MPP|sup|+|/sup|-induced neuronal death in rats involves tyrosine 33 phosphorylation of WW domain-containing oxidoreductase WOX1...
Fingerprint Dive into the research topics of MPP,sup,+,/sup,-induced neuronal death in rats involves tyrosine 33 phosphorylation of WW domain-containing oxidoreductase WOX1. Together they form a unique fingerprint. ...
Catalase-dependent release of half of the consumed oxygen during the activity of potato mitochondrial alternative oxidase...
Bhate, Radha H and Ramasarma, T (2010) Catalase-dependent release of half of the consumed oxygen during the activity of potato mitochondrial alternative oxidase confirms H2O2 as the product of oxygen reduction. In: Archives of Biochemistry and Biophysics, 495 (1). pp. 95-96. ...
Loss of wwox expression in zebrafish embryos causes edema and alters Ca2+ dynamics [PeerJ]
We investigated the role of the WW domain-containing oxidoreductase (wwox) gene in the embryonic development of zebrafish, with particular emphasis on intracellular Ca2+ dynamics because Ca2+ is an important intracellular messenger. Comparisons between zebrafish wwox and human WWOX sequences identified highly conserved domain structures. wwox was expressed in developing heart tissues in the zebrafish embryo. Moreover, wwox knockdown induced pericardial edema with similarities to conditions observed in human breast cancer. The wwox knockdown embryos with the edema died within a week. High Ca2+ levels were observed at the boundary between the edema and yolk in wwox knockdown embryos.
Nitric oxide reductase transcription regulator elisa and antibody
Shop Nitric oxide reductase transcription regulator ELISA Kit, Recombinant Protein and Nitric oxide reductase transcription regulator Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Association of Wwox With ErbB4 in Breast Cancer - PubMed
WWOX, WW domain-containing oxidoreductase, is a tumor suppressor that is altered in many human cancers, including breast cancer. Wwox interacts with the ErbB4 receptor, reduces nuclear translocation of the cleaved intracellular domain of ErbB4, and inhibits its transactivation function mediated thro …
Functional association between Wwox tumor suppressor protein and p73, a p53 homolog. - PubMed - NCBI
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Targeting STEAP1 | Amgen Oncology
Discover why STEAP1 (six-transmembrane epithelial antigen of prostate 1) is a therapeutic target and overexpressed in prostate cancer.
Recombinant Human WWOX protein (ab86687) References
References for Abcams Recombinant Human WWOX protein (ab86687). Please let us know if you have used this product in your publication
BISC 120 Section 3 review guide - MIDTERM 3 Review sheet This document lists SOME of the topics that were covered in lectures...
View Notes - BISC 120 Section 3 review guide from BISC 120 at USC. MIDTERM 3 Review sheet This document lists SOME of the topics that were covered in lectures or in the relevant chapters of the
BISC219/F13: Assignment 1 Lab1 - OpenWetWare
BISC219, Genetics Lab, models investigative science. We cannot provide individualized materials for you to design experiments to investigate questions you come up with on your own because of cost, time constraints, and your inexperience in using some of the tools. Nevertheless, we want you to learn first hand this semseter how scientists use genetic principles and techniques to answer basic and nuanced questions about gene structure and function and how that knowledge can be applied more broadly and communicated to the scientific community. Although your instructors have defined the questions and designed the experiments that will be used to address those questions, you must be able to, at any point in an investigation, describe what you are doing (summary of the experimental design and where you are in the process of completing the experiments), why you are doing it (experimental question(s) and goals), and what it means if x happens versus y when you collect your data (have a hypothesis ...
Difference between revisions of BISC110/S13 - OpenWetWare
Please complete a brief survey BEFORE leaving lab 12 to help us assess your background knowledge and expectations for lab. You can access this survey at . This survey is totally anonymous and not used to evaluate, you so please do not guess! Thank you for completing the survey. The labs for BISC 110/112 are designed to familiarize you with how experimental science is designed, performed and how it is communicated. Over the course of the semester, you will be designing and performing experiments that reinforce concepts covered in the lecture portion of the class. Your job will be to think like scientists when designing experiments to answer hypothesize driven questions about basic cellular processes. You will learn to perform the experiments properly, to keep good records of your results, and to communicate the results and conclusions of your work, both orally and in written reports ...
BISC104 Chapter 4 Flashcards - Cram.com
Study Flashcards On BISC104 Chapter 4 at Cram.com. Quickly memorize the terms, phrases and much more. Cram.com makes it easy to get the grade you want!
Escherichia coli peptide methionine sulfoxide reductase gene: regulation of expression and role in protecting against oxidative...
The Escherichia coli peptide methionine sulfoxide reductase gene (msrA) encodes a single-subunit polypeptide of 212 amino acid residues (M. A. Rahman, H. Nelson, H. Weissbach, and N. Brot, J. Biol. Chem. 267:15549-15551, 1992). RNA blot analysis showed that the gene is transcribed into an mRNA of about 850 nucleotides. The promoter region was characterized, and the transcription initiation site was identified by primer extension. The synthesis of the MsrA protein increased about threefold in a growth-phase-dependent fashion. In an attempt to define the in vivo role of msrA, a chromosomal disruption was constructed. This mutant was more sensitive to oxidative stress, suggesting that oxidation of methionine in proteins plays an important role in oxidative damage. ...
Peptide methionine sulfoxide reductase superfamily
The SCOP classification for the Peptide methionine sulfoxide reductase superfamily including the families contained in it. Additional information provided includes InterPro annotation (if available), Functional annotation, and SUPERFAMILY links to genome assignments, alignments, domain combinations, taxonomic visualisation and hidden Markov model information.
msrB - Peptide methionine sulfoxide reductase MsrB - Hathewaya histolytica - msrB gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Nitrate, nitrite and nitric oxide reductases: From the last universal common ancestor to modern bacterial pathogens<...
