This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
Elevated muscle protein synthesis after inactivation of MuRF1 and MuRF2. (A) The translation elongation factor EEF1G (interacting with MuRF1 and MuRF2; see Figu
Complete information for EEF1A1P9 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Alpha 1 Pseudogene 9, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for EEF1A1P10 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Alpha 1 Pseudogene 10, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Bacterial protein synthesis is intricately connected to metabolic rate. One of the ways in which bacteria respond to environmental stress is through posttranslational modifications of translation factors. Translation elongation factor Tu (EF-Tu) is methylated and phosphorylated in response to nutrient starvation upon entering stationary phase, and its phosphorylation is a crucial step in the pathway toward sporulation. We analyze how phosphorylation leads to inactivation of EF-Tu. We provide structural and biophysical evidence that phosphorylation of EF-Tu at T382 acts as an efficient switch that turns off protein synthesis by decoupling nucleotide binding from the EF-Tu conformational cycle. Direct modifications of the EF-Tu switch I region or modifications in other regions stabilizing the β-hairpin state of switch I result in an effective allosteric trap that restricts the normal dynamics of EF-Tu and enables the evasion of the control exerted by nucleotides on G proteins. These results ...
Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the ribosome. This protein is completely inactivated by EF-2 kinase phosphorylation. It is the target of diphtheria toxin (from Corynebacterium diphtheriae), and exotoxin A (from Pseudomonas aeruginosa). The inactivation of EF-2 by toxins inhibits protein production in the host, causing symptoms due to loss of function in affected cells. GRCh38: Ensembl release 89: ENSG00000167658 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000034994 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". Rapp G, Klaudiny J, Hagendorff G, Luck MR, Scheit KH (Mar 1990). "Complete sequence of the coding region of human elongation factor 2 (EF-2) by enzymatic amplification of cDNA from human ovarian granulosa ...
Studies on the high molecular weight form of polypeptide chain elongation factor-1 from pig liver. III. Temperature-dependent dissociation into subunits in the presence of GTP.:III. Temperature-Dependent Dissociation into Subunits in the Presence of GTP (1983 ...
ELOF1 - ELOF1 (untagged)-Human elongation factor 1 homolog (S. cerevisiae) (ELOF1) available for purchase from OriGene - Your Gene Company.
Plant elongation factor EF-1 consists of four subunits (EF-1 alpha beta beta gamma ). EF-1 alpha . GTP catalyses the binding of aminoacyl-tRNA to the ...
Protein required, along with Dph2p, Kti11p, Jjj3p, and Dph5p, for synthesis of diphthamide, which is a modified histidine residue of translation elongation factor 2 (Eft1p or Eft2p); may act in a complex with Dph2p and ...
EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This…
EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This…
這幾個月為了拼專案獎金~可以說沒什麼時間能好好休息還好我的努力有了收穫,讓我獲得了專案比賽的第二名暢銷熱賣嘿嘿~~真是太開心了,獎金拿到手後當然要好好的補償一下自己這幾個月的辛勞囉!!!!限時活動折扣所以馬上上網找尋我一直想買的超值推DVKN 大衛肯尼斯-
We recovered extracellular vesicles with a size consistent with exosomes that we called exosome-like vesicles (ELVs) from the supernatants of SS and Toxo cultures. The mRNA and miRNA content of these ELVs was highly regulated creating specific and unique expression profiles comparing Toxo ELVs, SS ELVs and RNA isolated from whole cell homogenates. Interestingly, among the most enriched mRNA isolated from ELVs of Toxo cells are 4 specific mRNA species that have been described in the literature as having neurologic activity: Rab-13, eukaryotic translation elongation factor 1 alpha 1, thymosin beta 4 and LLP homolog. In addition, miRNA species uniquely expressed in Toxo ELVs include miR-23b, a well-known regulator of IL-17 ...
