Shop Glycosyltransferase family 64 protein ELISA Kit, Recombinant Protein and Glycosyltransferase family 64 protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.

Shop Glycosyltransferase family protein 64 protein ELISA Kit, Recombinant Protein and Glycosyltransferase family protein 64 protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.

Chumpen Ramirez S et at, Biochem J., 2017. Ganglioside glycosyltransferases (GGTs) are type-II membrane proteins bearing a short N-terminal cytoplasmic tail, a transmembrane domain (TMD), and a lumenal catalytic domain. The expression and activity of these enzymes largely determine the quality of the glycolipids that decorate mammalian cells membranes. Many glycosyltransferases are themselves glycosylated and this is important for their proper localisation, but few if any other post-translational modifications of these proteins have been reported. Here we show that the GGTs, ST3Gal-V, ST8Sia-I, and β4GalNAcT-I are S-acylated at conserved cysteine residues located close the cytoplasmic border of their TMDs. ST3Gal-II, a GT that sialylates glycolipids and glycoproteins, is also S-acylated at a conserved cysteine located in the N-terminal cytoplasmic tail. Many others GTs also possess cysteine residues in their cytoplasmic regions suggesting that this modification occurs on these GTs as well. ...

El Archivo Digital UPM alberga en formato digital la documentacion academica y cientifica (tesis, pfc, articulos, etc..) generada en la Universidad Politecnica de Madrid.Los documentos del Archivo Digital UPM son recuperables desde buscadores: Google, Google Academics, Yahoo, Scirus, etc y desde recolectores OAI: E-ciencia, DRRD, Recolecta (REBIUN-FECYT), Driver, Oaister, etc.

Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity).

This family of glycoside hydrolases exclusively contains phosphorylases that cleave β-glycosidic bonds. The substrate specificities found in GH94 are: cellobiose (Glc-β1,4-Glc) phosphorylase (EC 2.4.1.20), cellodextrin ((Glc-β1,4-)n-1Glc; n ≥ 3) phosphorylase (EC 2.4.1.49), and N,N-diacetyl chitobiose (GlcNAc-β1,4-GlcNAc) phosphorylase. Moreover, a phosphorylase domain belonging to this family is found in cyclic β-1,2-glucan synthase, a modular protein that also contains a glycosyltransferase domain from Glycosyltransferase Family 84 [1]. The GH94 domain is thought to phosphorolyze protein-bound β-1,2-glucans synthesized from UDP-glucose by the GT84 domain. GH94 enzymes were initially classified in Glycosyltransferase Family 36 because none of them show hydrolytic activity. However because of the evolutionary, structural and mechanistic relatedness with clan GH-L glycoside hydrolases, the family was re-assigned to family GH94 [2]. ...

A detailed explanation of the catalytic mechanism employed by these enzymes can be found on the Glycosyltransferases lexicon page. Note: Transglycosylases are distinct from glycosyltransferases. Although both formally catalyze glycosyl transfer, i.e. transfer of a glycosyl residue from a donor substrate to an acceptor substrate,transglycosylases are mechanistically and structurally related to the glycoside hydrolases. Specifically, transglycosylases catalyze the intra- or intermolecular substitution of the anomeric position of glycosides. ...

Our site contains information on Cytochromes P450, Cytochromes b5, NADPH-Cytochrome P450 reductases, β-Glucosidases, and Glycosyltransferases (Family 1). Follow any of the links above for more information, or check our recent updates. The four structures shown above are links to the P450 (upper left), UGT (upper right), P450 reductase (lower left), and cytochrome b5 (lower right) sections of our site. Molecular images are made using UCSFs Chimera and Adobe Photoshop. Our last site update was on November 29, 2010 Areas Updated Recently: ...

Xyloglucan transglycosylases (XETs) have been implicated in many aspects of cell wall biosynthesis, but their function in vascular tissues, in general, and in the formation of secondary walls, in particular, is less well understood. Using an in situ XET activity assay in poplar stems, we have demonstrated XET activity in xylem and phloem fibers at the stage of secondary wall formation. Immunolocalization of fucosylated xylogucan with CCRC-M1 antibodies showed that levels of this species increased at the border between the primary and secondary wall layers at the time of secondary wall deposition. Furthermore, one of the most abundant XET isoforms in secondary vascular tissues (PttXET16A) was cloned and immunolocalized to fibers at the stage of secondary wall formation. Together, these data strongly suggest that XET has a previously unreported role in restructuring primary walls at the time when secondary wall layers are deposited, probably creating and reinforcing the connections between the ...

The GAUT genes are predicted to encode proteins with molecular masses between 61 and 78 KDa. Most of the GAUT proteins are likely to be type II membrane proteins with a transmembrane domain in their hypervariable N-terminal region. GAUT3,4, and 5 contain a N-terminal signal peptide rather than a transmembrane domain. By contrast, GAUT2 contains no N-terminal transmembrane domain and no signal peptide. The GATL genes encode proteins with molecular masses between 39 and 44 KDa and are predicted to contain only a signal peptide at their N termini suggesting they are processed into the secretory pathway. The 25 proteins in the GAUT1-related superfamily are members of the CAZy glycosyltransferase family 8. The Arabidopsis GAUT-1-related gene family consists of four clades (GAUT-A, GAUT-B, GAUT-C, and GATL, see above figure) that are clearly distinct from the other Arabidopsis glycosyltransferase family 8 proteins. Thus, we believe that the Arabidopsis family-8 proteins should be subdivided to reflect ...