TY - JOUR. T1 - Nitrate, nitrite and nitric oxide reductases. T2 - From the last universal common ancestor to modern bacterial pathogens. AU - Vázquez-Torres, Andrés. AU - Baumler, Andreas J. PY - 2016/2/1. Y1 - 2016/2/1. N2 - The electrochemical gradient that ensues from the enzymatic activity of cytochromes such as nitrate reductase, nitric oxide reductase, and quinol oxidase contributes to the bioenergetics of the bacterial cell. Reduction of nitrogen oxides by bacterial pathogens can, however, be uncoupled from proton translocation and biosynthesis of ATP or NH4 +, but still linked to quinol and NADH oxidation. Ancestral nitric oxide reductases, as well as cytochrome c oxidases and quinol bo oxidases evolved from the former, are capable of binding and detoxifying nitric oxide to nitrous oxide. The NO-metabolizing activity associated with these cytochromes can be a sizable source of antinitrosative defense in bacteria during their associations with host cells. Nitrosylation of terminal ...
Search Results
Numerous hits in PSI-BLAST to peptide methionine sulfoxide reductases; e.g. residues 2-155 are 50% similar to PMSR_MYCGE, and residues 5-157 are 45% similar to PMSR_HELPY. Similar correlations exist to PMSR_NEIGO, PMSR_BRANA, PMSR_ARATH, PMSR_ECOLI, PMSR_YEAST, and PMSR_BOVIN ...
Dioxygen and nitric oxide reactivity of a reduced heme/non-heme diiron(II) complex [(5L)Fe(II)···Fe(II)-Cl]+. Using a tethered...
TY - JOUR. T1 - Dioxygen and nitric oxide reactivity of a reduced heme/non-heme diiron(II) complex [(5L)Fe(II)···Fe(II)-Cl]+. Using a tethered tetraarylporphyrin for the development of an active site reactivity model for bacterial nitric oxide reductase. AU - Ju, Telvin D.. AU - Woods, Amina S.. AU - Cotter, Robert J.. AU - Moënne-Loccoz, Pierre. AU - Karlin, Kenneth D.. PY - 2000/1/1. Y1 - 2000/1/1. N2 - We present here a first-generation model and initial reactivity (with O2 and NO) study for the heme/non-heme diiron active site chemistry of nitric oxide reductase (NOR), a denitrifying bacterial enzyme which converts nitric oxide to nitrous oxide (2NO + 2e- + 2H+ → N2O + H2O). This research is also pertinent because of the considerable recent biological, chemical and industrial interest in NO and nitrogen oxides. The study employs the binucleating ligand 5L, with tetradentate tris(2-pyridyl-methyl)amine (TMPA) chelate tethered to a tetraarylporphyrin (with three 2,6-difluorophenyl meso ...
RCSB PDB - Protein Feature View - Mitochondrial peptide methionine sulfoxide reductase - P54149 (MSRA BOVIN)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Arsenic in the structure of Crystal Structure Of the C-Terminal Methionine Sulfoxide Reductase Domain (Msrb) of N. Gonorrhoeae...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Arsenic atom in PDB 1l1d: Crystal Structure Of the C-Terminal Methionine Sulfoxide Reductase Domain (Msrb) of N. Gonorrhoeae Pilb
Cytokinin oxidase/dehydrogenase genes in barley and wheat: cloning and heterologous expression. | Sigma-Aldrich
Sigma-Aldrich offers abstracts and full-text articles by [Petr Galuszka, Jitka Frébortová, Tomás Werner, Mamoru Yamada, Miroslav Strnad, Thomas Schmülling, Ivo Frébort].
Nitrous oxide reductase<...
TY - CHAP. T1 - Nitrous oxide reductase. AU - DellAcqua, Simone. AU - Pauleta, Sofia R.. AU - Moura, Isabel Maria Andrade Martins Galhardas de. N1 - Sem PDF. PY - 2013. Y1 - 2013. M3 - Chapter. SN - 978-1-4614-1532-9. T3 - Encyclopedia of Metalloproteins. BT - Nitrous oxide reductase. A2 - Kretsinger, R.H.. A2 - Uversky, V. N.. A2 - Permyakov, E.A.. PB - Springer. ER - ...
RDH11 Antibody | scrazzl.com - Simply Connecting Science
Androgen-regulated short-chain dehydrogenase/reductase 1, ARSDR1CGI82, EC 1.1.1.300, HCBP12, HCV core-binding protein HCBP12, MDT1, prostate short-chain dehydrogenase reductase 1, Prostate short-chain dehydrogenase/reductase 1, PSDR1FLJ32633, RALR1, RalR1, Retinal reductase 1, retinol dehydrogenase 11, retinol dehydrogenase 11 (all-trans and 9-cis), retinol dehydrogenase 11 (all-trans/9-cis/11-cis), SCALD, SDR7C1, short chain dehydrogenase/reductase family 7C, member ...
SDR9C7 Antibody | scrazzl.com - Simply Connecting Science
EC 1.1.1, EC 1.1.1.-, FLJ16333, MGC126600, Orphan short-chain dehydrogenase/reductase, RDH-S, RDHSMGC126602, SDR-Oorphan short-chain dehydrogenase / reductase, SDROretinol dehydrogenase similar protein, short-chain dehydrogenase/reductase family 9C member 7, short chain dehydrogenase/reductase family 9C, member ...
Activation of mercuric reductase by the substrate NADPH - SANDSTRÖM - 1987 - The FEBS Journal - Wiley Online Library
Preincubation of the oxidized form of the flavoenzyme mercuric reductase with the reducing substrate, NADPH, or with a high concentration of cysteine (30 mM) results in a substantial increase of the catalytic activity as measured in a standard spectrophotometric assay. Also NADH has some activating effect but NADP+ or EDTA have no effect. In the presence of 1 mM cysteine only one equivalent of NADPH per FAD seems to be required for full activation which occurs after an incubation time of about 10 min. Activated mercuric reductase appears to be stable under anaerobic conditions but eventually returns to the original level of activity in the presence of oxygen. The activated state seems to be stabilized by 1 mM cysteine. Activation of mercuric reductase does not seem to be correlated with a change in the number of reactive thiol groups. The chemical nature of the activation process is not yet understood.. Stopped-flow studies have shown that the nonactivated enzyme is practically inactive prior to ...
