based algorithms for the analysis of data arising from circulation cytometry: classification and regression trees (CARTs), random forests (RFs), and logic regression (LR). on the outcome of circulation cytometry at a single time point. We denote these with the vector x = (= 1,, matrix X is used to denote the full data design matrix with (for individual individuals in our study. In our establishing, each of the columns of X, denoted as an indication for being above or below the sample median value for that variable. Measuring and screening the association between a single categorical predictor and a binary end result is typically achieved through a contingency table analysis. The odds ratio, defined as the odds of disease given exposure, divided by the odds of disease given no exposure, is usually a well-described measure of association in the this context and is given formally by potential predictor variables. This ...
APS CAI Install PITA on 06 !!! | IW STi Forum
I know its been said already, but I cant emphasize enough what a pain it is to install the APS CAI on an 06.
I undertook this task last night and it took...
Adelaide Research & Scholarship: Proton-coupled high-affinity phosphate transport revealed from heterologous characterization...
High-affinity phosphate transporters mediate uptake of inorganic phosphate (Pi) from soil solution under low Pi conditions. The electrophysiological properties of any plant high-affinity Pi transporter have not been described yet. Here, we report the detailed characterization of electrophysiological properties of the barley Pi transporter, HvPHT1;1 in Xenopus laevis oocytes. A very low Km value (1.9 µm) for phosphate transport was observed in HvPHT1;1, which falls within the concentration range observed for barley roots. Inward currents at negative membrane potentials were identified as nH+:Pi- (n , 1) co-transport based on simultaneous Pi radiotracer uptake, oocyte voltage clamping and pH dependence. HvPHT1;1 showed preferential selectivity for Pi and arsenate, but no transport of the other oxyanions SO42− and NO3-. In addition, HvPHT1;1 locates to the plasma membrane when expressed in onion (Allium cepa L.) epidermal cells, and is highly expressed in root segments with dense hairs. The ...
The low-affinity phosphate transporter PitA is dispensable for in vitro growth of Mycobacterium smegmatis | BMC Microbiology |...
Growth experiments showed no difference between wild-type and pitA mutant in LBT medium or ST medium, either under phosphate-replete conditions (100 μM to 100 mM phosphate) or phosphate-limited conditions (10 μM or 50 μM phosphate) (not shown). This characteristic of the pitA mutant is markedly different from the previously created M. smegmatis mutants in the high-affinity phosphate transporters, which were unable to grow in minimal medium at 10 mM phosphate or below [13]. As mentioned above, Pit systems of Gram-negative bacteria transport a metal-phosphate complex. While no information regarding their substrate is available for Pit systems of Gram-positives, a mutant of Bacillus subtilis carrying an uncharacterized mutation in phosphate uptake was also defective in uptake of metal ions [21], suggesting an interrelation between uptake of phosphate and metals. The biological role of Pit in a bacterium with a plethora of high-affinity phosphate transporters may therefore be in uptake of ...
Engagement of Renin-Angiotensin System in Prostate Cancer | Bentham Science
Title: Engagement of Renin-Angiotensin System in Prostate Cancer. VOLUME: 11 ISSUE: 4. Author(s):H. Uemura, K. Hoshino and Y. Kubota. Affiliation:3-9, Fukuura, Kanazawa-ku,Yokohama, 236-0004, Japan.. Keywords:Angiotensin II, angiotensin II receptor blocker, castration resistant prostate cancer, local RAS, prostate cancer, renin-angiotensin system, Dihydrotestosterone, Estradiol, Guanosine phosphate binding protein coupled receptor, Interleukin, Monocyte chemoattractant protein-1, Signal transducer and activator of transcription 3, Tumor necrosis factor, Vascular endothelial factor, Peroxisome proliferator-activated receptor. Abstract: Angiotensin II (Ang-II) plays a role not only as a vasoconstrictor in controlling blood pressure and electrolyte and fluid homeostasis, but also as a mitogenic factor through the Ang-II type-1 (AT1) receptor in cardiovascular cells. Since a low prevalence of cancer in hypertensive patients receiving angiotensin converting enzyme inhibitors has been reported, the ...
Probable phosphate transport system permease protein elisa and antibody
Shop Probable phosphate transport system permease protein ELISA Kit, Recombinant Protein and Probable phosphate transport system permease protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
ATP-dependent protein kinase-catalyzed phosphorylation of a seryl residue in HPr, a phosphate carrier protein of the...