Main conclusion A large-scale bioinformatics analysis revealed the origin and evolution of GT47 gene family, and identified two clades of intron-poor genes with putative functions in drought stress...

PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.

CP001743.PE380 Location/Qualifiers FT CDS_pept 365530..366618 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Mrub_0385 FT /product=glycosyl transferase family 2 FT /note=PFAM: glycosyl transferase family 2; SPTR: A4CTP8 FT Putative glycosyltransferase family 2; InterPro IPR001173; FT COGs: COG1215 Glycosyltransferase probably involved in cell FT wall biogenesis; KEGG: met:M446_3158 glycosyl transferase FT family protein; PFAM: Glycosyl transferase family 2 FT /db_xref=EnsemblGenomes-Gn:Mrub_0385 FT /db_xref=EnsemblGenomes-Tr:ADD27162 FT /protein_id=ADD27162.1 FT /translation=MVSILEVLWYGVLAWLGLKLLVLLLNMLFFPVLKREKLRGPRPTV FT SLLVPARNEAHNLRETLPGLLLQGVQEILVLNDHSTDATAQVVEEFSRQDARVRLLAGL FT PKPEGWMGKTWACYQLAQAAQGEVLIFTDADVHWHKRGVRAVLARMERERAGLVSVYPR FT QMTHSLAERVILPLIDDVLLCYLPYPLLRTPFPSASAANGQVMAFTRPAYLASGGHAAV FT RGEVLEDVRLAQKTKGAGQRLALALGGGLVAVRMYRGFAEIVEGLGKNLIEFHGRSRVV FT LALSYMGHLLAYTLCWPLALFNPLWLWVGVLGLLERLLLGLKTGRAWWELVLVPLAPLL FT STPIYWRSAQRKYTWKGREYSR atggtatcta tcctcgaggt ...

The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-) and related proteins into distinct sequence based families has been described [(PUBMED:9334165)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form clans.. Glycosyltransferase family 28 comprises enzymes with a number of known activities; 1,2-diacylglycerol 3-beta-galactosyltransferase (EC ...

In this study, we found both in vitro and in vivo that a skewed Th2 environment increased Lfng expression in CD4 T cells. Importantly, Lfng expression exacerbated lung pathology and Th2 immune response during RSV-mediated exacerbation of allergic airway disease by enhancing Dll4-induced Notch activation. These findings are in accordance with previous work demonstrating that Lfng-mediated glycosylation of Notch1 enhances its capacity to be activated by Delta-like Notch ligands (3). Interestingly, a STAT5-dependent mechanism regulated Lfng expression during Th2 differentiation, and, in a positive feedback manner, Lfng further augmented Dll4-induced Notch activation and production of Th2 cytokines.. Mechanisms that regulate the immune response and associated pathology during RSV exacerbation of pulmonary airway disease are largely unknown. RSV exacerbation exploits the allergen-driven Th2 cytokine environment to further enhance Th2 cell development and worsen the inflammatory response. In this ...

Formerly known as glycosyltransferase family GT36; Assigned to a GH family following a paper by Hidaka, Honda, Kitaoka, Nirasawa, Hayashi, Wakagi, Shoun and Fushinobu (Structure (Camb). 2004 Jun;12(6):937-947) (PMID: 15274915) that revealed the evolutionary, structural and mechanistic relationship of these phosphorylases with glycoside hydrolases of clan GH-L ...

Formerly known as glycosyltransferase family GT36; Assigned to a GH family following a paper by Hidaka, Honda, Kitaoka, Nirasawa, Hayashi, Wakagi, Shoun and Fushinobu (Structure (Camb). 2004 Jun;12(6):937-947) (PMID: 15274915) that revealed the evolutionary, structural and mechanistic relationship of these phosphorylases with glycoside hydrolases of clan GH-L ...

FUT9 belongs to the glycosyltransferase family and catalyzes the last step in the biosynthesis of Ley glycolipids in the carbohydrate antigen Lex (Nishihara et al, 2003; Gouveia et al, 2012). This reaction takes place in the Golgi compartment, and the product is transported to the cytosol and secreted out from the cell (Duarte et al, 2007). The Ley glycolipid was previously reported to inhibit the procoagulant activity and metastasis of human adenocarcinoma (Nudelman et al, 1986; Suzuki et al, 1997; Inufusa et al, 2001). The loss of FUT9 in the metabolic model prevents Ley glycolipid formation and secretion. To chart the network‐wide metabolic alterations induced by FUT9 inactivation, we performed a Minimization Of Metabolic Adjustment (MOMA) (Segrè et al, 2002) analysis to predict the metabolic state after FUT9 KD in late‐stage colorectal cancers, simulated by the Gene Inactivity Moderated by Metabolism and Expression (GIMME) algorithm (Becker & Palsson, 2008) (Materials and Methods). This ...