Electrochemical behaviour of bacterial nitric oxide reductase-Evidence of low redox potential non-heme Fe-B gives new...
Cordas, Cristina M., Americo G. Duarte, Jose J. G. Moura, and Isabel Moura. Electrochemical behaviour of bacterial nitric oxide reductase-Evidence of low redox potential non-heme Fe-B gives new perspectives on the catalytic mechanism. Biochimica Et Biophysica Acta-Bioenergetics. 1827.3 (2013): 233-238 ...
Global Oxidoreductases Market 2019 - Novozymes, Dupont, DSM, BASF, AB Enzymes, CHR.Hansen, Amano Enzyme - Pharmaceutical...
The research report on Global Oxidoreductases Market Analysis 2019, evaluates the market based on SWOT analysis and Porters Five Forces Model, which analyzes the degree of competition in the global market by considering several micro and macro factors. The Global Oxidoreductases marketing research report is a comprehensive study of the current trends in the market, industry growth drivers, challenges, and restraints. It also provides data regarding the competitive landscape and geographical distribution of the Global Oxidoreductases market, along with an analysis of recent developments.. The Global Oxidoreductases market is anticipated to develop from xx USD billion 2019 to USD xx billion by 2024, at a CAGR of y% during the estimate time.. To Get Sample Copy of Report visit at : http://www.marketresearchtrade.com/report/global-oxidoreductases-market-2018-industry-overview-sales-demand.html#Request_Sample. Complete Global Oxidoreductases Market 2019 research report is isolated according to major ...
Independently recruited oxidases from the glucose-methanol-choline oxidoreductase family enabled chemical defences in leaf...
Larvae of the leaf beetle subtribe Chrysomelina sensu stricto repel their enemies by displaying glandular secretions that contain defensive compounds. These repellents can be produced either de novo (iridoids) or by using plant-derived precursors (e.g. salicylaldehyde). The autonomous production of …
Plus it
Degradation of the plant hormone cytokinin is controlled by cytokinin oxidase/dehydrogenase (CKX) enzymes. The molecular and cellular behavior of these proteins is still largely unknown. In this study, we show that CKX1 is a type-II single-pass membrane protein that predominantly localizes to the endoplasmic reticulum (ER). This indicates that this CKX isoform is a bona fide ER protein directly controlling the cytokinin which triggers the signaling from the ER. By using various approaches, we demonstrate that CKX1 forms homodimers and homooligomers in vivo. The N-terminal part of CKX1 was necessary and sufficient for the protein oligomerization as well as for targeting and retention in the ER. Moreover, we show that protein-protein interaction is largely facilitated by transmembrane helices and depends on a functional GxxxG-like interaction motif. Importantly, mutations rendering CKX1 monomeric interfere with its steady-state localization in the ER and cause a loss of the CKX1 biological ...
Thioredoxin reductase-dependent repression of MCB cell cycle box elements in Saccharomyces cerevisiae
File scanned at 300 ppi (Monochrome, 8-bit Grayscale, 24-bit Color) using ScandAll PRO 1.8.1 on a Fi-6670 in PDF format. CVista PdfCompressor 4.0 was used for pdf compression and textual OCR ...
STORRE: A field-compatible method for measuring alternative respiratory pathway activities in vivo using stable O2 isotopes
Plants can alter rates of electron transport through the alternative oxidase (AOX) pathway in response to environmental cues, thus modulating respiratory efficiency, but the 18O discrimination method necessary for measuring electron partitioning in vivo has been restricted to laboratory settings. To overcome this limitation, we developed a field-compatible analytical method. Series of plant tissue subsamples were incubated in 12 mL septum-capped vials for 0.5-4 h before aliquots of incubation air were injected into 3.7 mL evacuated storage vials. Vials were stored for up to 10 months before analysis by mass spectrometry. Measurements were corrected for unavoidable contamination. Additional mathematical tools were developed for detecting and addressing non-linearity (whether intrinsic or due to contamination) in the data used to estimate discrimination values. Initial contamination in the storage vials was 0.03 ± 0.01 atm; storing the gas samples at -17 °C eliminated further contamination ...
SDR42E1 Gene - GeneCards | D42E1 Protein | D42E1 Antibody
Complete information for SDR42E1 gene (Protein Coding), Short Chain Dehydrogenase/Reductase Family 42E, Member 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
RCSB PDB for 1GRX
1GRX: NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
Dehydrogenase/reductase SDR family protein elisa and antibody
Shop Dehydrogenase/reductase SDR family protein ELISA Kit, Recombinant Protein and Dehydrogenase/reductase SDR family protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
EMBL: CP000667.PE408
CP000667.PE408 Location/Qualifiers FT CDS_pept 469214..469912 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Strop_0408 FT /product=short-chain dehydrogenase/reductase SDR FT /note=PFAM: short-chain dehydrogenase/reductase SDR FT /db_xref=EnsemblGenomes-Gn:Strop_0408 FT /db_xref=EnsemblGenomes-Tr:ABP52893 FT /db_xref=InterPro:IPR002347 FT /db_xref=InterPro:IPR036291 FT /db_xref=UniProtKB/TrEMBL:A4X1Z3 FT /protein_id=ABP52893.1 FT /translation=MVNLDGLRVAVTGAGRASGRLLATAFAEHGAQVFVSARDEVAARR FT TTDSIRQRGRGRGEAFVCDLTSPDSVRAFAAALTDRTDHLDVLVNNGAGYLHGVDLGDV FT EDDHIIATIGGTATGTVLLTKHLLALLRASTRPDIVNMISACGEVGHHRSEAHPAFYAA FT KHAQAGFAEIMSHRLRVEGIRVISLFPPDFVQHGPRVASNNLTAQSVVDCVLFAVSQPR FT DCFIREFRFE gtggtgaatc tcgacggact acgggttgct gtcaccggcg ccgggcgcgc ctccggacgc 60 ctcctggcga ccgccttcgc cgagcacggc gcgcaggtgt ttgtctccgc ccgtgatgag 120 gtggcagcca gacgcaccac ggattcgatc cggcagcgtg ggcgggggag aggcgaagcc 180 ttcgtctgtg acctgaccag ccccgactcg gtacgcgcgt tcgcggcggc gttgaccgac 240 cgcaccgacc ...
