TY - JOUR. T1 - Glucosylation of sucrose laurate with cyclodextrin glucanotransferase. AU - Okada, Katsuhide. AU - Zhao, Haisuo. AU - Izumi, Minoru. AU - Nakajima, Shuhei. AU - Baba, Naomichi. PY - 2007. Y1 - 2007. N2 - Sucrose monolauroyl esters were found to serve as substrates for cyclodextrin glucanotransferase (CGTase)-catalyzed transglucosidation reactions, affording new sucrose esters that have an additional 1-3 glucose residues on the pyranose ring of the sucrose moiety in the ester.. AB - Sucrose monolauroyl esters were found to serve as substrates for cyclodextrin glucanotransferase (CGTase)-catalyzed transglucosidation reactions, affording new sucrose esters that have an additional 1-3 glucose residues on the pyranose ring of the sucrose moiety in the ester.. KW - CGTase. KW - Cyclodextrin glucanotransferase. KW - Sucrose monolaurate. KW - Surfactant. UR - http://www.scopus.com/inward/record.url?scp=33947580881&partnerID=8YFLogxK. UR - ...
Read "Cloning and characterization of full-length cDNA encoding sucrose phosphate synthase from faba bean, Gene" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
sucrose synthase (EC 2.4.1.13); sucrose-phosphate synthase (EC 2.4.1.14); α-glucosyltransferase (EC 2.4.1.52); lipopolysaccharide N-acetylglucosaminyltransferase (EC 2.4.1.56); phosphatidylinositol α-mannosyltransferase (EC 2.4.1.57); GDP-Man: Man1GlcNAc2-PP-dolichol α-1,3-mannosyltransferase (EC 2.4.1.132); GDP-Man: Man3GlcNAc2-PP-dolichol/Man4GlcNAc2-PP-dolichol α-1,2-mannosyltransferase (EC 2.4.1.131); digalactosyldiacylglycerol synthase (EC 2.4.1.141); 1,2-diacylglycerol 3-glucosyltransferase (EC 2.4.1.157); diglucosyl diacylglycerol synthase (EC 2.4.1.208); trehalose phosphorylase (EC 2.4.1.231); NDP-Glc: α-glucose α-glucosyltransferase / α,α-trehalose synthase (EC 2.4.1.245); GDP-Man: Man2GlcNAc2-PP-dolichol α-1,6-mannosyltransferase (EC 2.4.1.257); UDP-GlcNAc: 2-deoxystreptamine α-N-acetylglucosaminyltransferase (EC 2.4.1.283); UDP-GlcNAc: ribostamycin α-N-acetylglucosaminyltransferase (EC 2.4.1.285); UDP-Gal α-galactosyltransferase (EC 2.4.1.-); UDP-Xyl α-xylosyltransferase ...
sucrose synthase (EC 2.4.1.13); sucrose-phosphate synthase (EC 2.4.1.14); α-glucosyltransferase (EC 2.4.1.52); lipopolysaccharide N-acetylglucosaminyltransferase (EC 2.4.1.56); phosphatidylinositol α-mannosyltransferase (EC 2.4.1.57); GDP-Man: Man1GlcNAc2-PP-dolichol α-1,3-mannosyltransferase (EC 2.4.1.132); GDP-Man: Man3GlcNAc2-PP-dolichol/Man4GlcNAc2-PP-dolichol α-1,2-mannosyltransferase (EC 2.4.1.131); digalactosyldiacylglycerol synthase (EC 2.4.1.141); 1,2-diacylglycerol 3-glucosyltransferase (EC 2.4.1.157); diglucosyl diacylglycerol synthase (EC 2.4.1.208); trehalose phosphorylase (EC 2.4.1.231); NDP-Glc: α-glucose α-glucosyltransferase / α,α-trehalose synthase (EC 2.4.1.245); GDP-Man: Man2GlcNAc2-PP-dolichol α-1,6-mannosyltransferase (EC 2.4.1.257); UDP-GlcNAc: 2-deoxystreptamine α-N-acetylglucosaminyltransferase (EC 2.4.1.283); UDP-GlcNAc: ribostamycin α-N-acetylglucosaminyltransferase (EC 2.4.1.285); UDP-Gal α-galactosyltransferase (EC 2.4.1.-); UDP-Xyl α-xylosyltransferase ...