Complete information for UGT3A2 gene (Protein Coding), UDP Glycosyltransferase Family 3 Member A2, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium

CDw75, 100 Tests. CD75 is a 43-85 kD type II transmembrane sialoprotein, known as lacosamines, or CDw75. It is a member of glycosyltransferase family.

Nucleotide sugars are the activated forms of monosaccharides. Nucleotide sugars act as glycosyl donors in glycosylation reactions. Those reactions are catalyzed by a group of enzymes called glycosyltransferases. The anabolism of oligosaccharides - and, hence, the role of nucleotide sugars - was not clear until the 1950s when Leloir and his coworkers found that the key enzymes in this process are the glycosyltransferases. These enzymes transfer a glycosyl group from a sugar nucleotide to an acceptor. To act as glycosyl donors, those monosaccharides should exist in a highly energetic form. This occurs as a result of a reaction between nucleoside triphosphate (NTP) and glycosyl monophosphate (phosphate at anomeric carbon). The recent discovery of the reversibility of many glycosyltransferase-catalyzed reactions calls into question the designation of sugar nucleotides as activated donors. There are nine sugar nucleotides in humans which act as glycosyl donors and they can be classified depending ...

InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.

The Stories Tryptophans Tell: Exploring Protein Dynamics of Heptosyltransferase I from Escherichia coli, Joy M. Cote, Carlos A. Ramirez-Mondragon, Zarek S. Siegel, Daniel J. Czyzyk, Jiali Gao, Yuk Y. Sham, Ishita Mukerji, and Erika A. Taylor. ...

Learn About Lysosomal Storage Disorders and How A Glycosyltransferase Activity Assay Can Be Used to Find Novel Therapeutics for These Diseases.

KEGG Orthology (KO) [BR:ccv00001] 09180 Brite Hierarchies 09181 Protein families: metabolism 01005 Lipopolysaccharide biosynthesis proteins [BR:ccv01005] CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6] Enzymes [BR:ccv01000] 2. Transferases 2.7 Transferring phosphorus-containing groups 2.7.8 Transferases for other substituted phosphate groups 2.7.8.6 undecaprenyl-phosphate galactose phosphotransferase CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6] Lipopolysaccharide biosynthesis proteins [BR:ccv01005] O-antigen CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6 ...

MFNG - MFNG (Myc-DDK-tagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2 available for purchase from OriGene - Your Gene Company.

The synthesis of the plant cell wall is very complex, and understanding how this process occurs will lead to many benefits for future research and industries dependent upon cell walls for their products. The recent discovery of the functions of AtMUR3 and AtGT18 in Arabidopsis thaliana as xyloglucan galactosyltransferases has led to the identification of many more putative glycosyltransferases in the Arabidopsis genome. Due to the structural differences between the xyloglucans of Arabidopsis and solanaceous plants, we decided to search for putative arabinosyltransferases in the Solanaceae. Solanaceous xyloglucan is substituted by one to two arabinosyl residues at the second xylose position, and sometimes contains an arabinose at the first xylose position. In contrast, Arabidopsis xyloglucan does not contain arabinose, and is substituted by galactose at the second and third xylose position. Furthermore, the second galactose residue in Arabidopsis xyloglucan is usually fucosylated, a modification not

The hyaluronate synthase complex was identified in plasma membranes from B6 cells. It contained two subunits of molecular masses 52 kDa and 60 kDa which bound the precursor UDP-GlcA in digitonin solution and partitioned into the aqueous phase, together with nascent hyaluronate upon Triton X-114 phase separation. The 52 kDa protein cross-reacted with poly- and monoclonal antibodies raised against the streptococcal hyaluronate synthase and the 60 kDa protein was recognized by monoclonal antibodies raised against a hyaluronate receptor. The 52 kDa protein was purified to homogeneity by affinity chromatography with monoclonal anti-hyaluronate synthase. ...

The hyaluronate synthase complex was identified in plasma membranes from B6 cells. It contained two subunits of molecular masses 52 kDa and 60 kDa which bound the precursor UDP-GlcA in digitonin solution and partitioned into the aqueous phase, together with nascent hyaluronate upon Triton X-114 phase separation. The 52 kDa protein cross-reacted with poly- and monoclonal antibodies raised against the streptococcal hyaluronate synthase and the 60 kDa protein was recognized by monoclonal antibodies raised against a hyaluronate receptor. The 52 kDa protein was purified to homogeneity by affinity chromatography with monoclonal anti-hyaluronate synthase. ...

Goubet, F and Barton, CJ and Mortimer, JC and Xu, X and Zhang, Z and Miles, GP and Richens, J and Liepmann, A and Seffen, KA and Dupree, P (2009) Cell wall glucomannan in Arabidopsis is synthesised by CSLA glycosyltransferases, and influences the speed of embryogenesis. The Plant Journal. ISSN 0960-7412. Full text not available from this repository ...

Before you think of posting here, read back here , then read ahead The Lunatic Fringe (Part 1) http://www.colorado4x4.org/gallery/files/3/1/5/2/Untitled-1.jpg

Buy Losa Online! Losa is used to treat high blood pressure (hypertension) and to help protect the kidneys from damage due to diabetes. It is also used to lower the risk of strokes in patients with high blood pressure and an enlarged heart. Lowering high blood pressure helps prevent strokes, heart attacks, and kidney problems. Losa belongs to a class of drugs called...

FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] The protein encoded by this gene belongs to the UDP-glycosyltransferase family. It catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central and peripheral nervous systems. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2011 ...

The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form clans. Proteins containing this domain transfer UDP, ADP, GDP or CMP linked sugars to a variety of substrates, including glycogen, ...

Suggested Peptide Antigen for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; can be found in Genscripts Peptide Antigen Database. Anti- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; pAb has guaranteed Elisa titer of 1:64000 and 95% WB success rate

The design and synthesis of several beta-1,4-galactosyltransferase inhibitors are reported. Mimics of the pyrophosphate-Mn2+ complex were the focus of the design. Malonic, tartaric, and monosaccharide moieties were used as replacements of the pyrophosphate moiety, and galactose or azasugars with potent galactosidase inhibitory activity were used as the donor component. Compound 6, in which glucose was used as the pyrophosphate-Mn2+ complex mimic and galactose as the donor component, showed the best inhibitory activity towards the transferase with a Ki of 119.6 microM ...

Principal Investigator：NISHIHARA Shoko, Project Period (FY)：1998 - 1999, Research Category：Grant-in-Aid for Scientific Research (C), Section：一般, Research Field：Structural biochemistry

Principal Investigator：NOZAWA Shiro, Project Period (FY)：1994 - 1995, Research Category：Grant-in-Aid for General Scientific Research (B), Research Field：Obstetrics and gynecology

Childhood allergic asthma has been and still is a growing health problem in the western world. Many children begin to have significant complications from severe...

p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...

In the real world, of course, chemical compounds rarely exhibit this ideal combination of characteristics. Few are fully absorbed from the gut. The percentage that does cross is distributed at various sites in the body including, but not exclusively, the intended site of action. A large proportion passes through the liver where it may be metabolized by enzymes, such as the P450 oxygenases, sugar transferases, and drug transport system. Drugs may induce the activity of these molecular bouncers whose main biological role is to show the door to non-nutritious compounds, which the rather more welcoming guardians of the gut, lung, and other epithelia have foolishly allowed entry. The door in this case, of course, is usually the kidney. Elimination, the ultimate fate of all foreign compounds, including drugs, is relatively easy to measure, but much harder to explain or predict for any particular compound. It is, of course, highly dependent on the complex series of molecular, cellular, and ...

CP000124.RFAE Location/Qualifiers FT CDS_pept 620827..621312 FT /codon_start=1 FT /transl_table=11 FT /gene=rfaE FT /locus_tag=BURPS1710b_0607 FT /product=rfaE bifunctional protein, domain II FT /EC_number=2.7.7.- FT /note=identified by match to protein family HMM PF01467; FT match to protein family HMM TIGR00125; match to protein FT family HMM TIGR02199 FT /db_xref=EnsemblGenomes-Gn:BURPS1710b_0607 FT /db_xref=EnsemblGenomes-Tr:ABA50187 FT /db_xref=GOA:Q3JWN2 FT /db_xref=InterPro:IPR004821 FT /db_xref=InterPro:IPR011914 FT /db_xref=InterPro:IPR014729 FT /db_xref=UniProtKB/TrEMBL:Q3JWN2 FT /protein_id=ABA50187.1 FT /translation=MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA FT DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS FT LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR atgcccgctt cgttcgaacg caagctgatc acccgcgacg cgctcgccgc catgcgcgcg 60 tcgctgcccg cgcccgtcgt cttcacgaac ggcgtattcg acatcctgca tcgcggccac 120 gtcagctatc tcgccgacgc gaaggcgctc ...

Digitoxosyltetracenomycin C and Glucosyltetracenomycin C, Two Novel Elloramycin Analogues Obtained by Exploring the Sugar Donor Substrate Specificity of Glycosyltransferase ElmGT

Ruprecht, C.; Bartetzko, M. P.; Senf, D.; Lakhina, A.; Smith, P. J.; Soto, M. J.; Oh, H.; Yang, J.-Y.; Chapla, D.; Varón Silva, D. et al.; Clausen, M. H.; Hahn, M. G.; Moremen, K. W.; Urbanowicz, B. R.; Pfrengle, F.: A glycan array-based assay for the identification and characterization of plant glycosyltransferases. Angewandte Chemie International Edition (2020 ...

Bacteria RfaE protein: ADP-heptose synthase, required for lipopolysaccharide biosynthesis; amino acid sequence given in first source

ami:Amir_6058 K16150 glycogen synthase [EC:2.4.1.11] , (GenBank) glycosyl transferase group 1 (A) MRVLMLSWEYPPVVVGGLGRHVHALADRLVRAGHEVVVLCRQPEGTDAVTHPTEDVVLGG VRVVRVAEDPAHLVFERDLVAWVLAMGHAMTRAGLALLLEGWRPDVVHAHDWLVTHPAVA LAEASQAPLVATVHATEAGRHSGWLSQTLNQQVHSVEWWLANRADELITCSAAMRAEVAH LFEVEPGGITVLHNGIEPKRWRVRAADVEAARGRHSPDGAPVLLFFGRLEWEKGVQDLIA ALPRVRRRHPGTRLVVAGTGTHREWLVEQARKQKVKRAVEFAGHLSDRELAAAIASAAAV VLPSRYEPFGIVALEAAAAGAPLVASTAGGLGEVVLDGETGLSFPPGDVDALARAVCAVL DDRAAAGRRAKAAKARLATDFDWGTIAEGTVEVYRAAVVRERGALGRPKIGTGNVFL ...