HPr, a phosphate carrier protein of the streptococcal phosphotransferase system, is phosphorylated at the N-1 position of a single histidyl residue in a reaction requiring phosphoenolpyruvate (P-ePrv), Mg2+, and enzyme I (P-ePrv-HPr phosphotransferase, EC2.7.3.9). We demonstrate that in addition to this reaction, a seryl residue within HPr can be phosphorylated in an ATP-dependent process. This reaction is catalyzed by a protein kinase with an approximate Mr of 20,000. In whole cells the kinase activity is stimulated by glucose, whereas in crude extracts the activity is stimulated by glycolytic intermediates such as glucose 6-phosphate, fructose 1,6-diphosphate, and 2-phosphoglycerate. P-(Ser)-HPr cannot transfer its phosphate group via enzyme II to a sugar as does the P-(His)-HPr. Instead, a phosphatase (Mr = 70,000) was found to hydrolyze the phosphate group of P-(Ser)-HPr. The phosphatase reaction is strongly inhibited by the addition of P-ePrv and enzyme I. Protein kinase-catalyzed ...
Patent US6696087 - Phosphate-binding polymer preparation technical field - Google Patents
A tablet containing a phosphate-binding polymer, which has an average particle size of 400 μm or less, contains particles of 500 μm or less in particle size at a ratio of 90% or more and has a moisture content of 1 to 14%, together with crystalline cellulose and/or low substituted hydroxypropylcellulose and contains the active component at a high ratio, is excellent in the ability to bind to phosphate, and quickly disintegrates in an acidic to a neutral region.
PSTC Team | Critical Path Institute
C-Paths Predictive Safety Testing Consortium (PSTC) serves as a neutral third party in the independent assessment and validation of drug safety tests.
SA1219 - AureoWiki
Phosphorus MetabolismPhosphorus Metabolism - no subcategoryHigh affinity phosphate transporter and control of PHO regulon Phosphate transport system permease protein PstA (TC 3.A.1.7.1) ...
Cell Salt, Calc Phos | Digital Naturopath
CALCAREA PHOS or calcium phosphate is abundant in all tissues. Because it is a major constituent of bones, Calc Phos is also a chief builder of bone tissue, and the principal salt deficient in diseases of bone structure. It strengthens bones, and helps build new blood cells. A deficiency results in anemia, emaciation, slow growth, poor digestion and general weakness. Calc Phos is the cell salt for being generally run-down and helps bring about restoration after acute diseases and infections. Calc Phos and Mag Phos are the two remedies for cramps and spasms.. table th, table td { vertical-align: top; } .score { max-width: 100px; } @media screen and (max-width: 480px) { .score { max-width: 50px; } } ...
Decreased insulin-stimulated ATP synthesis and phosphate transport in muscle of insulin-resistant offspring of type 2 diabetic...
These data demonstrate that insulin-stimulated rates of mitochondrial ATP synthesis are reduced in IR offspring of parents with type 2 diabetes. Furthermore, these IR offspring also have impaired insulin-stimulated phosphate transport in muscle, which may contribute to their defects in insulin-stimu …
Specialty Liquids - Eco-Safe Pool Enzyme & Phos Out Maintenance
HASA ECO-SAFE POOL ENZYME & PHOS OUT MAINTENANCE is concentrated and robust; effective in removing 80 - 90% of organic matter; reduces sanitizer use; and is cost effective even for service usages.. HASA ECO-SAFE POOL ENZYME & PHOS OUT MAINTENANCE reduces phosphates and scum lines. It also improves water clarity and safe to swim immediately after use.. Hasa Eco-Safe Pool Enzyme & Phos Out Maintenance: 1 quart removes 750 ppb phosphates per 10,000 gallons of pool water. Non-Lanthanum based phosphate remover. ...
Biochemical characterization of novel appendages containing DING/PstS family proteins - Project topics materials
SDS-PAGE followed by Coomassie staining (Figure 3.6A) clearly shows that, upon induction in TSB media, there was a slight increase in PstS protein expression. As evident from the gel, expression was seen in both supernatant as well as lysate. This was further confirmed using immunoblot analysis. Figure 3.6B shows the immunoblot of PstS overexpression in PA14 wild-type. As seen in the blot, it is clear that the induction is seen only in overexpression strains and not in the wild-type, which indicates that the expression is plasmid-driven. The removal of signal sequence might have resulted in a slightly lower band in the secreted fraction as compared to that of the lysate.. Expression and Purification of Pseudomonas aeruginosa. UCBPP PA14 DING and PstS proteins. Previous attempts in our laboratory to purify recombinant PA14 DING from E. coli resulted in several issues, including poor solubility due to protein misfolding, and low yields. We therefore decided to carry out the expression in its ...
