An epitope of elongation factor Tu (EF-Tu), which is found in organisms in both the bacterial and archaeal domains, was recently defined by mAb 900. To localize the conserved epitope within the EF-Tu molecule and to determine its sequence, SPOTScan analysis of synthetic peptides, Western blot analysis of purified EF-Tu domains and site-directed mutagenesis studies were used. Analysis of mAb 900 binding to overlapping 15-mer peptides encompassing the complete sequence of EF-Tu of Escherichia coli was inconclusive, suggesting three distinct regions may be epitopes. Western blot analysis of EF-Tu domains 1-3 of Thermus thermophilus suggested that the epitope was located at the N terminus. This was confirmed by site-directed mutagenesis of EF-Tu domain 1 of Mycoplasma hominis. By C-terminal truncation of the N-terminal 15-mer peptide the epitope was mapped to EF-Tu residues 1-6. Replacement of each of the residues in the epitope peptide demonstrated that only positions 5 and 6 were indispensable for
Electron paramagnetic resonance spectroscopy has been used to obtain information on the structure and stability of the products of GTP cleavage at the active site of elongation factor Tu (EF-Tu) from Bacillus stearothermophilus. Using stereospecifically labelled (Sp)-(Rp)-[beta-17O]GTP (prepared by modification of a previously published procedure which is now also suitable for guanine nucleotides), it was found that only one of the two possible diastereomers (Sp) led to detectable line-broadening of the EPR spectrum of Mn2+ at the active site of EF-Tu (linewidth 1.5 mT), whereas the Rp isomer caused the same linewidth as unlabelled nucleotide (1.3 mT). From our earlier work and from a demonstration that the lifetime of the state giving the broadened spectrum is too long to be assigned to the EF-Tu.GDP.Mn complex [the rate constant for decay as measured by displacement of GDP by the fluorescent 2(3)-O-(N-methylanthraniloyl)-GDP is 6.2 x 10(-3) s-1 at 25 degrees C and pH 6.8], we conclude that ...
1KTV: A New Crystal Form of Thermus thermophilus Elongation Factor G Indicates Crystallographic Limitations Imposed on Molecular Flexibility
apg:APA12_09310 K02358 elongation factor Tu , (GenBank) translation elongation factor Tu (EF-TU) (A) MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKKGGAEFKAYDQIDAAPEERARG ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDVPIIKGSALVTLE DGDPEIGENRVRDLMDAVDSYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVIN VGDEIEIVGLKPTTKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNCA MEVELIAPIAMDEGLRFAIREGGRTVGAGVVSSIIE ...
bla:BLA_1148 K02358 elongation factor Tu , (GenBank) tuf; translation elongation factor Tu (A) MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHDEYPDLNPEYDFNQIDAAPEEQQ RGITINIAHIEYQTAKRHYAHVDCPGHADFVKNMITGAAQMDGAILVVAATDGPMAQTRE HVLLAPQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDENGFDRDCPVVHTSAYGAL HDDAPDHDKWVATIKELMDDVDEYIPTPVHDLDKPFLMPIEDVFTISGRGTVVTGRVERG KLPINTNVEIVGIRPTQTTTFTSIETFHKQMDECEAGDNTGLLLRGINRTDVERGQVVAA PGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRTTDVTGVITLPEGVEMVQPGD HATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA ...
Elongation factor thermal unstable Tu (EF-Tu) is a G protein that catalyzes the binding of aminoacyl-tRNA to the A-site of the ribosome inside living cells. Structural and biochemical studies have described the complex interactions needed to effect canonical function. However, EF-Tu has evolved the capacity to execute diverse functions on the extracellular surface of both eukaryote and prokaryote cells. EF-Tu can traffic to, and is retained on, cell surfaces where can interact with membrane receptors and with extracellular matrix on the surface of plant and animal cells. Our structural studies indicate that short linear motifs (SLiMs) in surface exposed, non-conserved regions of the molecule may play a key role in the moonlighting functions ascribed to this ancient, highly abundant protein. Here we explore the diverse moonlighting functions relating to pathogenesis of EF-Tu in bacteria and examine putative SLiMs on surface-exposed regions of the molecule.
tuf2; recname: full=elongation factor tu 2; short=ef-tu 2; recname: full=elongation factor tu 2; short=ef-tu 2; K02358 elongation factor ...