The cDNA encoding a xyloglucan endotransglycosylase, PttXET16A, from hybrid aspen (Populus tremula×tremuloides) has been isolated from an expressed sequence tag library and expressed in the methylotrophic yeast Pichia pastoris. Sequence analysis indicated a high degree of similarity with other proteins in the XTH (xyloglucan transglycosylase/hydrolase) gene subfamily of GH16 (glycoside hydrolase family 16). In addition to the conserved GH16 catalytic sequence motif, PttXET16A contains a conserved N-glycosylation site situated proximal to the predicted catalytic residues. MS analysis indicated that the recombinant PttXET16A expressed in P. pastoris is heterogeneous due to the presence of variable N-glycosylation and incomplete cleavage of the α-factor secretion signal peptide. Removal of the N-glycan by endoglycosidase H treatment did not influence the catalytic activity significantly. Similarly, site-directed mutagenesis of Asn93 to serine to remove the N-glycosylation site resulted in an ...

TY - JOUR. T1 - Donor substrate promiscuity of bacterial β1-3-N-acetylglucosaminyltransferases and acceptor substrate flexibility of β1-4-galactosyltransferases. AU - Li, Yanhong. AU - Xue, Mengyang. AU - Sheng, Xue. AU - Yu, Hai. AU - Zeng, Jie. AU - Thon, Vireak. AU - Chen, Yi. AU - Muthana, Musleh M.. AU - Wang, Peng G.. AU - Chen, Xi. PY - 2016/4/15. Y1 - 2016/4/15. N2 - β1-3-N-Acetylglucosaminyltransferases (β3GlcNAcTs) and β1-4-galactosyltransferases (β4GalTs) have been broadly used in enzymatic synthesis of N-acetyllactosamine (LacNAc)-containing oligosaccharides and glycoconjugates including poly-LacNAc, and lacto-N-neotetraose (LNnT) found in the milk of human and other mammals. In order to explore oligosaccharides and derivatives that can be synthesized by the combination of β3GlcNAcTs and β4GalTs, donor substrate specificity studies of two bacterial β3GlcNAcTs from Helicobacter pylori (Hpβ3GlcNAcT) and Neisseria meningitidis (NmLgtA), respectively, using a library of 39 ...

Altered sugar donor specificity and catalytic activity of pteridine glycosyltransferases by domain swapping or site-directed mutagenesis;kpubs;kpubs.org

When entering the differentiation zone, the elongating root cells that are programmed to become trichoblasts drastically add a new growth pattern to allow the highly localized emergence of root hairs. The initiation of a root hair is characterized on the level of gene expression patterns (for review, see Schiefelbein, 2000). On the level of cell physiology, specific enzymes or proteins need to restructure a defined spot of the apical outer periclinal cell wall to allow local wall loosening and bulging. At the time of root hair initiation, inside the cytoplasm actin and microtubules rearrange (Emons and Derksen, 1986; Baluška et al., 2000a, 2000b). A highly localized acidification (pH 4.5) of the cell wall is associated with the initiation process (Bibikova et al., 1998). Once the initiation is completed, the wall pH returns to the pH (approximately 6) found in the rest of the trichoblast. Besides pH changes, other factors are likely to be important to predict the future site of root hair ...

Trehalose is an unusual non-reducing disaccharide that plays a variety of biological roles, from food storage to cellular protection from environmental stresses such as desiccation, pressure, heat-shock, extreme cold, and oxygen radicals. It is also an integral component of the cell-wall glycolipids of mycobacteria. The primary enzymatic route to trehalose first involves the transfer of glucose from a UDP-glucose donor to glucose-6-phosphate to form alpha,alpha-1,1 trehalose-6-phosphate. This reaction, in which the configurations of two glycosidic bonds are set simultaneously, is catalyzed by the glycosyltransferase trehalose-6-phosphate synthase ( OtsA), which acts with retention of the anomeric configuration of the UDP-sugar donor. The classification of activated sugar-dependent glycosyltransferases into approximately 70 distinct families based upon amino acid sequence similarities places OtsA in glycosyltransferase family 20 (see afmb.cnrs-mrs.fr/CAZY/). The recent 2.4 Angstrom structure of ...

Lipopolysaccharyl-alpha-1,4-galactosyltransferase C (LgtC), a glycosyltransferase family 8 alpha-1,4-galactosyltransferase from Neisseria meningitidis, catalyzes the transfer of galactose from UDP galactose to terminal lactose-containing acceptor sugars with net retention of anomeric configuration. To investigate the potential role of discrete nucleophilic catalysis suggested by the double displacement mechanism generally proposed for retaining glycosyltransferases, the side chain amide of Gln-189, which is suitably positioned to act as the catalytic nucleophile of LgtC, was substituted with the more nucleophilic carboxylate-containing side chain of glutamate in the hope of accumulating a glycosyl-enzyme intermediate. The resulting mutant was subjected to kinetic, mass spectrometric, and x-ray crystallographic analysis. Although the K-m for UDP-galactose is not significantly altered, the k(cat) was reduced to 3% that of the wild type enzyme. Electrospray mass spectrometric analysis revealed that ...