BISC 307L : General Physiology - USC - Page 1 - Course Hero
Here is the best resource for homework help with BISC 307L : General Physiology at USC. Find BISC307L study guides, notes, and practice tests from USC.
Bacteria NosR protein Summary Report | CureHunter
Bacteria NosR protein: amino acid sequence given in first source; regulatory component necessary for expression of nitrous oxide reductase in denitrifying
Mutation - bisC9::Mu cts
F-, [araD139]B/r, Δ(argF-lac)169, λ-, bioA24, zbh-428::Tn10, flhD5301, Δ(fruK-yeiR)725(fruA25), relA1, rpsL150(strR), bisC9::Mu cts, deoC1 ...
Crnfa Vs Cnor????? | allnurses
VERY INTERESTED IN OR NURSING (PRESENTLY ON MED/SURG) AND WHILE LOOKING UP SOME INFO ON THE AORN SITE, I SAW COURSES AVAILABLE FOR CERTIFICATION AS A CRNFA AND CNOR. WHAT ARE THESE JOB
Publications | SBRC
Conrath, K., A. S. Pereira, C. E. Martins, C. G. Timóteo, P. Tavares, S. Spinelli, J. Kinne, C. Flaudrops, C. Cambillau, S. Muyldermans, et al., Camelid nanobodies raised against an integral membrane enzyme, nitric oxide reductase., Protein Sci, vol. 18, issue 3, pp. 619-28, 2009 Mar. ...
Publications | SBRC
Conrath, K., A. S. Pereira, C. E. Martins, C. G. Timóteo, P. Tavares, S. Spinelli, J. Kinne, C. Flaudrops, C. Cambillau, S. Muyldermans, et al., Camelid nanobodies raised against an integral membrane enzyme, nitric oxide reductase., Protein Sci, vol. 18, issue 3, pp. 619-28, 2009 Mar. ...
Bio2Vec
ID: http://www.ncbi.nlm.nih.gov/gene/56889 Type: http://bio2vec.net/ontology/gene Label: TM9SF3 Synonyms: TM9SF3, EP70-P-iso, SMBP, transmembrane 9 superfamily member 3, SM-11044 binding protein, dinucleotide oxidase disulfide thiol exchanger 3 superfamily member 3, endomembrane protein emp70 precursor isolog Alternative IDs: 56889 API: GO SPARQL: GO ...
Chemical Database: Ammonium, (p-(1,4-dihydro-3,5-dimethoxycarbonyl-2,6-dimethyl-4-pyridyl)phenyl)trimet hyl-, iodide ...
This page contains information on the chemical Ammonium, (p-(1,4-dihydro-3,5-dimethoxycarbonyl-2,6-dimethyl-4-pyridyl)phenyl)trimet hyl-, iodide including: 2 synonyms/identifiers.
Australian Researchers Uncover How Cancer-Suppressing Gene WWOX Works
WWOX gene plays an important role in the altered metabolism of cancer cells which are known to use glucose differently than normal cells.
INDOX - industrial oxidoreductases
An article highlighting the INDOX project objectives and main outcomes has been included in the BIOECONOMY INNOVATION -CommBeBiz magazine 2016-2017, a publication covering bioeconomy trends in markets, policy, and research social innovations.. CommBeBiz is H2020 funded initiative working with FP7 and H2020 project partners at all stages of their ideas and research development to enable more effective and speedier transfer of knowledge to the marketplace, to policy-players and for the public good. ...
INDOX - industrial oxidoreductases
An article highlighting the INDOX project objectives and main outcomes has been included in the BIOECONOMY INNOVATION -CommBeBiz magazine 2016-2017, a publication covering bioeconomy trends in markets, policy, and research social innovations.. CommBeBiz is H2020 funded initiative working with FP7 and H2020 project partners at all stages of their ideas and research development to enable more effective and speedier transfer of knowledge to the marketplace, to policy-players and for the public good. ...
Diversity of protein and mRNA forms of mammalian methionine sulfoxide reductase B1 due to intronization and protein processing....
Diversity of protein and mRNA forms of mammalian methionine sulfoxide reductase B1 due to intronization and protein processing. PLoS One. 2010 Jul 09; 5(7):e11497 ...
msrA - Peptide methionine sulfoxide reductase MsrA - Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) - msrA...
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Peptide Methionine Sulfoxide Reductase (MsrA) Is a Virulence Determinant in Mycoplasma genitalium | Journal of Bacteriology
M. genitalium was first isolated from the urine of two male patients with nongonococcal urethritis (28) and subsequently, along with M. pneumoniae, from throat specimens of pneumonia patients (4) and from synovial fluid of a patient with polyarthritis (29). Although Jensen et al. (18) recently used a cell culture system to isolate M. genitalium from urethral specimens, routine isolation of this fastidious pathogen from humans has been very difficult. Nevertheless, mounting PCR evidence reinforces its association with urethritis and other sexually transmitted diseases (26). With a limited genome size of 580 kb (12), M. genitalium is the smallest self-replicating microorganism reported to date. M. pneumoniae, which causes primary atypical pneumonia in humans, is closely related genetically to M. genitalium and has a genome size of 816 kb (15). Both Mycoplasmaspecies are limited metabolically and are deficient in genes common to other pathogenic bacteria, particularly genes related to cell wall ...