Plants are sessile organisms surrounded by a wide range of microorganisms, including plant pathogens. However, infection is established between a limited combination of plants and pathogens because plants can detect the presence of many potential pathogens through common pathogen-associated molecular patterns (PAMPs) or microbe-associated molecular patterns and subsequently mount a defense response called PAMP-triggered immunity (PTI) (He et al., 2007; Schwessinger and Zipfel, 2008). PAMPs include lipopolysaccharides, flagellin, and translation elongation factor Tu; all of these are released from bacterial pathogens (Nürnberger et al., 2004; Boller and Felix, 2009). Calcium-dependent cell wall transglutaminase and lipid-transfer proteins (elicitins) were identified as PAMPs from oomycetes (Nürnberger et al., 2004; Boller and Felix, 2009). Fungal cell wall components, such as β-glucan, ergosterol, and chitin, are also recognized as PAMPs (Nürnberger et al., 2004; Boller and Felix, 2009). In ...
Addresses: Bilgin N, Univ Uppsala, Ctr Biomed, Dept Biochem, Box 576, S-75123 Uppsala, Sweden. Uppsala Univ, Ctr Biomed, Dept Biol Mol, S-75124 Uppsala, Sweden. Inst Biol Struct, F-38027 Grenoble 1, France. DESY, European Mol Biol Lab, D-22603 Hamburg, GeAvailable from: 2008-10-17 Created: 2008-10-17 Last updated: 2011-01-14 ...
1ETU: Structural details of the binding of guanosine diphosphate to elongation factor Tu from E. coli as studied by X-ray crystallography.
2017 The Author(s). Many bacterial moonlighting proteins were originally described in medically, agriculturally, and commercially important members of the low G + C Firmicutes. We show Elongation factor Tu (Ef-Tu) moonlights on the surface of the human pathogens Staphylococcus aureus (SaEf-Tu) and Mycoplasma pneumoniae (MpnEf-Tu), and the porcine pathogen Mycoplasma hyopneumoniae (MhpEf-Tu). Ef-Tu is also a target of multiple processing events on the cell surface and these were characterised using an N-terminomics pipeline. Recombinant MpnEf-Tu bound strongly to a diverse range of host molecules, and when bound to plasminogen, was able to convert plasminogen to plasmin in the presence of plasminogen activators. Fragments of Ef-Tu retain binding capabilities to host proteins. Bioinformatics and structural modelling studies indicate that the accumulation of positively charged amino acids in short linear motifs (SLiMs), and protein processing promote multifunctional behaviour. Codon bias engendered ...
Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [PUBMED:11297922, PUBMED:11290319]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to ...
Complete information for EFTUD1P1 gene (Pseudogene), Elongation Factor Tu GTP Binding Domain Containing 1 Pseudogene 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
CON.CA · A Canadian electronic journal. · Published when we get around it · ISSN 1482-0471 · https://con.ca/ · Hosted by theorem.ca · Email con AT con DOT ca · we almost never respond · if we ever acquire a purpose, youll be the first to know · Read our Privacy Policy · Powered by scraps of time and espresso beans. · Page rendered in 0.1270 seconds on Mon Dec 18 17:32:42 2017 EST. ...
Greenora Holidays Brand Identity designed by Ensar TUĞ. Connect with them on Dribbble; the global community for designers and creative professionals.