The molecular basis of primary wall extension endures as one of the central enigmas in plant cell morphogenesis. Classical cell wall models suggest that xyloglucan endo-transglycosylase activity is the primary catalyst (together with expansins) of controlled cell wall loosening through the transient cleavage and religation of xyloglucan-cellulose cross links. The genome of Arabidopsis (Arabidopsis thaliana) contains 33 phylogenetically diverse XYLOGLUCAN ENDO-TRANSGLYCOSYLASE/HYDROLASE (XTH) gene products, two of which were predicted to be predominant xyloglucan endohydrolases due to clustering into group III-A. Enzyme kinetic analysis of recombinant AtXTH31 confirmed this prediction and indicated that this enzyme had similar catalytic properties to the nasturtium (Tropaeolum majus) xyloglucanase1 responsible for storage xyloglucan hydrolysis during germination. Global analysis of Genevestigator data indicated that AtXTH31 and the paralogous AtXTH32 were abundantly expressed in expanding ...

Abnormal O-glycans expressed by cancer cells have functional importance in cell adhesion, invasion, and metastasis [15]. Alterations in mucin-type O-glycans has been associated with malignant transformation, resulting in the formation of less complex structures and leading to an increase of the simple short determinants. Protein O-glycosylation is deregulated in breast cancer cells, leading to the accumulation of simple mucin-type tumor-associated antigens [37]. The expression of GalNAc-T14 mRNA was analyzed in normal and malignant tissue from breast, skin, lung, pancreas, ovary, endometrium, bladder and lymphoid cancers. A subset of tumor samples, ranging from 10% in lobular breast cancer to 30% in lung cancer and diffuse large B-cell lymphoma, showed GalNAc-T14 mRNA overexpression [36]. Under thees circumstances, we hypothesize the expression of GalNAc-T14 may be a useful biomarker for breast cancer by immunohistochemistry.. It has been shown that several glycosyltransferases are useful tumor ...

Staphylococcus aureus is the most common cause of nosocomial infections. Multiple antibiotic resistance and severe clinical outcomes provide a strong rationale for development of immunoglobulin-based strategies. Traditionally, novel immunological approaches against bacterial pathogens involve antibodies directed against cell surface-exposed virulence-associated epitopes or toxins. In this study, we generated a monoclonal antibody targeting the housekeeping protein IsaA, a suggested soluble lytic transglycosylase of S. aureus, and tested its therapeutic efficacy in two experimental mouse infection models. A murine anti-IsaA antibody of the IgG1 subclass (UK-66P) showed the highest binding affinity in Biacore analysis. This antibody recognized all S. aureus strains tested, including hospital-acquired and community-acquired methicillin-resistant S. aureus strains. Therapeutic efficacy in vivo in mice was analyzed using a central venous catheter-related infection model and a sepsis survival model. ...

Because of the large amount of interest shown by WAAC members in holding the Chicago-based McCrone Research Institute Microscopy for Conservators course on the West Coast, the WAAC Board voted at the 1990 Annual Meeting in Avalon, California to pursue this activity. The McCrone Research Institute has agreed to conduct two sessions of this course in Los Angeles, one session February 10-14, 1992 and the other February 17-21, 1992. The class is held for 8 or more hours per day, with alternating lecture and lab. There are openings for 20 students each week. These sessions will be held at the Getty Conservation Institute, where the Training Program of the GCI has generously extended the use of its laboratory facilities for this WAAC endeavor. Participants will be responsible for arranging their own housing. The McCrone Research Institute is making this course available at a substantial discount to WAAC members. Tuition for each participant will be $700. The McCrone Research Institute will supply ...

GLYCOSYLATED PROTEIN EXPRESSION IN PROKARYOTES - The present invention relates to a prokaryotic host cell comprising eukaryotic glycosyltransferase activity, where the eukaryotic glycosyltransferase activity is eukaryotic dolichyl-linked UDP-GlcNAc transferase activity and eukaryotic mannosyl-transferase activity. Also disclosed is a method of producing a glycosylated protein by providing a prokaryotic host cell comprising the eukaryotic glycosyltransferase activity and culturing the prokaryotic host cell under conditions effective to produce a glycosylated protein. Another aspect of the present invention pertains to a method for screening bacteria or bacteriophages by expressing one or more glycans on the surface of a bacteria, attaching a label on the one or more glycans on the surface of the bacteria or on the surface of a bacteriophage derived from the bacteria, and analyzing the label in a high-throughput format. A glycosylated antibody comprising an Fv portion which recognizes and binds to ...

Plant genomes encode numerous small molecule glycosyltransferases which modulate the solubility, activity, immunogenicity and/or reactivity of hormones, xenobiotics and natural products. The products of these enzymes can accumulate to very high concentrations, yet somehow avoid inhibiting their own biosynthesis. Glucosyltransferase UGT74B1 (UDP-glycosyltransferase 74B1) catalyses the penultimate step in the core biosynthetic pathway of glucosinolates, a group of natural products with important functions in plant defence against pests and pathogens. We found that mutation of the highly conserved Ser284 to leucine [wei9-1 (weak ethylene insensitive)] caused only very mild morphological and metabolic phenotypes, in dramatic contrast with knockout mutants, indicating that steady state glucosinolate levels are actively regulated even in unchallenged plants. Analysis of the effects of the mutation via a structural modelling approach indicated that the affected serine interacts directly with ...

