Lactobacillus buchneri ST2A vigorously decarboxylates histidine to the biogenic amine histamine, which is excreted into the medium. Cells grown in the presence of histidine generate both a transmembrane pH gradient, inside alkaline, and an electrical potential (delta psi), inside negative, upon addition of histidine. Studies of the mechanism of histidine uptake and histamine excretion in membrane vesicles and proteoliposomes devoid of cytosolic histidine decarboxylase activity demonstrate that histidine uptake, histamine efflux, and histidine/histamine exchange are electrogenic processes. Histidine/histamine exchange is much faster than the unidirectional fluxes of these substrates, is inhibited by an inside-negative delta psi and is stimulated by an inside positive delta psi. These data suggest that the generation of metabolic energy from histidine decarboxylation results from an electrogenic histidine/histamine exchange and indirect proton extrusion due to the combined action of the ...
Evaluation of effects of copper histidine on copper transporter 1-mediated accumulation of platinum and oxaliplatin-induced neurotoxicity in vitro and in vivo
Staphylococcus aureus alpha-toxin is a membrane-damaging exoprotein that oligomerizes to form transmembrane pores. Chemical modification of histidines with diethylpyrocarbonate has been shown to reduce the hemolytic activity of alpha-toxin, suggesting that one or more of the histidine residues is important for toxin function. To individually assess the functional importance of each of the four histidine residues (residues 35, 48, 144, and 259), we used oligonucleotide-directed mutagenesis of the cloned alpha-toxin gene to replace each histidine with leucine. The mutant toxins were expressed in S. aureus and evaluated for hemolytic activity in vitro and for lethality in an intraperitoneal murine model. Substitution of histidine 35 with leucine produced a mutant toxin (H35L) without hemolytic or lethal activity. Mutant toxins H48L, H144L, and H259L exhibited 7, 16, and 46%, respectively, of the hemolytic activity of wild-type toxin. Immunoblotting of purified H35L toxin incubated with liposomal ...
Histidine-containing phosphotransfer (HPt) factors from Arabidopsis thaliana, designated as AHPs, function most likely in concert with histidine (His)-kinases (HKs) and response regulators (RRs) in certain multistep histidine (His)→aspartate (Asp) phosphorelays that are involved in the signal transduction mechanisms, by which plant cells appear to respond to certain hormonal stimuli, including cytokinin. Although some previous in vitro results from studies on Arabidopsis AHPs (AHP1 to AHP5) supported this hypothesis, it has not yet been proven. To this end, here we constructed transgenic plants that contained the AHP2 protein in a considerably higher amount than in wild-type plants. Such AHP2-overexpressing young seedlings were examined in comparison with wild-type plants, with special reference to hormone responses; particularly, their inhibitory effects on root elongation of plants grown on agar-plates, and also hypocotyl elongation of etiolated seedlings grown in the dark. The results of ...
Histidine-to-aspartate (His-Asp) phosphorelay (or two-component) systems are very common signal transduction mechanisms that are implicated in a wide variety of cellular responses to environmental stimuli. The His-Asp phosphorelay components include sensor histidine kinase (HK), phosphotransfer intermediate (HPt), and response regulator (RR). With special reference to three bacterial species (Mesorhizobium loti, Bradyrhizobium japonicum, Sinorhizobium meliloti), each of which belongs to a different genera of Rhizobia, here we attempted to compile all of the His-Asp phosphorelay components in order to reveal a comparative genome-wide overview as to the His-Asp phosphorelay. It was revealed that M. loti has 47 HKs, 1 HPts, and 58 RRs; B. japonicum has 80 HKs, 3 HPts, and 91 RRs; whereas S. meliloti has 40 HKs, 1 HPt, and 58 RRs. These His-Asp phosphorelay components were extensively compiled and characterized. The resulting overview as to the His-Asp phosphorelay of Rhizobia will provide us ...
Signaling by kinases and phosphatases that act on serine, threonine, and tyrosine residues of proteins is among the most extensively studied regulatory mechanisms in mammalian cells, and research focused in this area is ongoing. We are just beginning to appreciate that such signaling mechanisms are extended and enriched by the reversible phosphorylation of histidine residues. The most exciting developments in this field to date come from studies on the β subunit of heterotrimeric guanosine triphosphate-binding proteins (G proteins), the enzyme adenosine 5′-triphosphate-citrate lyase, and now the Ca2+-activated K+ channel KCa3.1, all of which are targeted by nucleoside diphosphate kinase (which phosphorylates histidines) and protein histidine phosphatase (which dephosphorylates phosphorylated histidines).. ...