Rehner, Stephen A. , Marilena Aquino de Muro & Joseph W. Bischoff. Description and phylogenetic placement of Beauveria malawiensis sp. nov. (Clavicipitaceae, Hypocreales). Mycotaxon 98: 137 - 145. 2006.. ABSTRACT: A new entomopathogenic species, Beauveria malawiensis, is described. Beauveria malawiensis was isolated from a cadaver of Phoracantha semipunctata (Coleoptera: Cerambycidae) collected in Zomba, Malawi. Morphologically, B. malawiensis is distinguished by its pink colony color, the terminal and intercalary clusters of inflated conidiophores that each gives rise to multiple rachiform conidiogenous cells, and holoblastic cylindrical conidia. Phylogenetic analysis of nuclear ribosomal internal transcribed spacer and translation elongation factor-1 alpha sequences place B. malawiensis apart from other species in the genus that also produce cylindrical conidia, supporting its proposed species status. KEYWORDS: Cordyceps, fungal entomopathogen, new species, taxonomy. ...
Based on previous work,23,24 we chose a strategy for glycopeptide synthesis that involves direct silver-promoted glycosylation between an S-alkyl-isothiourea and the amine of the amino acid side chain on the solid phase. First, we synthesized the key building block, N-glycosyl-S-alkyl-isothiourea 6, starting from L-rhamnose 2 (Fig. 3b): glycosyl chloride 3 in the desired configuration was obtained using well established procedures (85% yield).25,26 Subsequently, 3 was treated with potassium thiocyanate (KSCN) and tetrabutylammonium hydrogen iodide (TBAI) in anhydrous acetonitrile to get glycosyl isothiocyanate 4 (70% yield).27 Next, glycosyl thiourea 5 was prepared via ammoniation of 4 in tetrahydrofuran (99% yield).28 Finally, a two-step, one-pot procedure converted 5 into 6 in the presence of ethyl iodide and tert-butoxycarbonyl anhydride (75% yield).29 Taken together from 2 to 6 we ended up with an efficiency of about 44%. The configuration of the attached rhamnose in the hapten depends on ...
Understanding the mechanisms behind translation and its rate-limiting steps is crucial for both the development of drug targets and improvement of heterologous protein production with many biotechnological applications, such as in pharmaceutical and biofuel industries. Despite many advances in the knowledge of the ribosome structure and function, there is still much discussion around the determinants of translation elongation with experiments and computational studies pointing in different directions. Here, we use a stochastic framework to simulate the process of translation in the context of an Escherichia coli cell by gathering the available biochemical data into a ribosome kinetics description. Our results from the study of translation in E. coli at different growth rates contradict the increase of mean elongation rate with growth rate established in the literature. We show that both the level of tRNA competition and the type of cognate binding interaction contribute to the modulation of ...
apg:APA12_09310 K02358 elongation factor Tu , (GenBank) translation elongation factor Tu (EF-TU) (A) MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKKGGAEFKAYDQIDAAPEERARG ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDVPIIKGSALVTLE DGDPEIGENRVRDLMDAVDSYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVIN VGDEIEIVGLKPTTKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNCA MEVELIAPIAMDEGLRFAIREGGRTVGAGVVSSIIE ...
bla:BLA_1148 K02358 elongation factor Tu , (GenBank) tuf; translation elongation factor Tu (A) MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHDEYPDLNPEYDFNQIDAAPEEQQ RGITINIAHIEYQTAKRHYAHVDCPGHADFVKNMITGAAQMDGAILVVAATDGPMAQTRE HVLLAPQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDENGFDRDCPVVHTSAYGAL HDDAPDHDKWVATIKELMDDVDEYIPTPVHDLDKPFLMPIEDVFTISGRGTVVTGRVERG KLPINTNVEIVGIRPTQTTTFTSIETFHKQMDECEAGDNTGLLLRGINRTDVERGQVVAA PGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRTTDVTGVITLPEGVEMVQPGD HATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA ...
Elongation factor 1-alpha 2 is a protein that in humans is encoded by the EEF1A2 gene. This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. EEF1A2 is a direct target of miRNA-663 and miRNA-744. GRCh38: Ensembl release 89: ENSG00000101210 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000016349 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". Knudsen SM, Frydenberg J, Clark BF, Leffers H (Sep 1993). "Tissue-dependent variation in the expression of elongation factor-1 alpha isoforms: isolation and characterisation of a cDNA encoding a novel variant of human elongation-factor 1 alpha". Eur J Biochem. 215 (3): 549-54. ...
