I. Synthetic Bacterial Lipopolysaccharide Core Structures as Vaccine Candidates against Chlamydia trachomatis and Yersinia...
Author: Guo, X. Q.; Genre: Thesis; Title: I. Synthetic Bacterial Lipopolysaccharide Core Structures|br/|as Vaccine Candidates against Chlamydia trachomatis and Yersinia pestis II. Synthesis of a Fungal Galectin Epitope Trisaccharide and the HNK-1 Epitope Trisaccharide
Role of capsular modified heptose in the virulence of Campylobacter jejuni.
The Campylobacter jejuni capsular polysaccharide is important for virulence and often contains a modified heptose. In strain ATCC 700819 (a.k.a. NCTC 11168), the modified heptose branches off from the capsular backbone and is directly exposed to the environment. We reported previously that the enzymes encoded by wcaG, mlghB and mlghC are involved in heptose modification. Here, we show that inactivation of any of these genes leads to production of capsule lacking modified heptose and alters the transcription of other capsule modification genes differentially. Inactivation of mlghB or mlghC, but not of wcaG, decreased susceptibility to bile salts and abrogated invasion of intestinal cells. All mutants showed increased sensitivity to serum killing, especially wcaG::cat, and had defects in colonization and persistence in chicken intestine, but did not show significant differences in adhesion, phagocytosis and intracellular survival in murine macrophages. Together, our findings suggest that the capsular
PROSITE
ADOK_MYCTO (P9WID4 ), ADOK_MYCTU (P9WID5 ), FRUK_MYCGE (Q49396 ), FRUK_MYCPN (P75038 ), HEPPK_BORBR (Q7WGU8 ), HLDE_ACICJ (A5FVE7 ), HLDE_ACTP2 (A3MZC0 ), HLDE_ACTPL (Q8GLU7 ), HLDE_ACTSZ (A6VP06 ), HLDE_AERHH (A0KPL4 ), HLDE_AERS4 (A4SIG6 ), HLDE_ALCBS (Q0VM60 ), HLDE_ALISL (B6ELZ7 ), HLDE_ALKEH (Q0A4T7 ), HLDE_ARCB4 (A8EVR4 ), HLDE_AZOVD (C1DGT9 ), HLDE_BLOFL (Q7VQQ6 ), HLDE_BLOPB (Q493X3 ), HLDE_BRASB (A5EN78 ), HLDE_BRASO (A4YYB6 ), HLDE_CAMC1 (A7ZE26 ), HLDE_CAMC5 (A7GZF6 ), HLDE_CAMFF (A0RQR9 ), HLDE_CAMJ8 (A8FMK8 ), HLDE_CAMJD (A7H2L7 ), HLDE_CAMJE (Q6TG09 ), HLDE_CAMJJ (A1W0D6 ), HLDE_CAMJR (Q5HTW1 ), HLDE_CAUCR (Q9A2C5 ), HLDE_CAUSK (B0T663 ), HLDE_CHRSD (Q1R1M6 ), HLDE_CITK8 (A8APT1 ), HLDE_COXBN (A9KDJ2 ), HLDE_COXBR (A9N9S2 ), HLDE_COXBU (Q83B60 ), HLDE_CROS8 (A7MP93 ), HLDE_DESAA (B8FB71 ), HLDE_DICNV (A5EWS4 ), HLDE_ECO24 (A7ZRT3 ), HLDE_ECO27 (B7UIW0 ), HLDE_ECO45 (B7MAC8 ), HLDE_ECO55 (B7LGY7 ), HLDE_ECO57 (Q7AAQ7 ), HLDE_ECO5E (B5YR91 ), HLDE_ECO7I (B7NJR5 ), HLDE_ECO81 (B7N0K1 ...
ADP-L-glycero-D-manno-heptose (CHEBI:15915)
Chemical Entities of Biological Interest (ChEBI) is a freely available dictionary of molecular entities focused on small chemical compounds.