Plant genomes encode numerous small molecule glycosyltransferases which modulate the solubility, activity, immunogenicity and/or reactivity of hormones, xenobiotics and natural products. The products of these enzymes can accumulate to very high concentrations, yet somehow avoid inhibiting their own biosynthesis. Glucosyltransferase UGT74B1 (UDP-glycosyltransferase 74B1) catalyses the penultimate step in the core biosynthetic pathway of glucosinolates, a group of natural products with important functions in plant defence against pests and pathogens. We found that mutation of the highly conserved Ser284 to leucine [wei9-1 (weak ethylene insensitive)] caused only very mild morphological and metabolic phenotypes, in dramatic contrast with knockout mutants, indicating that steady state glucosinolate levels are actively regulated even in unchallenged plants. Analysis of the effects of the mutation via a structural modelling approach indicated that the affected serine interacts directly with ...

Glycosyltransferases (GTFs, Gtfs) are enzymes (EC 2.4) that establish natural glycosidic linkages. They catalyze the transfer of saccharide moieties from an activated nucleotide sugar (also known as the glycosyl donor) to a nucleophilic glycosyl acceptor molecule, the nucleophile of which can be oxygen- carbon-, nitrogen-, or sulfur-based. The result of glycosyl transfer can be a carbohydrate, glycoside, oligosaccharide, or a polysaccharide. Some glycosyltransferases catalyse transfer to inorganic phosphate or water. Glycosyl transfer can also occur to protein residues, usually to tyrosine, serine, or threonine to give O-linked glycoproteins, or to asparagine to give N-linked glycoproteins. Mannosyl groups may be transferred to tryptophan to generate C-mannosyl tryptophan, which is relatively abundant in eukaryotes. Transferases may also use lipids as an acceptor, forming glycolipids, and even use lipid-linked sugar phosphate donors, such as dolichol phosphates. Glycosyltransferases that use ...

TY - CHAP. T1 - Enzymatic Approaches to O-Glycoside Introduction. T2 - Glycosyltransferases. AU - Chokhawala, H. A.. AU - Chen, Xi. PY - 2007/1/1. Y1 - 2007/1/1. UR - http://www.scopus.com/inward/record.url?scp=79951603384&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=79951603384&partnerID=8YFLogxK. U2 - 10.1016/B978-044451967-2/00012-X. DO - 10.1016/B978-044451967-2/00012-X. M3 - Chapter. AN - SCOPUS:79951603384. SN - 9780444519672. VL - 1-4. SP - 415. EP - 451. BT - Introduction to Glycoscience; Synthesis of Carbohydrates. PB - Elsevier. ER - ...

GLT25D2; glycosyltransferase 25 domain containing 2; 16790; ENSG00000198756; C1orf17; 1q25; FLJ37771, FLJ37873, KIAA0584; procollagen galactosyltransferase 2; hydroxylysine galactosyltransferase 2; glycosyltransferase 25 family member 2; EC 2.4.1.50 ...

The Notch receptor is a large, cell surface transmembrane protein involved in a wide variety of developmental processes in higher organisms. It becomes activated when its extracellular region binds to ligands located on adjacent cells. Much of this extracellular region is composed of EGF-like repeats, many of which can be O-fucosylated. A number of these O-fucosylated repeats can in turn be further modified by the action of a beta-1,3-N-acetylglucosaminyltransferase enzyme known as Fringe. Fringe potentiates the activation of Notch by Delta ligands, while inhibiting activation by Serrate/Jagged ligands. This regulation of Notch signalling by Fringe is important in many processes.Four distinct Fringe proteins have so far been studied in detail; Drosophila Fringe (Dfng) and its three mammalian homologues Lunatic Fringe (Lfng), Radical Fringe (Rfng) and Manic Fringe (Mfng). Dfng, Lfng and Rfng have all been shown to play important roles in developmental processes within their host, though the ...

Axon Medchem | Prime source supplier of high-value life science products, providing Axon Ligands™ for pharmaceutical research as world-wide recognized drug standards

Complete information for LFNG gene (Protein Coding), LFNG O-Fucosylpeptide 3-Beta-N-Acetylglucosaminyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium

Watch this video and answer the following question: Have the humanities gone mad? https://www.youtube.com/watch?v=vDT-Yj5n6zE

Modern & classic rock, electronica, world music & more - picked & mixed by real humans - highest quality sound with no subscription fees or ads.

The mad gene hunt gets odder and odder. The headlines are more and more becoming fit fodder for late night television comedy. The Times of India had this to say. Childhood adversity ups genetic disorder risk You can imagine the faces of their collective readership registering shock and dismay. Are children really having that much…

This is a replacement Losi Adjustable Hinge Pin Brace Insert Set, and is intended for use with the Losi 8ight 1/8 Scale Buggy and Truggy.  LOSA1756

InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.