A [4Fe-4S] enzyme that modifies a histidine residue of the translation elongation factor 2 (EF2) via a 3-amino-3-carboxypropyl radical. The enzyme is present in archae an
Molecular model of elongation factor complexed with GDP (guanosine diphosphate). This enzyme is involved in the elongation of polypeptide chains during translation, the production of a protein from an mRNA (messenger ribonucleic acid) template. - Stock Image C025/1936
Ribosomal elongation factor 4 (EF4) is highly conserved among bacteria, mitochondria, and chloroplasts. However, the EF4-encoding gene, lepA, is nonessential an
eEF-2 kinase, an adverse regulator of health proteins functionality as a result of terminating peptide elongation, can be overexpressed in different sorts of neoplasms such as malignant glioma plus cancers of the breast. Hang-up of eEF-2 kinase generates a dropped viability of unknown growth tissue. Previous scientific studies from the set as well as others get established that eEF-2 kinase participates in the induction connected with autophagy responding to several mobile phone tensions, underscoring the value of eEF-2 kinase like a regulator regarding autophagy. Given that Akt is regarded as an effective therapeutic aim for intended for melanoma treatment method, we wished to learn no matter if eEF-2 kinase had been mixed up in the account activation connected with autophagy caused by Akt hang-up. Most people found out that silencing of eEF-2 kinase prevents a autophagic effect activated simply by Akt hang-up frequently by means of MK-2206 or even by means of RNA interference throughout people ...
Buy Race for Pace by XI on VideoHive. Effect consists of hi-tech Alpha sequence, based on the real-time effect. Highly suitable for all kinds of flash &amp...
TY - JOUR. T1 - Biosynthetic incorporation of [3H]ethanolamine into protein synthesis elongation factor 1α reveals a new post-translational protein modification. AU - Rosenberry, T. L.. AU - Krall, J. A.. AU - Dever, T. E.. AU - Haas, R.. AU - Louvard, D.. AU - Merrick, W. C.. PY - 1989/1/1. Y1 - 1989/1/1. N2 - Biosynthetic incorporation of [3H]ethanolamine into proteins was assessed in the human erythroleukemia cell line K562. A single predominant labeled protein of about 50 kDa was observed following electrophoresis of cell extracts on polyacrylamide gels in the presence of sodium dodecyl sulfate. Subcellular fractionation showed this protein to distribute similarly to a 46-kDa [3H]ethanolamine-labeled protein reported previously (Tisdale, E.J., and Tartakoff, A.M. (1988) J. Biol. Chem. 263, 8244-8252). In particular, the protein was enriched in cytosolic and microsomal fractions relative to plasma membrane and thus did not appear to correspond to the class of proteins with glycoinositol ...
Yao, Q., B. Q. Liu, H. Li, D. McGarrigle, B. W. Xing, M. T. Zhou, Z. Wang, J. J. Zhang, X. Y. Huang and L. Guo (2014). "C-terminal Src kinase (Csk)-mediated phosphorylation of eukaryotic elongation factor 2 (eEF2) promotes proteolytic cleavage and nuclear translocation of eEF2." J Biol Chem 289(18): 12666-78 ...
Eukaryotic initiation factor 5A is an 18 kDa protein that has been implicated in a wide variety of cellular activities, but its primary role, especially its role in translation, has been a mystery. Investigation of its localization in developing maize endosperm and root and leaf tissue have reinforced the idea that eIF5A has at least a secondary role in cellular proliferation and cell division. The interactions of eIF5A with numerous maize proteins identified through pull down analysis, have provided insight into the primary function of this elusive protein. Identified proteins that interacted with eIF5A were components of the cytoskeleton or involved in cell division (tubulin, legumin, actin), carbohydrate synthesis and modification, amino acid biosynthesis, and translation elongation factors. These interacting proteins all have a link to management and survival under low oxygen conditions in plants, suggesting a role of eIF5A as an elongation factor that is necessary when stress interferes ...
At crucial points in the metabolism of all organisms, a protein with the unwieldy name of Translation Elongation Factor P (EF-P, for short) takes center stage. What it actually does during protein synthesis has only now been elucidated - by researchers at LMU.. The research group led by Kirsten Jung, Professor of Microbiology at LMU, actually focused on how bacteria cope with stress, for example how the receptor meolecule CadC monitors the acidity in the environment and alerts the cell to take countermeasures to protect itself. However, one day Kirsten Jung found herself asking questions about protein synthesis, the core biosynthetic process that makes all metabolism possible. This arose because she discovered that, in the absence of Elongation Factor P, the cell doesn´t make enough CadC to carry out its job effectively.. Recovering from a stall. How then does EF-P regulate protein synthesis in general, and, in particular, the synthesis of CadC? In collaboration with Daniel Wilson´s group at ...