ADP-L-glycero-D-manno-heptose (CHEBI:15915)
Chemical Entities of Biological Interest (ChEBI) is a freely available dictionary of molecular entities focused on small chemical compounds.
cMET - Abl Family Kinases Regulate Endothelial Barrier Function
An efficient one-pot three enzymes technique for chemoenzymatic synthesis of ADP-D-glycero-D-manno-heptose (ADP-D, D-heptose) was reported using chemically synthesized D, D-heptose-7-phosphate as well as the ADP-D, D-heptose biosynthetic enzymes GmhB and HldE. acid solution (Kdo) and D, L or D-heptose, D-heptose (Amount 1).1, 2 The biosynthesis from the Navarixin nucleotide activated heptose precursors for set up of LPS continues to be extensively studied.1 These nucleotide turned on heptoses mainly consist of ADP-D-glycero-D-manno-heptose (ADP-D, D-heptose), ADP-L-glycero-D-manno-heptose (ADP-L, D-heptose), and a much less common GDP-D-glycero-D-manno-heptopyranose (GDP-D, D-heptose).8 GDP-D, D-heptose continues to be defined in bakers fungus and defined as the substrate for the bacterial glycosyltransferase mixed up in assembly from the S-layer glycoprotein glycan in and mutants.10, 11 Heptosyltransferases from can acknowledge ADP-D, D-heptose and ADP-L, D-heptose simply because substrates for ...
A1TYR4 | hldE | Bifunctional protein HldE | Druggability | Cancer
casSAR Dugability of A1TYR4 | hldE | Bifunctional protein HldE - Also known as HLDE_MARHV, hldE. Catalyzes the phosphorylation of D-glycero-D-manno-heptose 7-phosphate at the C-1 position to selectively form D-glycero-beta-D-manno-heptose-1,7-bisphosphate., Catalyzes the ADP transfer from ATP to D-glycero-beta-D-manno-heptose 1-phosphate, yielding ADP-D-glycero-beta-D-manno-heptose. Homodimer.
Chemical Synthesis of d -glycero- d -manno-Heptose 1,7-Bisphosphate and Evaluation of Its Ability to Modulate NF-κB Activation<...
TY - JOUR. T1 - Chemical Synthesis of d -glycero- d -manno-Heptose 1,7-Bisphosphate and Evaluation of Its Ability to Modulate NF-κB Activation. AU - Inuki, Shinsuke. AU - Aiba, Toshihiko. AU - Kawakami, Shota. AU - Akiyama, Taishin. AU - Inoue, Jun Ichiro. AU - Fujimoto, Yukari. N1 - Funding Information: This research was financially supported by grants from the Grant-in-Aid for Scientific Research (Nos. JP26282211, JP26882036 JP16H01162, and JP16K16638), the Mizutani Foundation for Glycoscience and the Nagase Science Technology Foundation and Protein Research Foundation. We thank Prof. K. Suenaga (Keio University) for assistance in measuring the chiroptical data.. PY - 2017/6/16. Y1 - 2017/6/16. N2 - D-glycero-d-manno-Heptose 1,7-bisphosphate (HBP) is the precursor for heptose residues found in Gram-negative bacterial membrane surface glycoproteins and glycolipids. HBP β-anomer was recently reported to be a pathogen-associated molecular pattern (PAMP) that regulates TIFA-dependent immunity. ...
rfaQ - Lipopolysaccharide core heptosyltransferase RfaQ - Escherichia coli (strain K12) - rfaQ gene & protein
Catalyzes heptose transfer to the lipopolysaccharide core. It transfers a heptose, called heptose(III), to the heptose(II) of the inner core (By similarity).
hldE - Bifunctional protein HldE - Escherichia coli (strain K12) - hldE gene & protein
Catalyzes the phosphorylation of D-glycero-D-manno-heptose 7-phosphate at the C-1 position to selectively form D-glycero-beta-D-manno-heptose-1,7-bisphosphate.
Calcium adsorption and displacement: characterization of lipid monolayers and their interaction with membrane-active peptides...
Snyder et al. [29] concluded from electron density profiles of LPS R60 that its charges are located mainly in two distinct planes which are separated by a distance of 1.1 nm. The outer charged plane corresponds to the negatively charged phosphate groups linked to the heptoses in the core region of the LPS, the inner charged plane to the phosphate groups of the lipid A moiety. Using this model, we calculated the surface potential profiles of aggregates composed of those LPS having heptoses substituted with significant numbers of phosphate groups (LPS Rz, LPS R345, LPS R60) as superpositions of the Gouy-Chapman potential profiles ΨI and ΨO for the inner and the outer plane, respectively:. (Eq.1)ΨGC(x) = ΨI exp (- κ x) + ΨO exp (- κ (x - 1.1 nm)) for x ≥ 1.1 nm. where x is the distance from the inner charged plane and κ is the reciprocal Debye- length [27].. ΨGC at the plane of shear corresponds to the ζ-potential. Using Eq. 1, the distance of the plane of shear d2 can be calculated ...