Classificatiecodes TU Delft Library augustus 2012 Classification codes TU Delft Library August 2012 AB-AP - Naslagwerken algemeen - Reference sources general Adresboeken algemeen AB Address books general
In urdir fur Boblocel cuansilong tu bi iffictovi, e cuansilur mast bi cumplitily priperid tu wurk on thi monostry uf hilpong uthirs. Biyund thi wurldly chellingis, e Chrostoen cuansilur elsu fecis hamenostoc thirepiatoc felsi voiws uf sicaler thirepy. Chrostoen cuansilurs meonteon e fucel puont on gaodong piupli tu lovong e lofi thet os fall uf sporotael rochniss end metaroty. Yit, sicaler thirepost fucasis un silf-gretofocetoun end silf-ectaelozetoun. As Chrostoen monostry hilpirs, yua mast bi lovong by thi trath end iximplofy e Chrost-cintirid lofi. Crebb (1977) divilupid e cuansilong mudil thet tiechis as huw tu divilup ondovodaelozid lofi meps thet woll gaodi piupli tu sporotael gruwth, metaroty, end e lung-lovid Chrost-cintirid lofi. It os issintoel es Chrostoen cuansilurs wi eri ebli tu brong piupli tu andirstend thet thi ilacodetoun tu thior prublims Gud hes thi enswir prierrengid scroptarelly. Farthirmuri, inloghtin thi cloint thet thior onclasovi sicaroty os on Chrost Jisas thet uar ...
Hielth onfurmetoun hes biin ixprissid es thi "fuandetoun" fur bittir hielth verouasly. Huwivir, thi hielth onfurmetoun foild os tuu cumplix. Thi dospirsid hielthceri dete, whoch os thi meon prublim, hevi ettrectid thi ettintoun uf meny risierchirs. Farthirmuri, dai tu thi veroid netari uf hielthceri dete, ot hes bicumi mach cumplocetid tesk tu ixemoni end enelyzi thi hielthceri riletid dete. Hinci, thiri os e niid fur rubast, ontillogint end suphostocetid mithuds tu meki thi lergi emuant uf dete andirstendebli eatumetocelly. Addotounelly, midocel scoinci os e gruwong pruciss, whoch os biong apdetid tomi tu tomi. Thirifuri, ixostong hielth ceri dete niid tu bi enelyzid tu ubteon midocel pethweys ur trietmint mithuds tu andirstend thim end pussobly ompruvi thim tu en ixtint ...
1. yang kes mula2 tu, yang buat aku mencebik lepas baca pe yg pekerja tu pegang adalah RM8. RM8?????Majikan, ko tak tau ke kat mana2 pun harga tu boleh dapat la utk car wash.. harga standard..buat la kajian dulu kalo nak kata promosi pun ....dah la kejam, sengal tahap cipanzi plak tu..lebih baik ko pasang satu banner depan kedai kau tu je dari ko suruh pekerja ko tu terpacak..bukan mahal sangat pun..dari ko bayar org tu utk terpacak je baik die keje utk mencuci kereta tu ...
Ērču encefalītu izraisa vīruss, un, lai gan nav pieejama specifiska terapija pret vīrusa izraisīto ērču encefalītu, ir pieejama vakcīna.1,6 Primārās vakcinācijas kurss sastāv no trīs devām. Vakcinācija pret ērču encefalītu ir piemērota arī bērniem no 1 gada vecuma. Pirmās divas devas vajadzētu ievadīt ziemā un agri pavasarī - pirms ērču sezonas sākuma - un trešo devu nākamajā ziemā. 7,8. Ir pieejama arī paātrinātā vakcinācijas shēma, ja ir nepieciešamība iegūt aizsardzību pret ērču encefalītu ātrāk, piemēram, gatavojoties brīvdienām. Sazinieties ar savu ārstu, lai uzzinātu vairāk. 7,8. Vakcīna ir ieteicama arī cilvēkiem, kuri regulāri pavada laiku pie dabas vai kuri dodas vasaras atvaļinājumos uz Baltijas jūras arhipelāgu, piekrasti vai Ālandu salām.2 Visaugstākais risks inficēties ar ērču encefalītu ir ceļotājiem Centrāleiropas austrumos, Baltijas valstīs un Krievijā.1 Ja ir plānots doties ceļojumā uz apvidu, kur, ...