2020) LreEF1A,, a translation elongation factor from Lilium regale, Is pivotal for cucumber mosaic virus and tobacco rattle virus infections and tolerance to salt and drought. International Journal of Molecular Sciences, 21 (6). Article 2083. Jia, Y., Selva, C., Zhang, Y., Li, B., McFawn, L.A., Broughton, S., Zhang, X., Westcott, S., Wang, P., Tan, C., Angessa, T., Xu, Y., Whitford, R. and Li, C. ...
Wang, Z., Han, Q. Q., Zhou, M. T., Chen, X., and Guo, L. (2016) Protein turnover analysis in Salmonella Typhimurium during infection by dynamic SILAC, Topograph, and quantitative proteomics. J. Basic Microbiol. 56, 801-811. Yao, Q., Liu, B. Q., Li, H., McGarrigle, D., Xing, B. W., Zhou, M. T., Wang, Z., Zhang, J. J., Huang, X. Y., and Guo, L. (2014) C-terminal Src kinase (Csk)-mediated phosphorylation of eukaryotic elongation factor 2 (eEF2) promotes proteolytic cleavage and nuclear translocation of eEF2. J. Biol. Chem. 289, 12666-12678. ...
SORMANI R. , DELANNOY E. , LAGEIX S. , BITTON F. , LANET E. , SAEZ-VASQUEZ J. , DERAGON J. M. , RENOU J. P. , ROBAGLIA C. Plant and Cell Physiology 52(2), 436-447, 2011-02-01 References (48) ...
static void on_efl_event_finger_down(void *data, const Efl_Event *event) { Efl_Input_Pointer *info = event-,info; Eo *obj = event-,object; Data *d = data; /* event hander code */ } static void setup_event_handler(Eo *obj, Data *d) { efl_event_callback_add(obj, EFL_EVENT_FINGER_DOWN, on_efl_event_finger_down, d); } ...
Plasmid N111 nLV EF-1a-PGK-Puro Gal4-HP1a FL from Dr. Jerry Crabtrees lab contains the insert Cbx5 and is published in Cell. 2012 Jun 22;149(7):1447-60. doi: 10.1016/j.cell.2012.03.052. Epub 2012 Jun 14. This plasmid is available through Addgene.
Support for this feature is highly dependent on the theme in use. At the time of writing, the default theme for EFL does not implement support for orientation modes ...
Welcome to Eat. Drink. Love.! My name is Stephanie. Here you will find healthy and easy recipes with a few indulgences thrown in for good measure! Why the name Eat. Drink. Love.? Well, I think this is what life is all about! more about me » ...
Ustilaginomycotina (Basidiomycota, Fungi) has been reclassified recently based on multiple gene sequence analyses. However, the phylogenetic placement of two yeast-like genera Malassezia and Moniliella in the subphylum remains unclear. Phylogenetic analyses using different algorithms based on the sequences of six genes, including the small subunit (18S) ribosomal DNA (rDNA), the large subunit (26S) rDNA D1/D2 domains, the internal transcribed spacer regions (ITS 1 and 2) including 5.8S rDNA, the two subunits of RNA polymerase II (RPB1 and RPB2) and the translation elongation factor 1-α (EF1-α), were performed to address their phylogenetic positions. Our analyses indicated that Malassezia and Moniliella represented two deeply rooted lineages within Ustilaginomycotina and have a sister relationship to both Ustilaginomycetes and Exobasidiomycetes. Those clades are described here as new classes, namely Moniliellomycetes with order Moniliellales, family Moniliellaceae, and genus Moniliella; and ...
Genes related to RNA processing and translation showed higher rates of expression in young larvae (first and second instars) than in older larvae (Table 1). RNA helicase was strongly expressed by young larvae, as was an RNA-binding protein and translation elongation factor 2. Interestingly, two heat-shock proteins also were overexpressed in the youngest larvae. One shows a significant match to the Hsp70 family, whereas the second matches Hsp90. Heat-shock proteins are named for their ubiquitous presence following hyperthermy and other stresses [12], but members of this group have a more general role as molecular chaperones, and are involved in the assembly of newly translated proteins [13]. Hsp90 appears to be involved in the assembly of steroid hormone receptors [13]. Expression analyses on a more precise time scale, and at the level of specific tissues, should help determine whether the covariance between the expression of Hsps and agents involved in RNA processing reflects a joint role in ...