Affiliation：平成医療短期大学,リハビリテーション学科,教授, Research Field：Ophthalmology, Keywords：HTLV-I,PAX6,網膜変性,網膜色素変性症,Retina,Retinitis pigmentosa,HLA,加齢黄斑変性,Monoclinal antibody,Sugar transferases, # of Research Projects：9, # of Research Products：0

Glycosyltransferase (GT) enzymes are incredibly diverse in their abilities to catalyze the transfer of sugar molecules to protein, carbohydrate, and lipid substrates. GTs have various metabolic and regulatory roles in biology. Glycosyltransferase targets provide different areas of therapeutic potential in a wide array of disease, including cancer, metabolic disorders, and infectious disease. A glycosyltransferase ...

Centralized Modularity of N-Linked Glycosylation Pathways in Mammalian Cells. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.

The Half Baked Lunatic - Bringing a little sanity to this crazy world - News, Politics, Religion, Science, Economics, and More! -

Arsenic, Copper, Iron, Cells, Gene, Virus, Donor, Flavonoids, Glucose, Glucuronic Acid, Glycosyltransferases, Guanidinium, Plant, Plants, Plays, Report, Role, Specificity, Udp, Udpga

Creative Biogene offers challenging job opportunities for people looking for career growth in an entrepreneurial environment that recognizes individual contributions ...

Supplementary Materials10549_2017_4442_MOESM1_ESM. blotting, luciferase reporter assays, TUNEL assays, analysis of the gene, and ChIP assays. Results NSC35446.HCl inhibited proliferation and induced apoptosis in antiestrogen resistant LCC9, T47DCO, MCF-7/RR, and LY2 cells but not in ER-negative breast malignancy cell lines. (mRNA and protein expression in LCC9 cells. NSC35446.HCl also inhibited NF-B activity and expression of NF-B target genes. analysis of the promoter recognized nine estrogen response element (ERE) half-sites and one ERE-like full-site. ChIP assays revealed that ER was recruited to the ERE-like full-site and five from the nine half-sites which ER recruitment was inhibited by NSC35446.HCl in T47DCO and. ...

Washed antibody and started developing. Pax6 came up quite fast. I exchanged the solution after 1h and stopped after 2h. The remaining are slowly coming up, except asym and bilateral of engrailed. I used one tube of 0.8 ng/µL of probe and it must have been even lower concentration because the other 3 engrailed wells are coming up ok (same probe batch, but from another tube). Another issue is that there is not early gastrula like I wanted, they seem to be already have the differentiated lateral patches.. Lunatic fringe and runx are not showing up. I exchanged AP from all wells except engrailed after 3h and then all wells before leaving at 4 °C overnight.. ...

Sugars are involved in almost every aspect of biology, from recognising pathogens and to blood clotting.The glycomes basic building blocks are far more numerous and varied than the four letters of the DNA alphabet or the score of amino acids that make proteins.In the late 1980s, when researchers isolated the first gene for a glycosyl transferase, an enzyme that adds sugars to fats and proteins. The discovery gave scientists the first opportunity to study this process, which is usually called glycoslyation, by manipulating the activity of such enzymes ...

Say the Act of Contrition, I demanded before I even said good morning. Now, before you think Im a crazy lunatic you must know that tonight was her first reconciliation. A big night. So Im not a crazy lunatic, just a regular kind of fathery type lunatic whos been studying the Act of Contrition to the point where at night we all dream about how heartily sorry we all are. Just say the Act of Contrition, I said. One last time and Ill never ask again ...

My Fringe journey continues! Sex talks, rapid aging, and Peter singing Row row row your boat made episode 2 quite enjoyable. Someone call Sigourney Weaver! This girl is gonna burst Alien style. Its the Fringe committee and they are talking about their new ragtag team (the best kind!). Ooh la la. Peter in his boxers.…

All data and information provided on this site is for informational purposes only. pogoport.com makes no representations as to accuracy, completeness, currentness, suitability, or validity of any information on this site and will not be liable for any errors, omissions, or delays in this information or any losses, injuries, or damages arising from its display or use. All information is provided on an as-is basis ...

A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched…

A4GALT encodes a type II membrane glycosyltransferase and results in Pk and P1 antigens of the P Non-ABO blood group along with B3GALNT1. ...

Ardiccioni C, Clarke OB, Tomasek D, Issa HA, von Alpen DC, Pond HL, Banerjee S, Rajashankar KR, Liu Q, Guan Z, et al. Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. Nat Commun. 2016 ;7:10175. ...

Ardiccioni C, Clarke OB, Tomasek D, Issa HA, von Alpen DC, Pond HL, Banerjee S, Rajashankar KR, Liu Q, Guan Z, et al. Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. Nat Commun. 2016 ;7:10175. ...

Guys, Im ready for Olivia to come home. Things need to be set right in the blue universe. Peter is making AltLivia breakfast in bed and buying her U2 tickets. AltLivia is winning Walters heart with food and the Fringe team is being manipulated by Darth Vader Walternate. Things are falling apart and I dont…

pep chromosome:GRCm38:5:140607320:140615545:1 gene:ENSMUSG00000029570 transcript:ENSMUST00000031555 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Lfng description:LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1095413 ...