Lipopolysaccharide core structures and their correlation with genetic groupings of Shigella strains. A novel core variant in...
Lipopolysaccharide core structures and their correlation with genetic groupings of Shigella strains. A novel core variant in Shigella boydii type 16
Mannoheptulose - Wikipedia
Mannoheptulose is a hexokinase inhibitor. It is a heptose, a monosaccharide with seven carbon atoms. By blocking the enzyme hexokinase, it prevents glucose phosphorylation. As a result, the breakdown of glucose is inhibited. It is found as D-mannoheptulose in avocados. Mannoheptulose has been reported to inhibit insulin secretion from pancreas. This inhibition occurs because when mannoheptulose is present the glycolysis is inhibited (because there is no production of glucose-6-P) therefore no increase in ATP concentration which is required to close the KATP channel in the beta cells of the pancreas causing a diminution of calcium entry and insulin secretion. Because of its inhibition of glycolysis in vitro, it has been investigated as a novel nutraceuticals for weight management for dogs. However, while mannoheptulose is suggested to affect the energy balance of adult dogs, independent of dosage and physical activity, research disagrees whether it significantly alters energy expenditure in dogs. ...
Heptose - Wikipedia
A heptose is a monosaccharide with seven carbon atoms. They have either an aldehyde functional group in position 1 (aldoheptoses) or a ketone functional group in position 2 (ketoheptoses). There are few examples of C-7 sugars in nature, among which are: Sedoheptulose or D-altro-heptulose (a ketose), an early intermediate in lipid A biosynthesis Mannoheptulose, found in avocados L-glycero-D-manno-heptose (an aldose), a late intermediate in lipid A biosynthesis. Ketoheptoses have 4 chiral centers, whereas aldoheptoses have 5 ...
A0A5I2Q5J0 | SWISS-MODEL Repository
SWISS-MODEL Repository entry for A0A5I2Q5J0 (A0A5I2Q5J0_SALET), Lipopolysaccharide core heptose(II)-phosphate phosphatase. Salmonella enterica subsp enterica serovar Cotham
EMBL: CP000124.RFAE
CP000124.RFAE Location/Qualifiers FT CDS_pept 620827..621312 FT /codon_start=1 FT /transl_table=11 FT /gene=rfaE FT /locus_tag=BURPS1710b_0607 FT /product=rfaE bifunctional protein, domain II FT /EC_number=2.7.7.- FT /note=identified by match to protein family HMM PF01467; FT match to protein family HMM TIGR00125; match to protein FT family HMM TIGR02199 FT /db_xref=EnsemblGenomes-Gn:BURPS1710b_0607 FT /db_xref=EnsemblGenomes-Tr:ABA50187 FT /db_xref=GOA:Q3JWN2 FT /db_xref=InterPro:IPR004821 FT /db_xref=InterPro:IPR011914 FT /db_xref=InterPro:IPR014729 FT /db_xref=UniProtKB/TrEMBL:Q3JWN2 FT /protein_id=ABA50187.1 FT /translation=MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA FT DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS FT LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR atgcccgctt cgttcgaacg caagctgatc acccgcgacg cgctcgccgc catgcgcgcg 60 tcgctgcccg cgcccgtcgt cttcacgaac ggcgtattcg acatcctgca tcgcggccac 120 gtcagctatc tcgccgacgc gaaggcgctc ...