Hypermethylation-mediated reduction of WWOX expression in intraductal papillary mucinous neoplasms of the pancreas | British...
We have previously shown that WW domain-containing oxidoreductase (WWOX) has tumour-suppressing effects and that its expression is frequently reduced in pancreatic carcinoma. In this study, we examined WWOX expression in intraductal papillary mucinous neoplasm of the pancreas (IPMN) to assess the function of WWOX in pancreatic duct tumourigenesis using immunohistochemistry and methylation-specific polymerase chain reaction analysis. Among 41 IPMNs including intraductal papillary mucinous adenomas (IPMAs) and intraductal papillary mucinous carcinomas (IPMCs), loss or reduced WWOX immunoreactivity was detected in 3 (15%) of 20 IPMAs and 17 (81%) of 21 IPMCs. In addition, hypermethylation of the WWOX regulatory site was detected in 1 (33%) of 3 WWOX(−) IPMAs and 9 (53%) of 17 WWOX(−) IPMCs, suggesting that hypermethylation may possibly be important in the suppression of WWOX expression. Reduction of WWOX expression was significantly correlated with a higher Ki-67 labelling index but was not correlated
Isopenicillin N synthase - Wikipedia
Isopenicillin N synthase (IPNS) is a non-heme iron-dependent enzyme belonging to the oxidoreductase family. This enzyme catalyzes the formation of isopenicillin N from δ-(L-α-aminoadipoyl)-L-cysteinyl-D-valine (LLD-ACV). N-[(5S)-5-amino-5-carboxypentanoyl]-L-cysteinyl-D-valine + O2 ⇌ {\displaystyle \rightleftharpoons } isopenicillin N + 2 H2O This reaction is a key step in the biosynthesis of penicillin and cephalosporin antibiotics. The active sites of most isopenicillin N synthases contain an iron ion. This enzyme is also called isopenicillin N synthetase. A Fe(II) metal ion in the active site of the enzyme is coordinated by at least two histidine residues, an aspartate residue, a glutamine residue, and two water molecules in the absence of a bound substrate. Just two histidine residues and one aspartic acid residue are entirely conserved. Therefore, it is highly significant that these two histidine residues, His214 and His270, and one aspartic acid residue, Asp216, are precisely the ones ...
Expression analysis of alternative oxidase gene (aox1) with enhanced green fluorescent protein as marker in citric acid...
TY - JOUR. T1 - Expression analysis of alternative oxidase gene (aox1) with enhanced green fluorescent protein as marker in citric acid-producing Aspergillus niger. AU - Kirimura, Kohtaro. AU - Ogawa, Satoshi. AU - Hattori, Takasumi. AU - Kino, Kuniki. N1 - Funding Information: We express our thanks to Dr. Y. Niwa of the University of Shizuoka and Professor K. Kitamoto of the University of Tokyo for supplying the plasmid pBEGFP-F harboring the egfp gene. This work was partly supported by the 21COE program Practical Nano-Chemistry from MEXT, Japan.. PY - 2006/9. Y1 - 2006/9. N2 - In a citric acid-producing filamentous fungus Aspergillus niger WU-2223L, a cyanide- and antimycin A-insensitive and salicylhydroxamic acid-sensitive respiratory pathway functions in the mitochondria besides the cytochrome pathway and is catalyzed by alternative oxidase (AOX). We constructed an A. niger transformant strain AOXEGFP-1 expressing a fusion gene, aox1-egfp, encoding AOX and enhanced green fluorescent ...
Anti-Methionine Sulfoxide Reductase B antibody (ab71175) References
References for Abcams Anti-Methionine Sulfoxide Reductase B antibody (ab71175). Please let us know if you have used this product in your publication
Differential Expression of the Multigene Family Encoding the Soybean Mitochondrial Alternative Oxidase | Plant Physiology
The alternative oxidase (AOX) of the soybean (Glycine max L.) inner mitochondrial membrane is encoded by a multigene family (Aox) with three known members. Here, the Aox2 and Aox3 primary translation products, deduced from cDNA analysis, were found to be 38.1 and 36.4 kD, respectively. Direct N-terminal sequencing of partially purified AOX from cotyledons demonstrates that the mature proteins are 31.8 and 31.6 kD, respectively, implying that processing occurs upon import of these proteins into the mitochondrion. Sequence comparisons show that the processing of plant AOX proteins occurs at a characteristic site and that the AOX2 and AOX3 proteins are more similar to one another than to other AOX proteins, including soybean AOX1. Transcript analysis using a polymerase chain reaction-based assay in conjunction with immunoblot experiments indicates that soybean Aox genes are differentially expressed in a tissue-dependent manner. Moreover, the relative abundance of both Aox2 transcripts and protein ...
B2SQI9 | SWISS-MODEL Repository
SWISS-MODEL Repository entry for B2SQI9 (MSRA_XANOP), Peptide methionine sulfoxide reductase MsrA. Xanthomonas oryzae pv oryzae (strain PXO99A)
SWISS-MODEL Repository | C3LNU9
SWISS-MODEL Repository entry for C3LNU9 (MSRB_VIBCM), Peptide methionine sulfoxide reductase MsrB. Vibrio cholerae serotype O1 (strain M66-2)
WWOX suppresses autophagy for inducing apoptosis in methotrexate-treated human squamous cell carcinoma<...