Saya tak kira, saya tetap salahkan pemeriksa kertas, mesti dia gaduh dengan bini dia.. Saya pun buatlah semak semula, bayar rm50 kalau tak silap.. dalam 2/3minggu lepas tu, lecturer panggil pegi bilik dia.. Dia cakap, " Keputusan semak semula awak dah keluar ni..ish.. saya nak cakap pun salah, tak cakap pun salah.. Sape suruh awak rajin-rajin pegi cek balik.. Pointer awak dari 3.77 dah turun jadi 3.5, awak tau tak!! Ni lah orang panggil tamak! Saya kesal benar dengan awak".. Dengan muka bengis dia cakap.. Saya ni dah lah pantang kena herdik.. Terus nangis depan lecturer tu.. Mind u, lecturer tu lelaki ok.. saya tak segan silu dah nangis teresak-esak depan dia.. Masa tu dia tak bagi lagi slip periksa tu kat saya.. "Saya pun tak tau la nak cakap apa dengan student yang tak reti-reti bahasa ni.. Dulu saya dah cakap, jangan semak! Jangan semak! Ni pointer dah turun.. awak nak amek course apa nanti? 3.5 je.. ish! Nah! Amek ni! Tengok sendiri!" Time tu saya masuk bilik lecturer tu dengan my bestfren, ...
Team:TU_Delft/frame_check}} __NOTOC__ {{Team:TU_Delft/frame_check}} ,html>,center>,img src="http://2010.igem.org/wiki/images/0/00/TU_Delft_project_navigation.jpg" usemap="#projectnavigation" border="0" />,/center>,map id="projectnavigation" name="projectnavigation">,area shape="rect" alt="Characterization" title="" coords="309,3,591,45" href="http://2010.igem.org/Team:TU_Delft#page=Project/rbs-characterization/characterization" target="" />,area shape="rect" alt="Results" title="" coords="609,3,891,44" href="http://2010.igem.org/Team:TU_Delft#page=Project/rbs-characterization/results" target="" />,area shape="rect" alt="Parts" title="" coords="9,3,290,44" href="http://2010.igem.org/Team:TU_Delft#page=Project/rbs-characterization/parts" target="" />,/map>,/html> ==RBS measurement parts== ===Experimental setup=== The following RBS sequences from the [http://partsregistry.org/Ribosome_Binding_Sites/Prokaryotic/Constitutive/Anderson Anderson RBS family] were used: ...
Element skrótu HTML (abbr) reprezentuje skrót lub akronim; opcjonalny atrybut title może stanowić rozwinięcie lub opis skrótu.
NIEUWSBRIEF IS December 2004 Nummer 8 In dit nummer o.a.: Collaboration TU/e and Queensland University of Technology: BPMcenter.org Collaboration TU/e / QUT 1 Nieuwe medewerkers 2 The BPM Center is a collaborative
Kaman kuol, aalso nuo as fresh kuol ar simpli az kuol, a vairal infekshos diziiz a di opa resprichri chrak we praimerili afek di nuoz.[1] Di chruot, sainos, ah vais bax kiah aalso afek.[2] Sain ah simtom kiah bigin les dah tuu die afta expuoja.[2] Deh ingkluud kaafin, suo chuot, ronin nuoz, sniizin, ediek, ah fiiva.[3][4] Piipl yuujali rikova ina sebm tu ten die.[3] Som simtam kiah laas op tu chrii wiik.[5] Demde wid adaels elt prablem maita hokiejanali divelop nyuumuonia.[3] Wel uoba 200 vairos schrien implikiet ina di kaaz a di kaman kuol; di rainovairosdem a di muos kaman.[6] Deh pred chuu di ier juurin kluos kantak wid infektid piipl ah indirekli chuu kantak wid abjek ina di invairament fala bai chansfor tu di mout ar nuoz.[3] Rix fakta ingkluud wen pitni gaa diekier, smadi naa sliip gud, ah saikalajikal schres.[2] Simtam muosli juu tu di badi uona imyuun rispans tu di infekshan reda dah tu tishu dischrokshan bai di vairos dehself.[7] Piipl wid influenza noftaim shuo simila simtom az piipl ...