TY - JOUR. T1 - Administration and 1H MRS, detection of histidine in human brain. T2 - Application to in vivo pH measurement. AU - Vermathen, Peter. AU - Capizzano, Aristides A.. AU - Maudsley, Andrew A.. PY - 2000/5/17. Y1 - 2000/5/17. N2 - Measurement of histidine in vivo offers the potential for tissue pH measurement using routinely performed 1H MR spectroscopy. In the brain, however, histidine concentrations are generally too low for reliable measurement. By using oral loading of histidine, this study demonstrates that brain concentrations can be significantly increased, enabling detection of histidine by localized 1H MR measurements and making in vivo pH measurement possible. In studies carried out on healthy human subjects at 1.5 T, a consistent spectral quality downfield from water was achieved using a PRESS sequence at short echo times. Measurements at different TE values helped to characterize the downfield spectral region. Histidine loading of 400 mg/kg of body weight increased brain ...
On 24 Mar 1997, Kathleen Blackwell wrote: , Given a complex nitrogen source with various peptides in solution, would , digesting to various levels of free amino acids lead to a solutions with better , metal chelating properties as the levels of free amino acids rises? My thinking , is that higher levels of free histidine would chelate metals better than , histidine bound in peptides, mostly for steric reasons. Any thought? TIA It might work for most of the cases, but the same steric reasons might enable multiple histidine peptides to bind better. In one of Frances Arnolds papers they are able to show that the His-X-X-X-His arrangement binds the strongest to metal. In short, I think that the answer to your question has to vary depending on the peptide fragment and one cannot always assume that free histidine binds better. My 2 cents worth Rajesh , , , , ************************************ Rajesh Krishnamurthy E-mail: krishnam at Tel: (410) 247-8175 ...
We report here the generation of gas-phase complexes containing Pd(II), a ligand (deprotonated alanine, A-), and/or N-terminus derivatized peptides containing histidine as one of the amino acids. The species were produced by electrospray ionization, and their gas-phase reactions were investigated using ion-trap tandem mass spectrometry. Pd(II) forms a stable diaqua complex in the gas phase of the formula, [Pd(A-) (H(2)O)(2)]+, (where A- = deprotonated alanine) along with ternary complexes containing A- and peptide. The collision-induced dissociation (CID) patterns of the binary and ternary complexes were investigated, and the dissociation patterns for the ternary complexes suggest that: (a) the imidazole ring of the histidine side group may be the intrinsic binding site of the metal ion, and (b) the peptides fragment primarily by cleavage of the amide bond to the C-terminal side of the histidine residues. These observations are in accord with previous solution-state studies in which Pd(II) was ...
Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.
Shop Histidine transport ATP-binding protein ELISA Kit, Recombinant Protein and Histidine transport ATP-binding protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
A group of 28 uraemic patients on dialysis treatment were given daily supplements of histidine by mouth. Plasma amino-acid concentration, plasma iron, serum transferrin, packed cell volume, and reticulocyte count were all measured before and after two months of histidine supplementation. The treatment raised the plasma histidine concentration and at the same time there was a rise in transferrin and iron levels and packed cell volume. Reticulocyte counts fell after two months of histidine supplementation.. ...
Purpose: Alzheimers Disease is a neurodegenerative disease resulting from over-production and neuronal accumulation of amyloid-beta proteins (Aβ40/Aβ42). The glycine residue at position 33 and histidine residues at positions 13 and 14 are involved with binding and internalization of these proteins, actions potentially inhibited by substituting or sterically hindering these residues with an antibody specific to positions 2-11 (IgG-4.1). Rat pheochromocytoma (PC12) cells differentiated with nerve growth factor were used as a neuronal model to determine whether substitution and/or antibody block amyloid-betas neuronal interactions. Methods: PC12 cells were incubated with fluorescein-labeled-amyloid-beta-40 (F-Aβ40) or substituted F-Aβ40 derivatives (F-Aβ40-H13,14G, F-Aβ40-H13,14G;G33A), with or without IgG-4.1. Cells were analyzed by flow cytometry. Results: PC12 cells incubated with F-Aβ40 and IgG-4.1, as well as cells incubated with substituted peptides, exhibit decreased mean fluorescence
Pseudobiospecific ligand l-histidine is an inexpensive, highly stable, non-toxic ligand explored successfully over the last twenty years for the purification of immunoglobulins in immobilised histidine ligand affinity chromatography. It is of great interest to know the molecular recognition sites of IgG to immobilized l-histidine. Here, we have used an in silico approach to explore the molecular recognition of l-histidine by IgG. We have assessed the feasible binding modes of histidine and its moieties at different sites of IgG and considered only those binding conformations which are exhibited via the imidazole ring NH group or any other OH donating group apart from the ones which are terminally conjugated with the support matrix. We categorised binding site into two categories; category I: inner binding groove and category II: surface binding groove and observed that the hinge region of IgG has most favourable binding pocket for l-histidine and histidyl moieties. Ser and Tyr residues on the hinge
Sigma-Aldrich offers abstracts and full-text articles by [Vennela Mullangi, Xiang Zhou, David W Ball, David J Anderson, Masaru Miyagi].