TY - JOUR. T1 - WWOX suppresses autophagy for inducing apoptosis in methotrexate-treated human squamous cell carcinoma. AU - Tsai, C. W.. AU - Lai, F. J.. AU - Sheu, H. M.. AU - Lin, Y. S.. AU - Chang, T. H.. AU - Jan, M. S.. AU - Chen, S. M.. AU - Hsu, P. C.. AU - Huang, T. T.. AU - Huang, T. C.. AU - Sheen, M. C.. AU - Chen, S. T.. AU - Chang, W. C.. AU - Chang, N. S.. AU - Hsu, L. J.. PY - 2013/9. Y1 - 2013/9. N2 - Squamous cell carcinoma (SCC) cells refractory to initial chemotherapy frequently develop disease relapse and distant metastasis. We show here that tumor suppressor WW domain-containing oxidoreductase (WWOX) (also named FOR or WOX1) regulates the susceptibility of SCC to methotrexate (MTX) in vitro and cure of SCC in MTX therapy. MTX increased WWOX expression, accompanied by caspase activation and apoptosis, in MTX-sensitive SCC cell lines and tumor biopsies. Suppression by a dominant-negative or small interfering RNA targeting WWOX blocked MTX-mediated cell death in sensitive ...
Prevention and Early Intervention of Cancer by Reducing Serum Levels of the ENOX2 (tNOX) Protein With Green Tea and Capsicum...
ENOX2 Protein As Indicator of Cancerous Cells. Ecto-Nicotinamide Adenine Dinucleotide Oxidase Disulfide-Thiol Exchanger 2 (ENOX2), also known as Tumor-Associated Nicotinamide Adenine Dinucleotide Oxidase (tNOX), is specific for cancer by coating the surfaces of malignant cells and disrupting apoptosis signals to execute programmed cell death of the malignant cell. ENOX2 allows immature cancer cells to enlarge to a normal size. Essentially, cancers cells cannot survive or grow without ENOX2.. ENOX2 is produced only by cancer cells and not healthy normal cells. A distinct function of ENOX2 is the oxidation of NADH to NAD+ in an oscillating fashion. This process is accomplished within a period of 24 minutes, completing 60 cycles in a 24 hour period. This 60 cycles of 24 minutes is considered a regular oscillation of the biological clock. The period of oscillation in a cancerous cell is reduced to 22 minutes. 1. Detection of ENOX2 in the Serum with the ONCOblot® Test. The presence of ENOX2 in the ...
Recombinant Human BDH2 protein, His-tagged BDH2-3452H - Creative BioMart
BDH2; 3-hydroxybutyrate dehydrogenase, type 2; dehydrogenase/reductase (SDR family) member 6 , DHRS6; 3-hydroxybutyrate dehydrogenase type 2; FLJ13261; PRO20933; SDR15C1; short chain dehydrogenase/reductase family 15C; member 1; UCPA OR; UNQ6308; oxidoreductase UCPA; R-beta-hydroxybutyrate dehydrogenase; dehydrogenase/reductase SDR family member 6; dehydrogenase/reductase (SDR family) member 6; short chain dehydrogenase/reductase family 15C, member 1; DHRS6; EFA6R; UCPA-OR ...
Protein-carbonyl accumulation in the non-replicative senescence of the methionine sulfoxide reductase A ( msrA) knockout yeast...
The major enzyme of the methionine sulfoxide reductase (Msr) system is MsrA. Senescing msrAknockout mother yeast cells accumulated significant amounts of protein-carbonyl both at 5 generation-old...
mouse Steap protein Summary Report | CureHunter
mouse Steap protein: six-transmembrane epithelial antigen of the prostate, prostate stem cell antigen, and prostate-specific membrane antigen; RefSeq NM_027399
Supplementary Materialsijms-20-05857-s001 | Glycogen synthase kinase 3 (GSK3) is a serine/threonine protein kinase
Supplementary Materialsijms-20-05857-s001. = 7.4), Tf may bind two atoms of Fe3+ tightly. may be the receptor of can bind easily, and initiates Pyrithioxin dihydrochloride the clathrin-mediated endocytosis with the help of the TfR trafficking proteins [16]. Using the entry of protons, the pH in endosome filled with diferric Tf/TfR1 complicated decreases, producing a conformational alter in discharge and Tf of Fe3+ [17]. Subsequently, the apo-Tf/TfR complicated returns towards the cell surface area for another routine, whilst Fe3+ is normally decreased to Fe2+ by way of a reductase called six-transmembrane epithelial antigen from the prostate 3 ((PRV) over the hosts iron fat burning capacity [27], it really is of great importance to clarify the partnership between aquatic trojan infection as well as the iron fat burning capacity, which may donate to illuminating the antiviral iron-withholding strategies in aquatic pets and exploiting iron-related medications or feed chemicals for the avoidance ...
Oxidoreductases | definition of oxidoreductases by Medical dictionary
Looking for online definition of oxidoreductases in the Medical Dictionary? oxidoreductases explanation free. What is oxidoreductases? Meaning of oxidoreductases medical term. What does oxidoreductases mean?
N-O bond cleavage mechanism(s) in nitrous oxide reductase
Quantum chemical calculations of active-site models of nitrous oxide reductase (N2OR) have been undertaken to elucidate the mechanism of N-O bond cleavage mediated by the supported tetranuclear Cu4S core (Cu-Z) found in the enzymatic active site. Using either a minimal model previously employed by Gorelsky et al. (J. Am. Chem. Soc. 128:278-290, 2006) or a more extended model including key residue side chains in the active-site second shell, we found two distinct mechanisms. In the first model, N2O binds to the fully reduced Cu-Z in a bent mu-(1,3)-O,N bridging fashion between the Cu-I and Cu-IV centers and subsequently extrudes N-2 while generating the corresponding bridged mu-oxo species. In the second model, substrate N2O binds loosely to one of the coppers of Cu-Z in a terminal fashion, i.e., using only the oxygen atom; loss of N-2 generates the same mu-oxo copper core. The free energies of activation predicted for these two alternative pathways are sufficiently close to one another that ...
Biochemical properties of human dehydrogenase/reductase (SDR family) member 7. - Nuffield Department of Orthopaedics,...