Smith, D.J.; Taubman, M.A.; Ebersole, J.L., 1979: Preparation of glucosyl transferase ec 2.4.1.5 from streptococcus mutans by evolution from water insoluble poly saccharide with a dissociating solvent
Cyclomaltodextrins (Schardinger dextrins) of various sizes (6,7,8, etc. glucose units) are formed reversibly from starch and similar substrates. Will also disproportionat
Two glucosyl donors, which allowed for the α-selective glucosylation of primary hydroxyl groups, were designed using a combination of acyl groups capable of remote participation, an electron-withdrawing pentafluorobenzoyl substituent and a bulky TBDPS protecting group. The first had a participating levulinoyl group
Protein folding in the endoplasmic reticulum (ER) is error prone, and ER quality control (ERQC) processes ensure that only correctly folded proteins are exported from the ER. Glycoproteins can be retained in the ER by ERQC, and this retention contributes to multiple human diseases, termed ER storage diseases. UDP-glucose:glycoprotein glucosyltransferase (UGGT1) acts as a central component of glycoprotein ERQC, monoglucosylating deglucosylated N-glycans of incompletely folded glycoproteins and promoting subsequent reassociation with the lectin-like chaperones calreticulin and calnexin. The extent to which UGGT1 influences glycoprotein folding, however, has only been investigated for a few selected substrates. Using mouse embryonic fibroblasts lacking UGGT1 or those with UGGT1 complementation, we investigated the effect of monoglucosylation on the soluble/insoluble distribution of two misfolded alpha 1-antitrypsin (AAT) variants responsible for AAT deficiency disease: null Hong Kong (NHK) and Z ...
1,3-Beta-glucan synthase is a glucosyltransferase enzyme involved in the generation of beta-glucan in fungi. It serves as a pharmacological target for antifungal drugs such as caspofungin, anidulafungin, and micafungin, deemed 1,3-Beta-glucan synthase inhibitors. The biosynthesis of disaccharides, oligosaccharides, and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-.), and related proteins into distinct sequence-based families has been described.[1] This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site . The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of ...
McIntosh, Cecilia A.. 2014. Position-Specific Flavonoid Glucosyltransferases: Structure and Functional Analysis of Grapefruit Flavonol-Specific 3-O-GT. Workshop presentation. East Tennessee State University Institute for Quantitative Biology Seminar, Johnson City, TN. ...
Protein O-glucosyltransferase. Catalyzes the reaction that attaches glucose through an O-glycosidic linkage to a conserved serine residue in epidermal growth factor-like repeats. Regulates Notch signaling by glucosylating Notch in the ER, glucosylation is required for the correct folding and cleavage of Notch.
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
12676-30-1 - Calcium sucrose phosphate - Similar structures search, synonyms, formulas, resource links, and other chemical information.
1BGT: Crystal structure of the DNA modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose.
The food enzyme cyclomaltodextrin glucanotransferase ((1→4)‐α‐d‐glucan:(1→4)‐α‐d‐glucan 4‐α‐d‐[(1→4)‐α‐d‐glucano]‐transferase; EC 2.4.1.19) is produced with the non‐genetically modified Paenibacillus illinoisenis strain 107 by Hayashibara Co., Ltd. The cy .... ...
Although the evolution of multigene families involves multiple mechanisms, comprehensive analysis of phylogenetic tree and exon/intron gene structures, to a certain extent, allow us to make some generalizations and predictions about the possible origin of and relationships between different isoforms of Sus, as well as their possible function. Plant Sus proteins have been historically divided into at least three major groups (Sus1, SusA and New Group/NG) on the basis of phylogenetic tree and molecular structures analysis of their sequences [24, 29]. Phylogenetic analysis of cotton GaSus genes and other plant homologues in our work corroborated this classification (for unification and simplification, in this study, we renamed them as Sus I, II and III, respectively), and further support the idea that higher plant species may have at least one gene for each of the three groups [24]. The presence of five cotton Sus genes, GaSus1 to 5, in the Sus I group that cluster together with other dicot genes ...
SNF1 kinase homolog 11; Catalytic subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase. In vitro, KIN11 exhibits kinase activity on sucrose phosphate synthase and the kinase activity is inhibited by PRL1. May be a subunit of a SCF ubiquitin ligas [...] (512 aa ...
MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPLLLEASEFLAE 1 - 70 DSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKFCLSLRSYSATIQAFQQIAAD 71 - 140 EPPPEGCNSFFSVHGKKTCESDTLEALLLTASERPKPLLFKGDHRYPSSNPESPVVIFYSEIGSEEFSNF 141 - 210 HRQLISKSNAGKINYVFRHYIFNPRKEPVYLSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPID 211 - 280 EVQGFLFGKLRDLHPDLEGQLKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLS 281 - 350 QNFPTKARAITKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARV 351 - 420 MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQELLRPTFPGVIR 421 - 490 QIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLRIGFIFVVNDSEDVDGMQDAGVAVLRAYNYVAQ 491 - 560 EVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGP 561 - 630 LPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRIL 631 - 700 TAERDYLDLTASNNFFVDDYARFTILDSQGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFD 701 - 770 SPSGRQLLYDAIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAE 771 - 840 ...
So, like I said, I really love the CSLA.NET framework. But with all of its awesome excellence, Ive always been challenged writing true unit tests against business objects that use it. This is because CSLA.NET makes it difficult to implement Dependency Injection. Why? In short: CSLA.NET creates your business object instances for you. This happens in the servers-side portion of the DataPortal. Dependency Injection works best if it can have some kind of access to the object creation process so an objects dependencies can be injected. Unfortunately, the DataPortal does not provide any sort of hook where you can create your object. The DataPortal does this all behind the scenes as a black box and then gives you your object instance after creation, letting you then execute your data-access code in the DataPortal_* methods ...
1NZF: Crystal structures of the T4 phage beta-glucosyltransferase and the D100A mutant in complex with UDP-glucose: glucose binding and identification of the catalytic base for a direct displacement mechanism.
UPD-glucose-thiohydroximate glucosyltransferase: from Brassica; catalyzes the glucosylation of phenylacetothiohydroximate in the presence of UDP-glucose to form desulfobenzylglucosinolate
Mouse polyclonal antibody raised against a partial recombinant UGCG. UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. (H00007357-A01) - Products - Abnova
I agree with your surprise about the lack of a data model diagram in the GTFS specification. We at AddTransit have designed software to create and maintain GTFS files, and the first thing I did when reading the specification was look for the diagram to show me how all the files were linked together. Needless to say had to produce an almost identical diagram before we got started. At the same time we were left scratching our heads about why zones and blocks didnt get files of their own ...
I agree with your surprise about the lack of a data model diagram in the GTFS specification. We at AddTransit have designed software to create and maintain GTFS files, and the first thing I did when reading the specification was look for the diagram to show me how all the files were linked together. Needless to say had to produce an almost identical diagram before we got started. At the same time we were left scratching our heads about why zones and blocks didnt get files of their own ...
Join Ray Villalobos for an in-depth discussion in this video Padding elements with Susy, part of Building a Responsive Single-Page Design with Sass
RER_23700 probable glucosyltransferase GTGAAGATTCTCATCGTCTCGTGGGAGTACCCACCGGTCGTTGTCGGCGGCCTCGGCCGA CACGTCCACCATCTCGCCACCGAGCTTGCGGCTGCAGGCCACGAAGTCGTGGTTCTCTCG CGCCGCCCCTCCGGCACCGATGCGTCGACGCACCCGACGGTCACGCACATCTCCGAAGGC GTACTGGTCGTCGCAGTGGCCGAGGACCCGGCACACTTCGTCTTCGGCGAGGACATGCTC GCGTGGACCCTCGCGATGGGTCACGCGATGGTCCGTGCCGGGATGGCGCTGCACAAGCCA GGAGTGGGCGAGGGCTGGCAACCGGACGTCGTGCACGCACACGACTGGCTGGTCGCACAT CCGGCGATCGCCTTGGCCGAATTCTATGACGTCCCACTGGTTTCCACGCTTCACGCCACC GAGGCGGGTCGCCACAGCGGTTGGATCTCCGGACGCATCAACCGCCAGGTCCACTCGGTC GAGTGGTGGCTGGCAAACGAATCCGACTCTCTCATAACCTGTTCGGCGTCCATGCAGGAA GAAGTGACCGAACTCTACGGTCCGACGCTGCCGCCGATCACTGTCATCCGCAACGGAATC GACGTGACCACGTGGAACTTTCGCGAACGTGGCCCGCGGTCAGGGCCGCCGAAACTCCTC TTCGTCGGCCGCCTGGAATACGAGAAGGGTGTGCAGGACGCTATCGCGGCACTCCCCCGA ATCCGTCGTAGCCACCCCGGCACGACCCTCGCGATCGCGGGCGAAGGCACCCAGTTCACC TGGCTCTACCAACAGGCGCGCACACATCGCGTCGCGCGGGCAGTGGACTTTCTCGGCAAC CTCGATCACACGGAACTGCTCAGCTGGCTGCACGGAGCGGACGCCATCGTCCTGCCGTCG ...