NOTOC__ {{Team:TU_Delft/frame_check}} ,html>,center>,img src="http://2010.igem.org/wiki/images/0/00/TU_Delft_project_navigation.jpg" usemap="#projectnavigation" border="0" />,/center>,map id="projectnavigation" name="projectnavigation">,area shape="rect" alt="Characterization" title="" coords="309,3,591,45" href="http://2010.igem.org/Team:TU_Delft#page=Project/rbs-characterization/characterization" target="" />,area shape="rect" alt="Results" title="" coords="609,3,891,44" href="http://2010.igem.org/Team:TU_Delft#page=Project/rbs-characterization/results" target="" />,area shape="rect" alt="Parts" title="" coords="9,3,290,44" href="http://2010.igem.org/Team:TU_Delft#page=Project/rbs-characterization/parts" target="" />,/map>,/html> ==Characterization== ,i>By varying only the RBS sequence in a protein generator construct the dependence of the expression level of the encoded protein on the RBS sequence could be determined by simple fluorescence and biomass curve analysis. The methods are further ...
Which factors shape macrozoobenthic communities in tufa springs Results from Austrian meteogene travertine-depositing sites. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Browse detailed company profiles for search term Shabbir Tu Dekhay Ga Contact No Shabbir, including contact info and customer ratings.
Gentaur molecular products has all kinds of products like :search , Consort \ PH_EC METER BIO-ELECTRONIC KIT UK PLUG \ C3050TU for more molecular products just contact us
24 Finał Wielkiej Orkiestry Świątecznej Pomocy już 10 stycznia. Przygotowania do dwóch dni finału w Ząbkowicach Śląskich (sportowej soboty i niedzielnego finału) trwają w najlepsze. Pojawiły się także orkiestrowe aukcje ząbkowickiego sztabu na  allegro. Można tam licytować prawdziwe perełki:  płytę BRACIA: "Zmienić zdarzeń bieg" z
I malas nak nak cerita hal hal lain. Sebab semua nya komen sama jugak dengan b2b / ex b2b. Tempat ni best dan sangat recommended! Siap 4 jam sebelum berkursus Kak Ana SMS bagitau jangan lupa hari tu kita ada kursus kahwin. Dan kalau terlambat 5-10 minit pun masih dibenarkan masuk. Tapi jangan la pulak lambat sejam. Tu nanti kena repeat modul tu minggu yang akan datang. Tak ke rugi tu. Then sijil siap hari Rabu minggu seterusnya. Sijil dari JAKIM ...
Un nuevo estudio ha revelado que las células cancerosas del pecho reclutan fibroblastos tuétano-derivados hueso para aumentar su incremento
Penové tužidlo Wellaflex pre objem jemných vlasov - ultra silné spevnenie. Dodáva vlasom viditeľný objem. Zloženie pre objem vlasov obklopuje pramienky vlasov a vypĺňa redšie partie vašich vlasov. Vlasy nezlepuje. Spoľahlivé spevnenie pre flexibilný účes až na 24 hodín. Vlasy nevysušuje. Pomáha posk
January 2009 February 2009 March 2009 Su Mo Tu We Th Fr Sa Su Mo Tu We Th Fr Sa Su Mo Tu We Th Fr Sa 1 2 3 1 2 3 4 5 6 7 1 2 3 4 5 6 7 4 5 6 7 8 9 10 8 9 10 11 12 13 14 8 9 10 11 12 13 14 11 12 13 14 15 16 17 15 16 17 18 19 20 21 15 16 17 18 19 20 21 18 19 20 21 22 23 24 22 23 24 25 26 27 28 22 23 24 25 26 27 28 25 26 27 28 29 30 31 29 30 31 ...
Tu zbiram izraze, ki se ne pojavljajo v biokemijskem terminološkem slovarju, pa sem nanje naletel pri pedagoškem ali raziskovalnem delu. Ti prevodi niso recenzirani in so bolj predlogi za prevode, v skrajni sili in dvomu pa boljše kot nič :) Če česa ne znate prevesti ali pravilno zapisati, najprej preverite, ali je izraz vključen v Angleško-slovenski slovar izbranih izrazov iz biokemije in molekularne biologije (PDF). Če ni, poglejte še v Slovenski medicinski slovar, Mikrobiološki slovar Slovenskega mikrobiološkega društva in v druge recenzirane slovarje. Na koncu pa je tu šele tale slovar in Sinteznobiološki terminološki slovar. Kjer se mi je zdelo pomembno, sem dopisal, kje določen izraz uporabljajo v obliki, ki je predstavljena tu. Pri tem pomeni: BF Biotehniška fakulteta UL, FFA Fakulteta za farmacijo UL, FKKT Fakulteta za kemijo in kemijsko tehnologijo UL, FTS Farmacevtski terminološki slovar, IJS Institut Jožef Stefan, KI Kemijski inštitut, SMS Slovenski medicinski ...