Two-component systems consisting of histidine kinases and their corresponding receivers are widespread in bacterial signal transduction. In the past few years, genes coding for homologues of two-component systems were also discovered in eukaryotic organisms. DokA, a homologue of bacterial histidine kinases, is an element of the osmoregulatory pathway in the amoeba Dictyostelium. The work described here addresses the question whether DokA is phosphorylated in vivo in response to osmotic stress. We have endogenously overexpressed individual domains of DokA to investigate post-translational modification of the protein in response to osmotic shock in vivo. Dictyostelium cells were labeled with [32P]-orthophosphate, exposed to osmotic stress and DokA fragments were subsequently isolated by immunoprecipitation. Thus, a stress-dependent phosphorylation could be demonstrated, with the site of phosphorylation being located in the kinase domain. We demonstrate biochemically that the phosphorylated amino acid is
Kosher Histidine - Buy discounted Kosher Histidine and other Kosher Amino Acids at In our Kosher Amino Acids section you will find . Buy discount brand name Kosher Histidine vitamins, supplements, pills, capsules, softgels and tablets. Find natural, herbal, organic and healthy Kosher Histidine products.
The voltage-sensitive phosphoinositide phosphatases provide a mechanism to couple changes in the transmembrane electrical potential to intracellular signal transduction pathways. These proteins share a domain architecture that is conserved in deuterostomes. However, gene duplication events in primates, including humans, give rise to the paralogs TPTE and TPTE2 that retain protein domain organization but, in the case of TPTE, have lost catalytic activity. Here, we present evidence that these human proteins contain a functional voltage sensor, similar to that in nonmammalian orthologs. However, domains of these human proteins can also generate a noninactivating outward current that is not observed in zebra fish or tunicate orthologs. This outward current has the anticipated characteristics of a voltage-sensitive proton current and is due to the appearance of a single histidine residue in the S4 transmembrane segment of the voltage sensor. Histidine is observed at this position only during the ...
A strategy for rational enzyme design is reported and illustrated by the engineering of a protein catalyst for thiol-ester hydrolysis. Five mutants of human glutathione (GSH; gamma-Glu-Cys-Gly) transferase A1-1 were designed in the search for a catalyst and to provide a set of proteins from which the reaction mechanism could be elucidated. The single mutant A216H catalyzed the hydrolysis of the S-benzoyl ester of GSH under turnover conditions with a k(cat)/K(M) of 156 M(-1) x min(-1), and a catalytic proficiency of ,10(7) M(-1) when compared with the first-order rate constant of the uncatalyzed reaction. The wild-type enzyme did not hydrolyze the substrate, and thus, the introduction of a single histidine residue transformed the wild-type enzyme into a turnover system for thiol-ester hydrolysis. By kinetic analysis of single, double, and triple mutants, as well as from studies of reaction products, it was established that the enzyme A216H catalyzes the hydrolysis of the thiol-ester substrate by ...
View Notes - Bio 15 from BIOL 101 at UPenn. 1) Histidine, Glycine, Histidine, Leucine, Tyrosine 2) Transcription starts at binding sites called promoters on the DNA template strand, as opposed to the
Gentaur molecular products has all kinds of products like :search , Prospecbio \ Mouse Anti Polyhistidine Tag His tag \ ant-227 for more molecular products just contact us
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Our journals promote pharmacology in all its forms by disseminating the latest high quality research in our peer reviewed scientific journals.
TY - JOUR. T1 - Hydrolysis catalyzed with a resin containing histidine groups. AU - Hung, Wei Hsiu. AU - Hu, Cho Chun. AU - Liu, Chuen Ying. PY - 1996/1/1. Y1 - 1996/1/1. N2 - A histidine-containing polymer was synthesized in which the amino group of the histidine was attached chemically via an azide coupling method to the carboxylic acid of Amberlite IRC-50. The resultant polymer was applied as a catalyst for hydrolysis of p-nitrophenyl acetate (PNPA). PNPA in aqueous solution was hydrolyzed at 25°C with a phosphate buffer (pH 7.8). The observed kinetics obeyed Michaelis-Menten kinetics. The reaction rates at various temperature were measured. The activation parameters, preexponential factor (A) and activation energy (Ea), were 6.64 × 10-4 min-1 and 37.5 kJ mol-1 respectively. At a pH of the medium greater than 7.8, the reaction rate remained almost constant (kobs = 0.024 min-1) and seemed to be controlled by the rate of diffusion of PNPA from the bulk solution into the catalytically active ...
Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The family includes urease alpha, adenosine deaminase, phosphotriesterase dihydroorotases, allantoinases, hydantoinases, AMP-, adenine and cytosine deaminases, imidazolonepropionase, aryldialkylphosphatase, chlorohydrolases, formylmethanofuran dehydrogenases and others. ...
5.B.1 The gp91phox Phagocyte NADPH Oxidase-associated Cytochrome b558 (Phox) Family The human phagocyte cytochrome b558 is a heterodimeric complex consisting of a heavy (β) chain (gp91phox) and a light (α) chain (p22phox) as well as several auxiliary subunits (Geisz and Leto, 2004). The β-chain is a glycoprotein of 570 amino acyl residues called gp91phox, the product of the X-linked chronic granulomatous disease gene. The protein bears (1) the heme-binding site in its N-terminal 280 residues, and (2) an FAD binding site (residues 338-344) as part of the C-terminal NADPH oxidase domain. The N-terminal domain has 6 putative transmembrane spanners (TMSs) and is the cytochrome binding site. It has been reported to catalyze efflux of protons through an H+ channel that acts as a charge compensation pathway for the electrogenic generation of the superoxide radical, O2&149;-. The proposal that (gp91phox) has H+ channel activity has been effectively disputed and is now in doubt (DeCoursey 2003; ...
Complete information for DPH3P1 gene (Protein Coding), Diphthamide Biosynthesis 3 Pseudogene 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Shop Histidine kinase ELISA Kit, Recombinant Protein and Histidine kinase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Histidine list and information including what is Histidine, health benefits and usage indications. Find articles and product list for other top low-carb products, fat-burners, nutrition bars and shakes.
Histidine list and information including what is Histidine, health benefits and usage indications. Find articles and product list for other top low-carb products, fat-burners, nutrition bars and shakes.
[128 Pages Report] Check for Discount on Global Histidine Sales Market Report 2020 report by QYResearch Group. This report studies sales (consumption) of Histidine in Global market,...
Posted by guillo from IP on March 25, 2013 at 17:22:23:. Though Arginine and Histidine are syntethized inssufitiently in the organism, should we consider them ...
Product Number , 33782677. CAS Number , 351-50-8. EC , 206-513-8. Molecular Formula , C6H9N3O2. Molecular Weight , 155.16. Storage Temp , Harmonized Tariff code , 29332990. Signal Word , ...
L-histidine 71-00-1 MSDS report, L-histidine MSDS safety technical specifications search, L-histidine safety information specifications ect.
Phosphoryl transfer between the PTS components is thought to proceed by nucleophilic attack of the active histidine residue on the phospho-histidine of the target protein ...
Jim ,ash_mountain at, wrote in message news:b83c549.0201240704.3268435c at , post-translational modifications such as phosphorylation cannot be the , problem here as you are expressing in E. coli!! Proteolysis seems Yes they can. There are several examples of E.coli post-translational modifications :) Theyre not very common, but they DO happen. Examples include: histidine phosphorylation, biotinylation, and mysterious carbohydrate addition to the N-terminus (I have read a paper describing this recently, but I forgot which journal it was in, so one would have to look it up if ones interested). Artem ...
CP001630.PE64 Location/Qualifiers FT CDS_pept 73786..75072 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Amir_0064 FT /product=signal transduction histidine kinase, LytS FT /note=PFAM: histidine kinase internal region; ATP-binding FT region ATPase domain protein; SMART: ATP-binding region FT ATPase domain protein; KEGG: signal transduction histidine FT kinase, LytS; K07704 two-component system, LytT family, FT sensor histidine kinase LytS FT /db_xref=EnsemblGenomes-Gn:Amir_0064 FT /db_xref=EnsemblGenomes-Tr:ACU34038 FT /db_xref=GOA:C6WDP3 FT /db_xref=InterPro:IPR003594 FT /db_xref=InterPro:IPR010559 FT /db_xref=InterPro:IPR036890 FT /db_xref=UniProtKB/TrEMBL:C6WDP3 FT /inference=protein motif:PFAM:PF06580 FT /protein_id=ACU34038.1 FT /translation=MPGARRPHSMDGVRDLLTERAVLGVIATLAVLGLFVMLCRARRVS FT TSVEDAVMDMLHRMSKASADLREGLTAEAADKATPHLREMLRCVAVGITDSTGSVLSWD FT GGAADHYELMRGHIEQAIREVHKEHVEHRKLDCDLSGPCPMHSAVIVPLIVESEVAGTL FT ...