Analyzing Chris Deadlift - Beyond Strength Performance, LLC
Look at the elbows-Dead Give Away. His elbows arent tucked-meaning that he has limited lat tension. Lack of lat tension during heavy deadlifts results in instability of the Thoracopelvic Cannister. Long story short-the spine isnt stable so the body creates false stability by extending the neck and flexing the lower back. So even though he felt like he had his neck packed-and its obvious that he didnt-theres no way he could have. He was lacking the requisite stability farther down the chain.. Theres also an interplay between the deep cervical flexors and the inner-core that Senor Merritt is lacking. Id hazard to guess that Chris felt like he had his air in a good place. Ill also guess that he didnt. Theres a reciprocal pattern of stability here-packed neck promotes utilization of the inner-core, activation of the diaphragm with a solid belly breath creates stability that allows for neck packing. Its a circle. Having these two elements locked in lets the brain open up the juice to the ...
How hot is the inner core of the Earth? | Reference.com
According to National Geographic, the inner core of the Earth ranges between 9,000 and 13,000 degrees Fahrenheit. This is approximately as high as the temperature of the suns...
Heptose I glycan substitutions on Neisseria gonorrhoeae lipooligosacch by Sanjay Ram, Jutamas Ngampasutadol et al.
Lipooligosaccharide (LOS) heptose (Hep) glycan substitutions influence gonococcal serum resistance. Several gonococcal strains bind the classical complement pathway inhibitor, C4b-binding protein (C4BP), via their porin (Por) molecule to escape complement-dependent killing by normal human serum (NHS). We show that the proximal glucose (Glc) on HepI is required for C4BP binding to Por1B-bearing gonococcal strains MS11 and 1291 but not to FA19 (Por1A). The presence of only the proximal Glc on HepI (lgtE mutant) permitted maximal C4BP binding to MS11 but not to 1291. Replacing 1291 lgtE Por with MS11 Por increased C4BP binding to levels that paralleled MS11 lgtE, suggesting that replacement of the Por1B molecule dictated the effects of HepI glycans on C4BP binding. The remainder of the strain background did not affect C4BP binding; replacing the Por of strain F62 with MS11 Por (F62 PorMS11) and truncating HepI mirrored the findings in the MS11 background. C4BP binding correlated with resistance to killing
Buy 3-Deoxy-D-manno-2-octulosonic Acid Ammonium Salt - 103404-70-2 | Vulcanchem
Vulcanchem offers qualified products for CAS No. 103404-70-2(3-Deoxy-D-manno-2-octulosonic Acid Ammonium Salt), please inquire us for more detail.
KEGG PATHWAY: Lipopolysaccharide biosynthesis + T30302
Lipopolysaccharide (LPS) is the major component of the outer membrane of Gram-negative bacteria consisting of three domains: a hydrophobic anchor called lipid A, a non-repeating core oligosaccharide (OS) and a repetitive glycan polymer called O-antigen or O-polysaccharide (O-PS). The enzymes for the biosynthesis of lipid A are well conserved among Gram-negative bacterial species [MD:M00060 M00866]. The core OS connecting lipid A with O-antigen is divided into inner and outer parts. Five core types, K-12 and R1-R4, are identified in Escherichia coli, with the common inner part composed of Kdo (ketodeoxyoctulosonic acid) and Hep (heptose) residues and the outer part made of various sugar residues. O-antigen is the most variable part used for serotyping of pathogenic Escherichia coli, where about 170 types are known. All three domains are involved in toxicity, pathogenicity, antimicrobial resistance and other activities ...
Sugar, Monosaccharides and Disaccharides In Detail - Sample
Monosaccharides are colorless crystalline substances with a sweet taste. Sometimes monosaccharides are commonly known as monosaccharide sugar. Monosaccharides are classified by size according to the number of carbon atoms in the chain of the monosaccharides. For example monosaccharides called dioses has tow carbon ring backbone, monosaccharide trioses has three carbon ring backbone, and monosaccharides heptose has seven carbon ring backbone.. ...
Lipopolysaccharides: How Toxic Is Your Gut?
Learn about how important it can be to consider endogenous toxins where a client is displaying inflammatory symptoms and to work on the gut to improve outcomes.
Towards the synthesis of a Yersinia pestis cell wall polysaccharide: enantioselective synthesis of an L-glycero-D-manno-heptose...
Towards the synthesis of a Yersinia pestis cell wall polysaccharide: enantioselective synthesis of an L-glycero-D-manno-heptose building block ...