Sveiki! Man ir 16 gadi, bet augumā es esmu tikai 1,7m, ja ikdienā nenodarbotos ar basketbolu, tad tā nebūtu tik liela problēma, bet ja man komandā visi ir 185++, tad.. :D es gribētu uzzināt, vai nav kāds līdzeklis, tabletes, pulveris, vienalga kas, kas palīdzētu ma
Sveiki! Man ir 16 gadi, bet augumā es esmu tikai 1,7m, ja ikdienā nenodarbotos ar basketbolu, tad tā nebūtu tik liela problēma, bet ja man komandā visi ir 185++, tad.. :D es gribētu uzzināt, vai nav kāds līdzeklis, tabletes, pulveris, vienalga kas, kas palīdzētu ma
Este sitio web utiliza cookies propias y de terceros para mejorar tu accesibilidad a la web, así como para analizar y personalizar tu navegación mostrar publicidad y anuncios basados en tus intereses. Al continuar navegando aceptas nuestra.Acepto No Acepto Leer más ...
Información confiable de Biological properties of plasties - Encuentra aquí ✓ ensayos ✓ resúmenes y ✓ herramientas para aprender ✓ historia ✓ libros ✓ biografías y más temas ¡Clic aquí!
Klinika Chirurgii Plastycznej AESTETICA dr Jacek Jarliński zajmuje się chirurgią plastyczną i medycyną estetyczną. Wykonywane operacje plastyczne to m.in. powiększanie piersi, odsysanie tłuszczu, botox, leczenie nadpotliwości, wolumetria, facelifting i wiele innych.
Información confiable de Hapiness - Encuentra aquí ✓ ensayos ✓ resúmenes y ✓ herramientas para aprender ✓ historia ✓ libros ✓ biografías y más temas ¡Clic aquí!
Utilizziamo i cookie per essere sicuri che tu possa avere la migliore esperienza sul nostro sito. Se continui ad utilizzare questo sito noi assumiamo che tu ne sia felice.OkPrivacy policy ...
Jgn risau, kalau seorang cikgu bg hadiah penampar, tandanya dia sayang anak murid tu, penampar tanda sayang la tuh..insyaAllah budak tu akan ingat sampai mati..semuga dia faham apa silap dia dan bersedia utk berubah.. ...
Utilizziamo i cookie per essere sicuri che tu possa avere la migliore esperienza sul nostro sito. Se continui ad utilizzare questo sito noi assumiamo che tu ne sia felice.OkLeggi di più ...
Utilizziamo i cookie per essere sicuri che tu possa avere la migliore esperienza sul nostro sito. Se continui ad utilizzare questo sito noi assumiamo che tu ne sia felice.Ok ...
Šajā veidnē tiek izmantots skripts, kas uzrakstīts programmēšanas valodā Lua. Skatīt lapu Vikipēdija:Lua, lai uzzinātu vairāk ...
Aħna nużaw il-cookies biex naħdmu bmod effettiv. Int taqbel ma dan meta tuża din il-websajt. Kunsens għall-użu tal-cookies.. ...
Aħna nużaw il-cookies biex naħdmu bmod effettiv. Int taqbel ma dan meta tuża din il-websajt. Kunsens għall-użu tal-cookies.. ...
Aħna nużaw il-cookies biex naħdmu bmod effettiv. Int taqbel ma dan meta tuża din il-websajt. Kunsens għall-użu tal-cookies.. ...
Šī vietne izmanto sīkdatnes, lai uzlabotu lietošanas pieredzi un optimizētu tās darbību. Turpinot lietot šo vietni, Jūs piekrītiet sīkdatņu lietošanai genetikascentrs.lv tīmekļa vietnē. Lasīt vairāk ...