Background Among the 20 natural amino acids histidine is the most active and versatile member that plays the multiple roles in protein interactions, often the key residue in enzyme catalytic...
This sequence change replaces arginine with histidine at codon 306 of the CTC1 protein (p.Arg306His). The arginine residue is weakly conserved and there is a small physicochemical difference between arginine and histidine. This variant is present in population databases (rs567779457, ExAC 0.01%). This variant has not been reported in the literature in individuals with CTC1-related disease. Algorithms developed to predict the effect of missense changes on protein structure and function output the following: SIFT: Tolerated; PolyPhen-2: Benign; Align-GVGD: Class C0. The histidine amino acid residue is found in multiple mammalian species, suggesting that this missense change does not adversely affect protein function. These predictions have not been confirmed by published functional studies and their clinical significance is uncertain. In summary, the available evidence is currently insufficient to determine the role of this variant in disease. Therefore, it has been classified as a Variant ...
This sequence change replaces arginine with histidine at codon 460 of the CTC1 protein (p.Arg460His). The arginine residue is moderately conserved and there is a small physicochemical difference between arginine and histidine. This variant is present in population databases (rs200619397, ExAC 0.09%). This variant has not been reported in the literature in individuals with CTC1-related conditions. Algorithms developed to predict the effect of missense changes on protein structure and function output the following: SIFT: Tolerated; PolyPhen-2: Benign; Align-GVGD: Class C0. The histidine amino acid residue is found in multiple mammalian species, suggesting that this missense change does not adversely affect protein function. These predictions have not been confirmed by published functional studies and their clinical significance is uncertain. In summary, the available evidence is currently insufficient to determine the role of this variant in disease. Therefore, it has been classified as a ...
HIS-Select products from Sigma Life Science have the ability to purify histidine-tagged proteins quickly and with high selectivity. This is due to HIS-Select′s patented, non-charged, hydrophilic nickel chelate linkage. This non-charged linkage greatly diminishes non-specific binding.
You are viewing an interactive 3D depiction of the molecule n-[2-({(1s)-1-carboxy-4-[(diaminomethylene)amino]butyl}amino)ethyl]-l-histidine (C14H25N7O4) from the PQR.
L-Histidine Reviews and other Reviews of Nutritional Supplements and Merchants Plus Related Resources Including a 2017 Buying Guide. Healthy Learning for Healthy Living.
Recombinant Human ICAM1 extracellular domain (Met 1-Glu 480) (NP_000192.2), fused with a polyhistidine tag at the C-terminus, was produced in Human Cell.
Recombinant Human EFNB1 extracellular domain (Met 1-Gly 232) (NP_004420.1), fused with a polyhistidine tag at the C-terminus, was produced in Human Cell.
I? This semi-essential amino acid BENEFITS skin, immune system, blood and cell regeneration. Read about functions and studies about Histidine here?
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
Amino acids at deep discount. Save up to 75%. Pure, USA, l-carnitine, l-taurine, creatine, factory direct at below wholesale cost.
Myoglobin is a globular protein and consists of eight α-helixes in its secondary structure. Myoglobin is a protein composed of a single polypeptide chain build by 153 amino acids. The polypeptide chain is bound to a heme molecule which represents the prosthetic group of myoglobin. The heme is bound to a histidine residue at position 93 (His93 or His-F8) within the N-terminal end of the myoglobin polypeptide. If oxygen is bound to heme, the distal histidine at position 64 (called His64 or His-E7) contributes to the stabilization of the oxygen which binds to iron (Fe2+) within the heme structure. ...
TY - JOUR. T1 - Serine protease acylation proceeds with a subtle re-orientation of the histidine ring at the tetrahedral intermediate. AU - Zhou, Yanzi. AU - Zhang, Yingkai. PY - 2011/2/7. Y1 - 2011/2/7. N2 - The acylation mechanism of a prototypical serine protease trypsin and its complete free energy reaction profile have been determined by Born-Oppenheimer ab initio QM/MM molecular dynamics simulations with umbrella sampling.. AB - The acylation mechanism of a prototypical serine protease trypsin and its complete free energy reaction profile have been determined by Born-Oppenheimer ab initio QM/MM molecular dynamics simulations with umbrella sampling.. UR - UR - U2 - 10.1039/c0cc04112b. DO - 10.1039/c0cc04112b. M3 - Article. C2 - 21116528. AN - SCOPUS:78751489563. VL - 47. SP - 1577. EP - 1579. JO - Chemical Communications. JF - Chemical ...