Bacteria RfaE protein Summary Report | CureHunter
Bacteria RfaE protein: ADP-heptose synthase, required for lipopolysaccharide biosynthesis; amino acid sequence given in first source
The Week Ahead: Inner Core Deepening | Rev. Angela Peregoff
We are not here just to survive and live long - we are here to live and know Life in its multi-dimensions, to know Life in its richness, in all its variety.
Sedoheptulose 7-phosphate | C7H15O10P - PubChem
Sedoheptulose 7-phosphate | C7H15O10P | CID 165007 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
DL-Glyceraldehyde, tris(trimethylsilyl) ether
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
The Layers Of Earth - The Three Layers Of The Earth, Inner Core, Outer Core
The layers Of The Earth | Learn facts about the Structure of The Layers of Earth, The Earth is composed of four different layers.
Sedoheptulose | Article about Sedoheptulose by The Free Dictionary
Looking for Sedoheptulose? Find out information about Sedoheptulose. A seven-carbon ketose sugar widely distributed in plants of the Crassulaceae family; a significant intermediary compound in the cyclic regeneration... Explanation of Sedoheptulose
Patent US7582027 - Negative hardness gradient inner core for dual core golf ball - Google Patents
A golf ball includes an inner core having a first outer surface and a geometric center and is formed from a first substantially homogenous formulation throughout such that the inner core has a hardness of 30 Shore C to 45 Shore C. An outer core layer is formed around the inner core and has a second outer surface and an inner surface and is formed from a second substantially homogenous formulation throughout such that the outer core layer has a hardness of 60 Shore C to 95 Shore C. A cover layer is formed around the outer core layer. The hardness of the first outer surface is lower than the hardness of the geometric center to define a negative hardness gradient, and the hardness of the second outer surface is greater than the hardness of the inner surface to define a positive hardness gradient.
14 Factors that May Reduce Lipopolysaccharides (LPS) - SelfHacked
Lipopolysaccharides can cause health problems when they enter the blood. Find out about their health risks & factors that may reduce them here.
NWMN RS11555 - AureoWiki
Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesbifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 24.4) ...
N-methylimidazole-N-methylimidazole-N-methylpyrrole-aminobutyric acid- N-methylpyrrole-N-methylpyrrole-N-methylpyrrole-alanine...
N-methylimidazole-N-methylimidazole-N-methylpyrrole-aminobutyric acid- N-methylpyrrole-N-methylpyrrole-N-methylpyrrole-alanine- ...
A NOVEL CORE STRUCTURE, LACKING HEPTOSE AND PHOSPHATE, OF THE LIPOPOLYSACCHARIDE FROM THE GRAM-NEGATIVE BACTERIUM PSEUDOMONS...
The extracted lipopolysaccharides (LPSs) fraction of the plant-pathogenic bacterium Pseudomonas cichorii contained two different molecules, the first of them an LPS possessing an O-specific polysaccharide made up of four 2-acetamido-2,6-dideoxy sugars linked linearly in a tetrasaccharide repeating unit. The structure of the second LPS component is reported here: it was of the rough form and contained a novel type of core region. The rough form LPS of Ps. cichorii was de-O-acylated by mild hydrazinolysis and then de-N-acylated with hot 4 M KOH. The oligosaccharide representing the complete carbohydrate backbone of the LPS was isolated by high-performance anion-exchange chromatography. Its structural characterization employed compositional and methylation analyses, matrix-assisted laser desorption/ionisation mass spectrometry and 1H, 13C and 31P NMR spectroscopy, with application of various 1D and 2D experiments. The carbohydrate backbone of this core region consisted of a hexasaccharide that ...
Analysis of Campylobacter jejuni capsular loci reveals multiple mechanisms for the generation of structural diversity and the...
Analysis of Campylobacter jejuni capsular loci reveals multiple mechanisms for the generation of structural diversity and the ability to form complex heptoses: Mol.Microbiol.