4j05 » Phosphate transporter - Orientations of Proteins in Membranes (OPM) database
C - Tilt: 14° - Segments: 1( 38- 59), 2( 72- 95), 3( 106- 123), 4( 131- 151), 5( 170- 195), 6( 208- 227), 7( 310- 339), 8( 357- 380), 9( 385- 405), 10( 413- 438), 11( 451- 470), 12( 480- 498 ...
Dr. Reckeweg Ammonium Phos Dilution 50M CH: Buy bottle of 11 ml Dilution at best price in India | 1mg
Order Dr. Reckeweg Ammonium Phos Dilution 50M CH:bottle of 11 ml Dilution online at best price in India. Know Dr. Reckeweg Ammonium Phos Dilution 50M CH price, specifications, benefits and other information only on 1mg.com
Buy Pita Work Anarkali Sherwani | Online Pita Work Anarkali Sherwani | Designer Pita Work Anarkali Sherwani
Shop Designer Pita Work Anarkali Sherwani at Cbazaar. We provide heavy discounts on Pita Work Anarkali Sherwani products with very attractive prices. Buy Now!
AID 894901 - Open TG-GATES: Regimen: Single; Time: 3 hr; Dose: High; Route: Gavage | Dataset: Biochemistry; Assay: PHOS ...
BioAssay record AID 894901 submitted by ChEMBL: Open TG-GATES: Regimen: Single; Time: 3 hr; Dose: High; Route: Gavage | Dataset: Biochemistry; Assay: PHOS (Phosphate); Study_ID: 533/13.
AID 867698 - Open TG-GATES: Regimen: Single; Time: 24 hr; Dose: Low; Route: Gavage | Dataset: Biochemistry; Assay: PHOS ...
BioAssay record AID 867698 submitted by ChEMBL: Open TG-GATES: Regimen: Single; Time: 24 hr; Dose: Low; Route: Gavage | Dataset: Biochemistry; Assay: PHOS (Phosphate); Study_ID: 279/8.
Test showed alk phos 141, alt 57 and ast 51. Are these levels high?
Question - Test showed alk phos 141, alt 57 and ast 51. Are these levels high?. Ask a Doctor about diagnosis, treatment and medication for Fatty liver, Ask a Radiologist
Healthy Pita Bread Sandwiches | LIVESTRONG.COM
Portable, tasty and low in fat, pita bread can inspire unlimited ideas for healthy sandwiches. One large whole-wheat pita has 170 calories, 2g of fat, 35g...
CaMKIIα phos Thr286 | ALZFORUM
If you know of any papers that use this antibody, please contact us at antibodies [at] alzforum [dot] org for consideration in the References section.. ...
Akt1 phos Thr308 | ALZFORUM
If you know of any papers that use this antibody, please contact us at antibodies [at] alzforum [dot] org for consideration in the References section.. ...
OsPTF1, a Novel Transcription Factor Involved in Tolerance to Phosphate Starvation in Rice | Plant Physiology
In this study, we cloned and characterized a bHLH transcription factor, OsPTF1, which is responsible for tolerance to Pi starvation in rice. Overexpression of OsPTF1 can enhance tolerance to Pi deficiency. It was reported that PHO4, which was also a bHLH protein, acts as a key regulator of PHO regulon in yeast. In Pi starvation conditions, PHO4 combines with its partner, PHO2, and induces the expression of PHO5 and PHO84, the Pi starvation-induced acid phosphatase and the high-affinity Pi transporter (Johnston and Carlson, 1992; Oshima, 1997). Microarray analysis was performed to test whether OsPTF1 regulates downstream genes as PHO4. Unexpectedly, no high-affinity phosphate transporter genes or acid phosphatase genes were found to be controlled by OsPTF1 (see supplemental data). In addition, OsPTF1 is located in the nucleus in both high- and low-Pi conditions, which is different from PHO4, which is imported into or exported out of the nucleus under Pi-sufficient or starvation conditions (Kaman ...