Differences in carbohydrate contents and metabolizing-enzyme activities were monitored in apical, medial, basal and core sections of pineapple (Ananas comosus cv. Comte de paris) during fruit development and ripening. Fructose and glucose of various sections in nearly equal amounts were the predominant sugars in the fruitlets, and had obvious differences until the fruit matured. The large rise of sucrose/hexose was accompanied by dramatic changes in sucrose phosphate synthase (SPS) and sucrose synthase (SuSy) activities. By contrast, neutral invertase (NI) activity may provide a mechanism to increase fruit sink strength by increasing hexose concentrations. Furthermore, two cDNAs of Ac-sps (accession no. GQ996582) and Ac-ni (accession no. GQ996581) were first isolated from pineapple fruits utilizing conserved amino-acid sequences. Homology alignment reveals that the amino acid sequences contain some conserved function domains. Transcription expression analysis of Ac-sps, Ac-susy and Ac-ni also indicated
Differences in carbohydrate contents and metabolizing-enzyme activities were monitored in apical, medial, basal and core sections of pineapple (Ananas comosus cv. Comte de paris) during fruit development and ripening. Fructose and glucose of various sections in nearly equal amounts were the predominant sugars in the fruitlets, and had obvious differences until the fruit matured. The large rise of sucrose/hexose was accompanied by dramatic changes in sucrose phosphate synthase (SPS) and sucrose synthase (SuSy) activities. By contrast, neutral invertase (NI) activity may provide a mechanism to increase fruit sink strength by increasing hexose concentrations. Furthermore, two cDNAs of Ac-sps (accession no. GQ996582) and Ac-ni (accession no. GQ996581) were first isolated from pineapple fruits utilizing conserved amino-acid sequences. Homology alignment reveals that the amino acid sequences contain some conserved function domains. Transcription expression analysis of Ac-sps, Ac-susy and Ac-ni also indicated
0149]Bachmann, M., Huber, J. L., Athwal, G. S., Wu, K., Ferl, R. J., and Huber, S. C. (1996). 14-3-3 proteins associate with the regulatory phosphorylation site of spinach leaf nitrate reductase in an isoform-specific manner and reduce dephosphorylation of Ser-543 by endogenous protein phosphatases. FEBS Letters 398, 26-30. [0150]Becraft, P. W. (2002). Receptor Kinase Signaling in Plant Development. Annual Review of Cell and Developmental Biology 18, 163-192. [0151]Berridge, M. J. (1993). Inositol Trisphosphate and Calcium Signaling. Nature 361, 315-325. [0152]Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. [0153]Bornke, F. (2005). The variable C-terminus of 14-3-3 proteins mediates isoform-specific interaction with sucrose-phosphate synthase in the yeast two-hybrid system. J Plant Physiol. 162, 161-8. [0154]Bowman, J. L., Smyth, D. R., Meyerowitz, E. M. (1989) Genes directing flower development in Arabidopsis. Plant Cell, 1(1), 37-52. ...