The effect of N-acylglucosamines on the biosynthesis and secretion of insulin in the rat | Biochemical Journal
The effects of N-acylglucosamines on insulin release have been studied. N-Acylglucosamines stimulated insulin release from rat islets in vitro only if a sub-stimulatory concentration of glucose was also present, and this secretory response was abolished by mannoheptulose. In perifused islets the rapidity of the secreotry response to N-acetyl-D-glucosamine was similar to that observed with D-glucose. Increasing acyl-chain length from N-acetyl- to N-hexanoyl-D-glucosamine impaired the secretory response; however, N-dichloroacetyl-D-glucosamine was a more potent stimulator of release than was N-acetyl-D-glucosamine. Polymers of N-acetyl-D-glucosamine containing two to six monomers linked α1-4 did not stimulate insulin release; glucosamine linked to dextran via a propionyl or hexanoyl spacer group was also without insulin-releasing ability. N-Acylglucosamines were also effective in eliciting insulin release in vivo when injected into conscious rats. At the dose used (86 mumol), N-acetylgucosamine ...
Sedoheptulokinase deficiency due to a 57-kb deletion in cystinosis patients causes urinary accumulation of sedoheptulose:...
The most common mutation in the nephropathic cystinosis (CTNS) gene is a homozygous 57-kb deletion that also includes an adjacent gene carbohydrate kinase-like (CARKL). The latter gene encodes a protein that is predicted to function as a carbohydrate kinase. Cystinosis patients with the common 57-kb deletion had strongly elevated urinary concentrations of sedoheptulose (28-451 mmol/mol creatinine; controls and other cystinosis patients ,9) and erythritol (234-1110 mmol/mol creatinine; controls and other cystinosis patients ,148). Enzyme studies performed on fibroblast homogenates derived from patients carrying the 57-kb deletion revealed 80% reduction in their sedoheptulose phosphorylating activity compared to cystinosis patients with other mutations and controls. This indicates that the CARKL-encoded protein, sedoheptulokinase (SHK), is responsible for the reaction: sedoheptulose + ATP --, sedoheptulose-7-phosphate + ADP and that deletion of CARKL causes urinary accumulation of sedoheptulose ...
Brevet US20140045615 - Golf ball with resin inner core having specified coefficient of restitution ... - Google Brevets
A high performance golf ball includes a resin inner core, a rubber outer core, and a cover. The resin inner core is made of a blend of highly neutralized polymers and a low flexural modulus ionomer, and may include a blend of different highly neutralized polymers. The inner core has a specified range of coefficients of restitution when measured at different velocities. The cover is a single layer ionomer cover, and may be made from a blend of different grades of the ionomer. The ball as a whole has properties to maximize performance and aesthetic properties, such as backspin off the irons, feel, and sound.
Earths Inner Core Rotation Slower Than Estimated - Slashdot
intellitech writes Scientists at the University of Cambridge believe they have achieved the first accurate estimate of how much faster Earths core is rotating compared to the rest of the planet. The rate — about one degree every million years — is much slower than previously thought an...
Menticulture Blog
Author: joe Tuesday, 20 November, 2012 - 22:09. One of the concerns that arises in the analysis of the relationship between selfhood and computerised media is a focus on authenticity. There is a tension that arises between the various personae that people are able to adopt in any given situation and the centripetal force that unites them in some supposed inner core. The relative status of these different personae - the extent to which they have fidelity with respect to the primary source of the inner core, or the extent to which they perhaps mislead other inter-actors as to the true nature of that real person, or even threaten the supposed integrity of the authentic self, is instantiated in the very functionality and interface of the computer screen which permits the same logged-in, authenticated user to adopt pseudonymous guises in online environments that can be slipped in and out of, framed as they are by windows one can cycle through. The people that Turkle describes, who find in ...
Global Card Donors of KDO
સમગ્ર શ્રી કચ્છી દશા ઓશવાલ જ્ઞાતિની વિવિધ પ્રવૃત્તિઓ સારી રીતે નિભાવી શકાય અને તેન જરૂરિયાતો સારી રીતે સંતોષી શકાય તે ઉદે્શે મધ્યસ્થ સંસ્થા હોવી જોઈએ એવો વીચાર 1985 માં મુંબઈ મહાજનશ્રીના પ્રમુખ શ્રી રાજેન્દ્ર મણીલાલ ખોનાને આવતાં તેમણે સાથી પદાધિકારીઓ સાથે વિચાર વિમર્શ કરીને વ્યવસ્થાપક સમિતિ સમક્ષ સજુઆત કરી અને મધ્યસ્થ સંથાનું માળખું તૈયાર કરવા સમિતિની સચના કરી.. ...