Homepage - Genetics Society of America
Image: Arpan Roy. Hydrangea macrophylla is a flowering plant that changes color of the bloom in response to soil pH. Ferdoush et al. demonstrate a metaphorical mimicry of such a phenomenon at the level of gene activation, where the activator in budding yeast functionally alternates between coactivators, SAGA and NuA4, in response to inorganic phosphate in the growth medium to promote transcription of a high-affinity inorganic phosphate transporter gene, PHO84. Image courtesy of Arpan Roy. See Ferdoush et al. GENETICS 208: 191-205.. ...
What does G3PT mean? - Definition of G3PT - G3PT stands for Glycerol 3 Phosphate Transporters. By AcronymsAndSlang.com
Hop on to get the meaning of G3PT acronym / slang / Abbreviation. The Undefined Acronym / Slang G3PT means... AcronymsAndSlang. The G3PT acronym/abbreviation definition. The G3PT meaning is Glycerol 3 Phosphate Transporters. The definition of G3PT by AcronymAndSlang.com
Renagel Missed Dose - Renagel Tablete Cena
Renvela vs renagel, renagel 800 mg prix maroc, renagel 800 mg preisvergleich, renagel max dose, renagel 800 preis, renagel 800 mg precio colombia, renagel coupon card
Kaufen Renagel online. Sicher einkaufen Renagel in der Internet-Apotheke. Qualitätsgarantie.
Kaufen Renagel in der Internet-Apotheke. Möchten Sie eine Ermäßigung auf Renagel bekommen Kaufe und spare dein Geld. Sicher und komfortabel. Schnelle Lieferung.
Control of phosphate transport in liver | Biochemical Society Transactions
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Chicken Pita
1. Spread sauce on the pita 2. Put chicken on half of pita 3. Layer veggies and feta on top of chicken 4. Fold in half and grill the pita ...
Chicken Pita Sandwiches with Harissa Sauce Recipe | EatingWell
We serve these lemon-oregano chicken pitas with lots of fixings tucked in, but you could ditch the pita and serve it all over cooked bulgur, cauliflower rice or a bed of greens.
Pitas & Sticks on the App Store
Read reviews, compare customer ratings, see screenshots, and learn more about Pitas & Sticks. Download Pitas & Sticks and enjoy it on your iPhone, iPad, and iPod touch.
Frankopanova pita / Frangipane pie
Ako mene pitate, od ove pite ljepše nema! Ali prosudite sami nakon što je probate!
Čini se malo zahtjevnom, ali kad vam prvi zalogaj dotakne nepce, sve zaboravite i pamtite samo - užitak!
Ova pita spada u one poznate francuske - frangipane, a koje su nazvane po našim slavnim i poznatim vojskovođama iz obitelji Frankopan! Uživajte!
How Many Calories in Bread, pita, whole-wheat
See how many calories are in Bread, pita, whole-wheat along with its full nutrition facts including carbs, fat, protein and more.
Pita Pockets - Ajinomoto Cambrooke Online Store
Description: Each package contains 6 low protein pita pockets. Pockets are 6 rounds. Two servings per pocket.
Preparation: Thaw to room temperature or microwave on defrost 30-60 seconds.
Serving Suggestions: Cut across into two halves. Open pocket . . .
Natures Table DTSP | Home-made Hummus & Pita | Order Online
Order Home-made Hummus & Pita for takeout, delivery, and dine in from Natures Table DTSP. Serving the best Breakfast & Lunch in St Petersburg, FL.
Pita the Wonder Dog | Outside Bozeman
Twelve years ago on a backcountry adventure my two sisters, me, and our mama crossed paths with Pita the Wonder Dawg, or PWD for short.
Kali phos
Press base twice to release two pillules into cap. Unscrew cap and without touching pillules tip them into mouth. Pillules to be sucked or chewed and taken between meals ...
in busy shops, 3yr old being a PITA! | Page 2 | Bub Hub
i dont have anyone to help me out, ive done my xmas shopping online. I had to head to the post office to express post something this morning. Had to take the kids with me. It was busy and dd was misbehaving. My question is what do you do - page 2
MAPK Signalweg | www.antikoerper-online.de
Phosphorylierung ist das reversible Anhängen einer Phosphatgruppe an einen spezifischen Aminosäurerest eines Moleküls. Auf funktionaler Ebene dient die Phos...