The photosynthetic oxygen evolution rate, Hill reaction activity of seedlings and photosynthetic parameter, Pn-Ci curve and some source-sink metabolism-related enzyme activities, and substance content of flag leaves were measured by using two wheat near isogenic lines with significant differences in the photosynthetic rate of the 154 (high photosynthetic rate) and 212 (low photosynthetic rate) lines as materials. The results showed that the maximal carboxylation efficiency (Vcmax) and Hill reaction activity were higher in line 154 than that of line 212. The Pn in flag leaves of line 154 was significantly higher than that of line 212 during the anthesis to grain-filling stage. Higher leaf sucrose phosphate synthase activity, grain sucrose synthase activity, and grain ADPG pyrophosphorylase activity ensured that the photosynthate of line 154 could be transported to grains and translated into starch in a timely and effective manner, which also contributed to the maintenance of its high ...
Glucans, with the (1-3)-b-glucosidic linkage as major feature, are present in most of the higher plants, in many lower plants, as well as in microorganisms (Stone and Clarke, 1992). The synthesis of (1-3)-b-glucan in vivo is catalysed by the enzyme (1-3)-b-glucan synthase (EC 2.4.1.34; UDP-glucose:1,3-b-D-glucan 3-b-D-glucosyl transferase) using UDP-glucose as substrate. The (1-3)-b-glucan synthase was characterised in a number of fungi and plants, but not much work was done with oomycetes (Stone and Clarke, 1992), even though one of the earliest successful in vitro assays for glucan synthase activity was done using Phytophthora cinnamomi (Wang and Bartnicki-Garcia, 1976, Selitrennikoff 1995). In this work, the glucan synthase of the oomycete Phytophthora sojae was characterised, solubilized, and partially purified, and the cDNA for a protein co-purifying with the glucan synthase activity was cloned. The glucan synthase of P. sojae had several features that distinguish it from what is known for ...
Sorbitol dehydrogenase (SDH, EC 1.1.1.14) was extracted, as described by Park et al. (2002) and Yamaguchi and Kanayama (1996) with some modifications. 0.5 g frozen sample was homogenized in 2 ml of 200 mM potassium phosphate buffer (pH 7.8) containing 1 mM EDTA, 10 mM sodium ascorbate, 1 mM dithiothreitol (DTT), 0.15% (v/v) Triton X-100, 1% (w/v) BSA and 2% (w/v) insoluble polyvinylpolypyrrolidone (PVPP). The homogenate was centrifuged at 13,000×g for 15 min at 4°C. 1 ml of the supernatant was desalted with a Sephadex G25 PD-10 column (GE Healthcare, UK) equilibrated with 125 mM Tris-HCl (pH 9.6). SDH activity was measured in a 1 ml reaction mixture containing 500 mM Sorbitol, 1 mM NAD+ and desalted extract in 125 mM Tris-HCl (pH 9.0), and NADH production was determined at 340 nm.. For acid invertase (AI, EC 3.2.1.26), neutral invertase (NI, EC 3.2.1.26), sucrose synthase (SS, EC 2.4.1.13), sorbitol oxidase (SOX, EC 1.5.3.1) and sucrose phosphate synthase (SPS, EC 2.4.1.14) activity, the ...
Fruits of cv. Fortune mandarin were periodically :harvested throughout the ripening period to evaluate changes in carbohydrate content and metabolism in flavedo tissue and to determine the potential role of carbohydrates in the tolerance of citrus fruit to chilling injury (CI). Sucrose showed little change in the flavedo during the season, but fructose and glucose increased, in nearly equal amounts, throughout the fall and winter, reaching a maximum in January. Starch levels were less abundant than soluble carbohydrates and rose continuously until March. Sucrose phosphate synthase (SPS; EC 4.1.14) activity decreased from December throughout ripening. Changes in sucrose synthase (SS; EC 2.4.1.13) and acid and alkaline invertase (Inv; EC 3.2.1.26) activities correlated with changes in the reducing sugars, but acid invertase was less active than the other sucrose-metabolizing enzymes. Carbohydrate changes in the flavedo of Fortune mandarins with fruit maturity appear not to be related to the ...
SWISS-MODEL Template Library (SMTL) entry for 1ukt. Crystal structure of Y100L mutant cyclodextrin glucanotransferase compexed with an acarbose
This patent search tool allows you not only to search the PCT database of about 2 million International Applications but also the worldwide patent collections. This search facility features: flexible search syntax; automatic word stemming and relevance ranking; as well as graphical results.