TY - JOUR. T1 - Identification of novel bacterial histidine biosynthesis inhibitors using docking, ensemble rescoring, and whole-cell assays. AU - Henriksen,Signe Teuber. AU - Liu,J.. AU - Estiu,G.. AU - Oltvai,Z.N.. AU - Wiest,O.. PY - 2010. Y1 - 2010. N2 - The rapid spread on multidrug-resistant strains of Staphylococcus aureus requires not just novel treatment options, but the development of faster methods for the identification of new hits for drug development. The exponentially increasing speed of computational methods makes a more extensive use in the early stages of drug discovery attractive if sufficient accuracy can be achieved. Computational target identification using systems-level methods suggested the histidine biosynthesis pathway as an attractive target against S. aureus. Potential inhibitors for the pathway were identified through docking, followed by ensemble rescoring, that is sufficiently accurate to justify immediate testing of the identified compounds by whole-cell assays, ...
Two absolutely conserved histidines and a third highly conserved histidine are noted in 11 bacterial and plant ADP-glucose pyrophosphorylases. These histidines were individually mutagenized in the E. coli enzyme to glutamine in order to determine their function. Glutamine mutations at residues 143 and 156 produced functional enzymes in cell extracts with slightly lower than wild-type specific catalytic activities and with same heat stability characteristics of the wild-type enzyme. Substitution of residue 83 with glutamine however produced an enzyme having decreased thermal stability. Additional mutageneses at residue 83 with asparagine, arginine, or aspartate gave rise to enzymes having a progressively decreasing trend in thermal stability. These mutants are more susceptible to proteolysis than wild-type enzyme. Kinetic analysis of H83Q and H83N indicates that histidine 83 is not involved in the catalytic mechanism or in substrate binding but possibly in maintenance of the active catalytic structure.
Bovine complex I is an assembly of 46 different proteins. Seven of them are encoded in mitochondrial DNA, and the rest are nuclear gene products that are imported into the organelle. Fourteen of the nuclear encoded subunits have modified N termini. Many of these post-translational modifications have been deduced previously from intact protein masses. These assignments have been verified by mass spectrometric analysis of peptides. Thirteen of them are N-alpha-acetylated, and a 14th, subunit B18, is N-alpha-myristoylated. Subunit B18 forms part of the membrane arm of the complex, and the myristoyl group may attach subunit B18 to the membrane. One subunit, B12, has a particularly complex pattern of post-translational modification that has not been analyzed before. It is a mixture of the N-alpha-acetylated form and the form with a free N terminus. In addition, it has one, two, or three methyl groups attached to histidine residues at positions 4, 6, and 8 in various combinations. The predominant form ...
The Cu2+-nitrilotriacetic acid complex improves loading of ?-helical double histidine site for precise distance measurements by pulsed ESR Publication
Genes for histidyl-aspartyl (His-Asp) phosphorelay components (His-containing phosphotransfer proteins, HP, and response regulators, RR) were isolated from Zea mays L. to characterize their function in cytokinin signaling. Six type-A RRs (ZmRR1, ZmRR2, ZmRR4-ZmRR7), 3 type-B RRs (ZmRR8-ZmRR10), and …
Get information, facts, and pictures about histidine at Make research projects and school reports about histidine easy with credible articles from our FREE, online encyclopedia and dictionary.
Histidine is one of the 20 most common natural amino acids, coded for in DNA. Nutritionally, in humans, histidine is considered an essential amino acid, but only in children. The nitrogen side chains of histidine and the relatively neutral pK (ca 6.0) of the histine proton mean that this amino acid side chain finds its way into considerable use as a coordinating ligand in metalloproteins, and also as a catalytic site in certain enzymes.. The amino acid is a precursor for histamine biosynthesis.. ...
The study report titled Global Histidine Market offers an in-depth analysis of this market across the globe. The study, aimed at providing current and prospect players in this market sharp insights to gain the advantage over their competitors. The report does so by providing an executive summary including all valuable market figures and exploring the favorable factors that are expected to drive the growth rate of the market, besides taking account of the restraining factors.. Questions that the report answers with regards to the competitive hierarchy of the Histidine market:. =,As per the Histidine report, which are the firms that fall under the competitive landscape of the industry in question.. =,Which among these contenders - Kyowa Hakko Bio, Ajinomoto, KingYork Group, Huaheng Biologgical, Shine Star Biological Engineering is most likely to evolve as the most profitable investment hub of this market.. =,How much market share does each of these companies accrue in the industry.. =,What are the ...