Dehydrogenase/reductase (SDR family) member 7 (DHRS7, retSDR4, SDR34C1) is a previously uncharacterized member of the short-chain dehydrogenase/reductase (SDR) superfamily. While human SDR members are known to play an important role in various (patho)biochemical pathways including intermediary metabolism and biotransformation of xenobiotics, only 20% of them are considered to be well characterized. Based on phylogenetic tree and SDR sequence clusters analysis DHRS7 is a close relative to well-known SDR member 11β-hydroxysteroid dehydrogenase 1 (11β-HSD1) that participates in metabolism of endogenous and xenobiotic substances with carbonyl group. The aim of present study is to determine the basic biochemical properties of DHRS7 and its possible involvement in metabolism of substrates with carbonyl group. For the first time the computational predictions of this membrane protein and membrane topology were experimentally confirmed. DHRS7 has been demonstrated to be an integral protein facing the lumen of
KAKEN - Research Projects | The Function of B Cytochrome in Complex II (Succinate-Ubiquinone Oxidoreductase) (KAKENHI-PROJECT...
Principal Investigator:KITA Kiyoshi, Project Period (FY):1989 - 1990, Research Category:Grant-in-Aid for General Scientific Research (C), Research Field:General medical chemistry
日本微生物生態学会第30回土浦大会 » JS1-2:Regulation of N2O reductase genes by the two-component system NasST in Bradyrhizobium diazoefficiens
Here, I will present the recently discovered regulation of nos genes through the two-component system NasST. NasS is a nitrate sensor and NasT is a transcription antiterminator. Mutation of nasS induced both N2O reductase activity and transcription of nos genes (nosRZD), in cells of B. diazoefficiens incubated in the absence of nitrate. The NasS_NasT protein complex was dissociated in vitro by the addition of nitrate, suggesting the release of NasT, which is known to bind the leader RNA of the target gene, thereby preventing hairpin formation and allowing complete transcription. Disruption of nasT led to a marked decrease in nos transcription in B. diazoefficiens cells incubated with nitrate, indicating that NasST system regulates nos transcription in response to nitrate. Although analysis of the region upstream nosR and nosZ genes revealed no regulatory hairpin structures similar to those present in the leader RNA of other genes regulated by NasT, we could confirm binding of purified NasT with ...
櫻井 宣彦 (Nobuhiko Sakurai) - Heterologous expression of Halomonas halodenitrificans nitric oxide reductase and its N-terminally...
researchmap is an information sharing platform for the researchers.
researchmap is provided by Japan Science and Technology Agency.
ZFIN Gene: msra
Predicted to have L-methionine-(S)-S-oxide reductase activity and peptide-methionine (S)-S-oxide reductase activity. Predicted to be involved in cellular response to oxidative stress. Predicted to localize to cytoplasm. Orthologous to human MSRA (methionine sulfoxide reductase A ...
The SDR superfamily : functional and structural diversity within a family of metabolic and regulatory enzymes
Short-chain dehydrogenases/reductases (SDRs) constitute a large family of NAD(P)(H)-dependent oxidoreductases, sharing sequence motifs and displaying similar mechanisms. SDR enzymes have critical roles in lipid, amino acid, carbohydrate, cofactor, hormone and xenobiotic metabolism as well as in redox sensor mechanisms. Sequence identities are low, and the most conserved feature is an alpha/beta folding pattern with a central beta sheet flanked by 2 - 3 alpha-helices from each side, thus a classical Rossmannfold motif for nucleotide binding. The conservation of this element and an active site, often with an Asn-Ser-Tyr-Lys tetrad, provides a platform for enzymatic activities encompassing several EC classes, including oxidoreductases, epimerases and lyases. The common mechanism is an underlying hydride and proton transfer involving the nicotinamide and typically an active site tyrosine residue, whereas substrate specificity is determined by a variable C-terminal segment. Relationships exist with ...
Molecular and structural aspects of xenobiotic carbonyl metabolizing enzymes. Role of reductases and dehydrogenases in...
The major metabolic pathways involved in synthesis and disposition of carbonyl and hydroxyl group containing compounds are presented, and structural and functional characteristics of the enzyme families involved are discussed. Alcohol and aldehyde dehydrogenases (ADH, ALDH) participate in oxidative pathways, whereas reductive routes are accomplished by members of the aldo-keto reductase (AKR), short-chain dehydrogenases/reductases (SDR) and quinone reductase (QR) superfamilies. A wealth of biochemical, genetic and structural data now establishes these families to constitute important phase I enzymes.
GTOP nfar0:BAD57618.1
GT:ID BAD57618.1 GT:GENE BAD57618.1 GT:PRODUCT putative short chain dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2940013..2940783 GB:FROM 2940013 GB:TO 2940783 GB:DIRECTION + GB:PRODUCT putative short chain dehydrogenase GB:PROTEIN_ID BAD57618.1 LENGTH 256 SQ:AASEQ MDKDSFRKLFDLSGRTAIVTGGTRGIGLAIAEGFACAGANLVVASRKPEACEQAAARLRELGAQAVGVPTHLGEIDSLRALVDTAVSAFGGIDIVVNNAANALAQPLATMAPEAVDKSFGVNVQGPLFLVQAALPHLRASAHAAVLNLGSVAALQFAPGLSMYAAGKAALLSFTRAMAAEFAADGIRVNAMAPGAVNTDMVRKNPPEFIAAMAQAPLLRRIAEPDEMVGAALLLCSDAGSFITGQTFLVDGGTVAR GT:EXON 1,1-256:0, BL:SWS:NREP 1 BL:SWS:REP 12-,256,DHRS4_RABIT,4e-36,36.8,242/260, PROS 150-,178,PS00061,ADH_SHORT,PDOC00060, SEG 97-,102,nnaana, BL:PDB:NREP 1 BL:PDB:REP 9-,255,1vl8B,1e-34,34.4,247/252, RP:PDB:NREP 1 RP:PDB:REP 10-,256,2ae1A,8e-44,30.6,245/252, RP:PFM:NREP 1 RP:PFM:REP 15-,180,PF00106,2e-21,42.2,166/169,adh_short, HM:PFM:NREP 1 HM:PFM:REP 16-,181,PF00106,2.2e-34,30.9,162/167,adh_short, GO:PFM:NREP 2 GO:PFM ...