Synthesis of proteins is performed by the ribosome, a large ribonucleoprotein complex. Apart from the ribosome, numerous protein factors participate in this process. Elongation factor 2 (eEF2) is one of these factors. eEF2 is an essential protein with a mol. mass of about 100 kDa. The amino acid sequence of eEF2 is highly conserved in different organisms. eEF2 from S. cerevisiae contains 842 amino acids. The role of eEF2 in protein synthesis is to participate in the translocation of tRNAs from the A- and P-sites on the ribosome to the P- and E-sites. This movement of tRNAs is accompanied by a simultaneous movement of mRNA by one codon. eEF2 consists of six domains referred to as domains G, G′ and II-V, belongs to the G-protein super-family and possesses all structural motifs characterizing proteins in this family. eEF2 binds to the ribosome in complex with GTP. After GTP hydrolysis and translocation, it leaves the ribosome bound to GDP. The rate of protein synthesis in the cell can be ...
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome ...
aminoacyl tRNA synthetase p18 component: shares a protein motif with the beta and gamma subunits of eukaryotic elongation factor 1; amino acid sequence given in first source
tuf2; recname: full=elongation factor tu 2; short=ef-tu 2; recname: full=elongation factor tu 2; short=ef-tu 2; K02358 elongation factor ...
Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria [PUBMED:15755955]. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 kDa that contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this group undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation.. ...
All 72 EFL Clubs have been busy showcasing their contribution in the local community, with todays EFL Day of Action 2019 taking centre stage. Across the country, EFL Clubs in the Sky Bet Championship, League One and League Two have been running activities to highlight a diverse range of social is
Four subspecies are recognized: C. d. mitis, C. d. intermedius, C. d. gravis, and C. d. belfanti. The four subspecies differ slightly in their colonial morphology and biochemical properties, such as the ability to metabolize certain nutrients, but all may be toxigenic (and therefore cause diphtheria) or not toxigenic. C. diphtheriae produces diphtheria toxin which alters protein function in the host by inactivating the elongation factor EF-2. This causes pharyngitis and pseudomembrane in the throat. The diphtheria toxin gene is encoded by a bacteriophage found in toxigenic strains, integrated into the bacterial chromosome. To accurately identify C. diphtheriae, a Gram stain is performed to show Gram-positive, highly pleomorphic organisms with no particular arrangement. Special stains like Alberts stain and Ponders stain are used to demonstrate the metachromatic granules formed in the polar regions. The granules are called polar granules, Babes Ernst granules, volutin, etc. An enrichment ...
The kinase eEF2K [eukaryotic elongation factor 2 (eEF2) kinase] controls the rate of peptide chain elongation by phosphorylating eEF2, the protein that mediates the movement of the ribosome along the mRNA by promoting translocation of the transfer RNA from the A to the P site in the ribosome. eEF2K-mediated phosphorylation of eEF2 on threonine 56 (Thr56) decreases its affinity for the ribosome, thereby inhibiting elongation. Here, we show that in response to genotoxic stress, eEF2K was activated by AMPK (adenosine monophosphate-activated protein kinase)-mediated phosphorylation on serine 398. Activated eEF2K phosphorylated eEF2 and induced a temporary ribosomal slowdown at the stage of elongation. Subsequently, during DNA damage checkpoint silencing, a process required to allow cell cycle reentry, eEF2K was degraded by the ubiquitin-proteasome system through the ubiquitin ligase SCFβTrCP (Skp1-Cul1-F-box protein, β-transducin repeat-containing protein) to enable rapid resumption of translation ...
canSAR Domains and Structures of B7KGU8 | efp | Elongation factor P - Also known as EFP_GLOC7, efp. Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.
Nolan, R D.; Grasmuk, H; Hogenauer, G; and Drews, J, "Elongation factor 1 from krebs ii mouse ascites cells. Interaction with guanosine nucleotides and aminoacyl-trna." (1974). Subject Strain Bibliography 1974. 1110 ...
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome (By similarity).
ef-tu; highly similar to elongation factor Tu from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp,A6TEX7); K02358 elongation factor ...