TY - JOUR. T1 - Hydrolysis catalyzed with a resin containing histidine groups. AU - Hung, Wei Hsiu. AU - Hu, Cho Chun. AU - Liu, Chuen Ying. N1 - Funding Information: We thank the National Science Council of the Republic of China for financial support. Copyright: Copyright 2017 Elsevier B.V., All rights reserved.. PY - 1996/10/10. Y1 - 1996/10/10. N2 - A histidine-containing polymer was synthesized in which the amino group of the histidine was attached chemically via an azide coupling method to the carboxylic acid of Amberlite IRC-50. The resultant polymer was applied as a catalyst for hydrolysis of p-nitrophenyl acetate (PNPA). PNPA in aqueous solution was hydrolyzed at 25°C with a phosphate buffer (pH 7.8). The observed kinetics obey those of Michaelis-Menten. The reaction rates at various temperatures were measured. The activation parameters, pre- exponential factor (A) and activation energy (E(a)), were 6.64 x 10-4 min- 1 and 37.5 kJ mol-1 respectively. At a pH of the medium greater than ...
Despite its importance in central metabolism and bacterial cell signaling, protein histidine phosphorylation has remained elusive with respect to its extent and functional roles in biological systems due to the lack of adequate research tools. to nitrogen availability and that -ketoglutarate (-KG) inhibits phosphotransfer from phosphorylated phosphoenolpyruvate synthase SRT3109 (PpsA) to pyruvate. We expect this antibody to open opportunities for investigating other pHis-proteins and their functions. INTRODUCTION Protein phosphorylation is a central player in the regulation of cellular processes.1 Although this class of posttranslational modification (PTM) is known to occur on several amino acids, the available biochemical, pharmacological and proteomic tools for studying the modification are best developed in the context of Ser, Thr and Tyr phosphorylation.2 By contrast, there is a dearth of such tools for studying other protein phosphorylation events, a situation which has greatly hindered our ...
WDR85 Full-Length MS Protein Standard (NP_620133), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis (Carette et al., 2009 )
Histidine-rich glycoprotein (HRG)is a glycoprotein that in humans is encoded by the HRG gene. The HRG protein is produced in the liver, and it could also be synthesized by monocytes, macrophages, and megakaryocytes. It possesses a multi-domain structure, which makes it capable of binding to numerous ligands and modulating various biological processes including immunity, vascularization and coagulation. The HRG gene lies on location of 3q27 on the chromosome 3, spans approximately 11kb, and consist of 7 exons. Two common isoforms of the HRG gene have been found in humans. These isoforms exist due to a polymorphism occurring in exon 5. HRG is a glycoprotein of 70-75kDa present at a relatively high concentration in the plasma of vertebrates. The primary structure of human HRG is predicted to be a 507 amino acid multidomain polypeptide consisting of two cystatin-like regions at the N-terminus, a histidine-rich region (HRR) flanked by proline-rich regions (PRR), and a C-terminal domain. HRG has an ...
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
United States Histidine Market by Manufacturers, States, Type and Application, Forecast to 2022 United States Histidine Market by Manufacturers, States, Type and Application, Forecast to - Market research report and industry analysis - 10946302
The pharmacokinetics of L-histidine in humans has been investigated to evaluate the in vivo histidine ammonia lyase system for the conversion of L-histidine to urocanic acid. Two healthy volunteers (subjects A and B) received a single 100-mg oral dose of L-[3,3-2H2,1,3-15N2]histidine. Blood and urine samples were obtained over 24 hr after the administration and analyzed by stable isotope dilution ms. Labeled L-histidine was rapidly absorbed, and a maximum plasma concentration of L-histidine was observed at 30 min (1057.6 ng/ml) in subject A and at 60 min (1635.6 ng/ml) in subject B after oral administration. Pharmacokinetic parameters were calculated based on a two-compartment model. Labeled L-histidine in subject A (t1/2 = 1.0 hr) was eliminated approximately twice faster than that in subject B (t1/2 = 1.9 hr). Total body clearances were 70.0 liters/hr in subject A and 30.0 liters/hr in subject B. The low ratios of the renal clearance to the total body clearance (1.04% for subject A and 0.43% ...
The two-component system is involved in several developmental events and different responses to the environment. Histidine-containing phosphotransfer prote
Han, J H. and Harding, J D., Isolation and nucelotide sequence of a mouse histidine trna gene. (1982). Subject Strain Bibliography 1982. 4165 ...
1OPD: Mutation of serine-46 to aspartate in the histidine-containing protein of Escherichia coli mimics the inactivation by phosphorylation of serine-46 in HPrs from gram-positive bacteria.