GTOP nfar0:BAD55466.1
GT:ID BAD55466.1 GT:GENE BAD55466.1 GT:PRODUCT putative short chain dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 643418..644293 GB:FROM 643418 GB:TO 644293 GB:DIRECTION + GB:PRODUCT putative short chain dehydrogenase GB:PROTEIN_ID BAD55466.1 LENGTH 291 SQ:AASEQ MSRWDTANIPDQSGRTFIVTGANSGLGAVAARALARAGADVVLACRNLTKAEKVAAEIGARATVRELDLADLASVRAFAAGTERVDVLINNAGVMAVPHRTTADGFEMQIGTNHLGHFALTGLLLDKITDRVVTVSSGAHAVGRIDLADLNWERRRYQRWLAYGQSKLANLLFAYELQRRLGAAGSPILSVAAHPGYAATELQSHTETFLDSVMNVGNRILAQTAEMGALPELFAATMPVEPGAFYGPTGLGGMRGYPGRCGSTKASRDERVAGELWALSERLTGVTYSFD GT:EXON 1,1-291:0, BL:SWS:NREP 1 BL:SWS:REP 7-,286,RDH13_MOUSE,2e-38,40.5,269/334, SEG 25-,44,glgavaaralaragadvvla, BL:PDB:NREP 1 BL:PDB:REP 14-,205,2japC,4e-08,39.4,180/246, RP:PDB:NREP 2 RP:PDB:REP 13-,91,2ag5C,1e-05,23.4,77/244, RP:PDB:REP 68-,205,3ce6B,5e-13,8.1,136/485, RP:PFM:NREP 1 RP:PFM:REP 46-,143,PF00106,3e-05,38.8,98/169,adh_short, HM:PFM:NREP 1 HM:PFM:REP ...
SDHA QuickView - Correlation Engine
This gene encodes a major catalytic subunit of succinate-ubiquinone oxidoreductase, a complex of the mitochondrial respiratory chain. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. Mutations …
Characterization of Apoptosis-Related Oxidoreductases from Neurospora crassa - pdf descargar
Characterization of Apoptosis-Related Oxidoreductases from Neurospora crassa. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Anti-Human Dehydrogenase/reductase (SDR Family) Member 9 Antikörper für Immunohistochemistry (Frozen Sections) (IHC (fro))
Top performende anti-Human Dehydrogenase/reductase (SDR Family) Member 9 Antikörper für Immunohistochemistry (Frozen Sections) (IHC (fro)) vergleichen & kaufen.
Oxidation of hemicellulose derived oligosaccharides with carbohydrate oxidoreductases</em>...
TY - CONF. T1 - Oxidation of hemicellulose derived oligosaccharides with carbohydrate oxidoreductases. AU - Karppi, Johanna. PY - 2018/7/8. Y1 - 2018/7/8. M3 - Poster. T2 - Oxizymes. Y2 - 8 July 2018 through 10 July 2018. ER - ...
myeloperoxidase | 1.-.-.- Oxidoreductases | IUPHAR/BPS Guide to PHARMACOLOGY
The IUPHAR/BPS Guide to Pharmacology. myeloperoxidase - 1.-.-.- Oxidoreductases. Detailed annotation on the structure, function, physiology, pharmacology and clinical relevance of drug targets.
Mglur Pathway | Page 2
2010).10 There are six main classes of enzymes, as follows (Schomburg et al., 2014): EC 1 Oxidoreductases catalyse reactions in which a substrate donates one or more electrons to an electron acceptor, becoming oxidized in the process. In reality all of the enzymes A1210477 in classes 1-3 satisfy the definition of transferases. However, as these three classes are all large compared. with the other three groups, it is convenient to break them into three classes, and to reserve the name transferase for enzymes that are not oxidoreductases or hydrolases. In addition to the name synthetase for ligases, the name synthase can be used for any enzyme when it is appropriate to use a name that emphasizes the name of the product synthesizes. Metzler (1980) pointed out that find more using two such similar names in contrasting ways was a source of confusion. 11 There is also a difference between the way enzymes in EC 6 are named: ligases are named according to the substrates that are joined, whereas ...
Estudo da correlação entre a hemorragia pulmonar induzida por exercício e alterações...
A hemorragia pulmonar induzida por exercício (HPIE) é caracterizada pela presença de sangue no trato respiratório anterior e posterior, sendo considerada por muitos autores como a principal causa na redução...
Arun K. Dhar | OMICS International
Dr. Dhar was Adjunct Associate Professor at San Diego State University Biology Department. He has studied viral diseases of shrimp for the past eight years, with a foc..
Bernie Clement, CIO, Thibodaux Regional Medical Center, Chapter 1 (HealthsystemCIO)
View Original Healthsystemcio.com Article Here Any CIO worth his or her salt knows the importance of getting physicians engaged; the big question is how to
SA RS05160 - AureoWiki
MetabolismEnergy metabolismElectron transportcytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104.3) ...
SAUSA300 0961 - AureoWiki
MetabolismEnergy metabolismElectron transportcytochrome aa3 quinol oxidase, subunit III (TIGR02897; EC 1.10.3.-; HMM-score: 359) ...
Cluster 46 details
oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of ...
Webinars | StorageCraft
A nossa plataforma de continuidade de negócio resolve os desafios de proteção e armazenamento de dados de empresas de todas as dimensões. Saiba como apoiamos os fornecedores de soluções com modelos de negócio de serviços Pro e centrados nos produtos. ...