Figure 1. Schematic Representations of the Structure of a CESA Protein and a CSC.. (A) Domain structure of a CESA. The intracellular N-terminal domain contains a Zn binding domain and a variable region and is followed by two transmembrane domains. The large cytoplasmic central catalytic domain is divided into the conserved region, which flanks the plant-specific region on both sides, the variable region(s), which includes the class-specific region, and the conserved region(s). The six subsequent transmembrane domains are followed by the cytoplasmic C-terminal domain. CESA1 phosphorylations on various Ser and Thr residues are indicated (source: PhosPhAt 4.0, Zulawski et al., 2013; and references in the text). Several cysteines in the cytoplasmic loop and within the C-terminal domain that are s-acylated in CESA7 (Kumar 2016b) are depicted in pink. C, cellulose chain; CR1, conserved region 1; CR2, conserved region 2; P-CR, plant-specifc region; S, Ser; T, Thr.. (B) A schematic representation of a ...
Excellgen : Ask a Question - Recombinant Proteins Proteases Cytokines Protein Expression Polymerases Transfection Stem Cell Reagents New Products Ligases Custom Cloning Recombinases Transcription Factors Cancer Proteins Genome Engineering DNA Modifying Enzymes PCR & qPCR Electrophoresis 5 Capped mRNA Peptides RNA Enzymes Nuclear Receptors Nucleases DNA Binding Proteins Glycosylases Glucosyltransferases Topoisomerases Kinases and Phosphatases Restriction Enzymes Conjugation Lysozymes Antibodies
A - Tilt: 18° - Segments: 1( 15- 34), 2( 41- 60), 3( 64- 86), 4( 96- 120), 5( 418- 435), 6( 447- 466), 7( 522- 543), 8( 549- 570 ...
CP001743.PE380 Location/Qualifiers FT CDS_pept 365530..366618 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Mrub_0385" FT /product="glycosyl transferase family 2" FT /note="PFAM: glycosyl transferase family 2; SPTR: A4CTP8 FT Putative glycosyltransferase family 2; InterPro IPR001173; FT COGs: COG1215 Glycosyltransferase probably involved in cell FT wall biogenesis; KEGG: met:M446_3158 glycosyl transferase FT family protein; PFAM: Glycosyl transferase family 2" FT /db_xref="EnsemblGenomes-Gn:Mrub_0385" FT /db_xref="EnsemblGenomes-Tr:ADD27162" FT /protein_id="ADD27162.1" FT /translation="MVSILEVLWYGVLAWLGLKLLVLLLNMLFFPVLKREKLRGPRPTV FT SLLVPARNEAHNLRETLPGLLLQGVQEILVLNDHSTDATAQVVEEFSRQDARVRLLAGL FT PKPEGWMGKTWACYQLAQAAQGEVLIFTDADVHWHKRGVRAVLARMERERAGLVSVYPR FT QMTHSLAERVILPLIDDVLLCYLPYPLLRTPFPSASAANGQVMAFTRPAYLASGGHAAV FT RGEVLEDVRLAQKTKGAGQRLALALGGGLVAVRMYRGFAEIVEGLGKNLIEFHGRSRVV FT LALSYMGHLLAYTLCWPLALFNPLWLWVGVLGLLERLLLGLKTGRAWWELVLVPLAPLL FT STPIYWRSAQRKYTWKGREYSR" atggtatcta tcctcgaggt ...
Glycogen and protein are both polymers. Explain why there can only be one type of glycogen molecule, but there can be many types of protein ...
Production of Viscous Dextran-Containing Whey-Sucrose Broths by Leuconostoc mesenteroides ATCC 14935: Viscous broths were produced by growing Leuconostoc mesent
GTF3C4兔多克隆抗体(ab74304)可与人样本反应并经IP, IHC实验严格验证。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
Limited information is available about homopolysaccharide synthesis in the genus Lactobacillus. Using efficient screening techniques, extracellular glucosyltransferase (GTF) enzyme activity, resulting in α-glucan synthesis from sucrose, was detected in various lactobacilli. PCR with degenerate primers based on homologous boxes of known glucosyltransferase (gtf) genes of lactic acid bacteria strains allowed cloning of fragments of 10 putative gtf genes from eight different glucan producing Lactobacillus strains (five Lactobacillus reuteri strains, one Lactobacillus fermentum strain, one Lactobacillus sake strain and one Lactobacillus parabuchneri strain). Sequence analysis revealed that these lactobacilli possess a large variation of (putative) gtf genes, similar to what has been observed for Leuconostoc and Streptococcus strains. Homologs of GTFA of Lb. reuteri 121 (synthesizing reuteran, a unique glucan with α(1 → 4) and α-(1 → 6) glycosidic bonds) (Kralj et al., 2002) were found in ...
Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mutans; Streptococcus mutans serotype c (strain ATCC 700610 / UA159 ...
Glucosylceramide synthase (GCS) catalyses the transfer of glucose from UDP-glucose (UDP-Glc) to ceramide to form glucosylceramide, the common precursor of most higher-order glycosphingolipids. Inhibition of GCS activity has been proposed as a possible target of chemotherapeutic agents for a number of diseases, including cancer. Design of new GCS inhibitors with desirable pharmaceutical properties is hampered by lack of knowledge of the secondary structure or catalytic mechanism of the GCS protein. Thus we cloned the rat homologue of GCS to begin studies to identify its catalytic regions. The histidine-modifying agent diethyl pyrocarbonate (DEPC) inhibited recombinant rat GCS expressed in bacteria; this inhibition was rapidly reversible by hydroxylamine and could be diminished by preincubation of GCS with UDP-Glc. These data suggest that DEPC acts on histidine residues within or near the UDP-Glc-binding site of GCS. Mutant proteins were expressed in which the eight histidine residues in GCS were
Author: Paredez, A. R. et al.; Genre: Journal Article; Published in Print: 2008; Open Access; Keywords: cell elongation|br/|arabidopsis-thaliana|br/|plasma-membrane|br/|phospholipase-d|br/|microfibril alignment|br/|plant-cells|br/|in-vivo|br/|tubulin|br/|growth|br/|mutants; Title: Genetic evidence that cellulose synthase activity influences microtubule cortical array organization
Sucrose phosphorylase (EC. 2.4.1.7) is an important enzyme in the metabolism of sucrose and regulation of other metabolic intermediates. Sucrose phosphorylase is in the c
Leuconostoc mesenteroides (Tsenkovskii) van Tieghem 1878, Leuconostoc dextranicum (Beijerinck) Hucker and Pederson 1930, and Leuconostoc cremoris (Knudsen and Sørensen) Garvie 1960 belong to a single deoxyribonucleic acid homology group. These three organisms have similar lactate dehydrogenases and glucose-6-phosphate dehydrogenases. Because of these common properties, these organisms are here regarded as subspecies within a single species, Leuconostoc mesenteroides. The names of the subspecies are Leuconostoc mesenteroides subsp. mesenteroides, Leuconostoc mesenteroides subsp. dextranicum (Beijerinck) comb. nov., and Leuconostoc mesenteroides subsp. cremoris (Knudsen and Sørensen) comb. nov. The type strains of these subspecies are ATCC 8293, NCDO 529, and NCDO 543, respectively.
TY - CONF. T1 - Sucrose Phosphorylase in Carbohydrate Synthesis - Mechanistic and Synthetic Considerations. AU - Gödl, Christiane. AU - Sawangwan, Thornthan. AU - Wildberger, Patricia. AU - Nidetzky, Bernd. PY - 2010. Y1 - 2010. M3 - Poster. ER - ...
The trehalose-6-phosphate synthase AtTPS I is involved in regulating sugar metabolism and partitioning in connection with plant morphogenesis and development in an as yet unknown fashion. AtTPS I expressed in yeast supports the synthesis of trehalose as well as an essential regulatory function in glucose consumption. The gene is essential for embryo development in Arabidopsis and its overproduction leads to sugar insensitivity as well as increased drought tolerance. Here we report on AtTPS I protein containing complexes in Arabidopsis and in yeast. AtTPS I co-migrated in FPLC separated extracts with 600-800 kDa protein complexes containing the cell cycle kinase CDKA; I and tubulin. In two hybrid experiments, the N-terminal domain of AtTPS I interacted with CDKA; I and the CDKA; I interacting kinesin KCA 1. In vitro precipitation tests using CDKA; I affinity beads showed that AtTPS 1 co-precipitated with KCA 1 and tubulin. This protein complex was predominantly observed in inflorescence tissue. ...