The wealth of newly obtained proteomic information affords researchers the possibility of searching for proteins of a given structure or function. Here we describe a general method for the detection of a protein domain of interest in any species for which a complete proteome exists. In particular, we apply this approach to identify histidine phosphotransfer (HPt) domain-containing proteins across a range of eukaryotic species. From the sequences of known HPt domains, we created an amino acid occurrence matrix which we then used to define a conserved, probabilistic motif. Examination of various organisms either known to contain (plant and fungal species) or believed to lack (mammals) HPt domains established criteria by which new HPt candidates were identified and ranked. Search results using a probabilistic motif matrix compare favorably with data to be found in several commonly used protein structure/function databases: our method identified all known HPt proteins in the Arabidopsis thaliana ...
This entry represents the active-site-containing domain found in the trypsin family members. The catalytic activity of the serine proteases from the trypsin family is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which itself is hydrogen-bonded to a serine. The sequences in the vicinity of the active site serine and histidine residues are well conserved in this family of proteases [ (PUBMED:3136396) ]. A partial list of proteases known to belong to the trypsin family is shown below. ...
This entry represents the active-site-containing domain found in the trypsin family members. The catalytic activity of the serine proteases from the trypsin family is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which itself is hydrogen-bonded to a serine. The sequences in the vicinity of the active site serine and histidine residues are well conserved in this family of proteases [ (PUBMED:3136396) ]. A partial list of proteases known to belong to the trypsin family is shown below. ...
Authors: Julia, Georgescu; Burkhard, Bechinger. Citation: Georgescu, Julia; Bechinger, Burkhard. NMR structures of the histidine-rich peptide LAH4 in micellar environments: membrane insertion, pH-dependent mode of antimicrobial action and DNA transfection Biophysical J. ., .-... Assembly members: ...
Histidine is an essential amino acid that is significant in the growth and repair of tissues. It is important for the maintenance of the myelin sheaths that protect nerve cells.....
We have some questions concerning this process, namely it is how the histadine tags are interacting with the Ni-agarose and the casein that we use to passivate the flow cells. We know that histidine has an affinity to interact with cysteine, another amino acid, that is prevalent on the structure of the kappa-casein. We would like to know how they interact, and if that is the key for why kappa-casein is so effective as as a coating for the flow cells. Another thing that we are interested in is how the histidine tag interacts with the nickel in the Ni-agarose. We know that it interacts, it is a crucial step in the collection of kinesin, but exactly how it interacts is a currently a mystery. If we can understand that more clearly, we could use this knowledge to advance our understanding of the questions centered on the kappa-casein. One idea is that we can convert the histidine tag into a protected group that will not interact with anything and then proceed with the usual gliding motility assays to ...
Exposure of proteins to visible light in the presence of a sensitizer results in the oxidation of Met, Trp, Tyr, Cys, and His side chains. These reactions are only partially understood, particularly with His. In this study, the oxidation of free His, His derivatives, and His-containing peptides has been examined using visible light and a range of sensitizers. It is shown that photooxidation gives rise to unstable peroxides, in a light-, illumination time-, and sensitizer-dependent manner. The yield of these materials is increased when reactions are carried out in solutions prepared with D2O, which prolongs the lifetime of 1O2, and decreased in the presence of the potent 1O2 scavenger azide, consistent with the involvement of this excited state. These peroxides have half-lives of hours, though the rate of decomposition is enhanced by elevated temperatures, reductants, and metal ions. Reducing metal ions catalyze the formation of radicals, which have been detected by EPR spin trapping. Structural ...
A molecular model of histidine, an essential amino acid that is a precursor to histamine, a compound involved in the inflammatory response of the immune system. Atoms are coloured dark grey (carbon), light grey (hydrogen), red (oxygen) and blue (nitrogen). - Stock Image C017/6246
Click to know about the uses, price, consumption and side effects of HealthVit L- Histidine 500mg Capsule. Consult with top doctors online on mfine to know more
Imidazoleglycerol-phosphate dehydratase, catalyzes the sixth step in histidine biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts; transcription is regulated by general amino acid control via ...
Histidine is an essential amino acid. L-Histidine, specifically, cannot be formed by other nutrients and must be present within ones diet.. ...
Question - 10 months old, regularly constipated, skin tag on the bottom due to this. Advice ?. Ask a Doctor about uses, dosages and side-effects of Lactulose, Ask a Gastroenterologist
MODx: img tag on steroids... :) - @pepebe shared this Cacher snippet. Cacher is the code snippet organizer that empowers professional developers and their teams to get more coding done, faster.