Spletni strežnik Apache, velikokrat samo Apache, je spletni strežnik, ki igra ključno vlogo pri širjenju spleta. Bil je prva alternativa Netscapeovemu spletnemu strežniku, trenutno znanemu kot spletni strežnik Sun Java System. Od aprila 1996 je Apache najbolj popularen HTTP strežnik na celem spletu. Od oktobra 2007 pa je bilo na Apachijevem strežniku postavljenih približno 48 % vseh spletnih strani. Uporablja ga 73,09%[1] vseh registriranih slovenskih domen. Ime »Apache« je bilo izbrano iz dveh razlogov: ...
On Sunday, August 24th at 3:20 am, a very large (6.0) earthquake struck the Napa Valley of California with most of the damage occurring in the old, historic part of town. I am heartbroken to see the images of some of my favorite buildings "red tagged" and literally shaken off their foundations with roofs collapsed, walls crumbled and windows blown out. My facebook feed is filled with photos of my friends homes and businesses and wineries in shambles. Picture the interior of your house. Now imagine someone picking it up, shaking it like mad, and then setting it back down. Everything fallen off the walls, dropped out of cupboards, broken glass and plates and heirlooms everywhere. No power...gas off because of the potential for leaks, no running water. That was downtown Napa this weekend. But Napans are strong and resilient. My heart was full hearing all the stories of neighbors helping neighbors. I am so happy to report that Napa Farmhouse 1885 is doing just fine...so, if you want to help, visit ...
TY - JOUR. T1 - High-resolution timing of cell cycle-regulated gene expression. AU - Rowicka-Kudlicka, Malgorzata. AU - Kudlicki, Andrzej. AU - Tu, Benjamin P.. AU - Otwinowski, Zbyszek. PY - 2007/10/23. Y1 - 2007/10/23. N2 - The eukaryotic cell division cycle depends on an intricate sequence of transcriptional events. Using an algorithm based on maximum-entropy deconvolution, and expression data from a highly synchronized yeast culture, we have timed the peaks of expression of transcriptionally regulated cell cycle genes to an accuracy of 2 min (≈1% of the cell cycle time). The set of 1,129 cell cycle-regulated genes was identified by a comprehensive analysis encompassing all available cell cycle yeast data sets. Our results reveal distinct subphases of the cell cycle undetectable by morphological observation, as well as the precise timeline of macromolecular complex assembly during key cell cycle events.. AB - The eukaryotic cell division cycle depends on an intricate sequence of ...
Antibody-mediated defense against pathogens typically requires complex interactions between antibodies and other constituents of the humoral and cellular immune systems. However, recent evidence indicates that some antibodies alone can inhibit pathogen function in the absence of complement, phagocytes, or NK cells. In this issue of the JCI, McClelland et al. have begun to elucidate the molecular bases by which antibodies alone can impact pathogen growth and metabolism. They show that mAbs specific for the polysaccharide capsule of the human pathogenic fungus Cryptococcus neoformans elicit diverse effects on fungal gene expression, lipid biosynthesis, susceptibility to amphotericin B, cellular metabolism, and protein phosphorylation. These data suggest that pathogens have the capacity to generate broad metabolic responses as a result of surface binding by pathogen-specific antibodies, effects that may hold therapeutic promise. ...
Antibody-mediated defense against pathogens typically requires complex interactions between antibodies and other constituents of the humoral and cellular immune systems. However, recent evidence indicates that some antibodies alone can inhibit pathogen function in the absence of complement, phagocytes, or NK cells. In this issue of the JCI, McClelland et al. have begun to elucidate the molecular bases by which antibodies alone can impact pathogen growth and metabolism. They show that mAbs specific for the polysaccharide capsule of the human pathogenic fungus Cryptococcus neoformans elicit diverse effects on fungal gene expression, lipid biosynthesis, susceptibility to amphotericin B, cellular metabolism, and protein phosphorylation. These data suggest that pathogens have the capacity to generate broad metabolic responses as a result of surface binding by pathogen-specific antibodies, effects that may hold therapeutic promise. ...
As a public service, the genomic sequence data and preliminary annotations for various fungal species are being made available before scientific publication by the Genozymes for Bioproducts and Bioprocesses Development Project which is funded primarily by Genome Canada. This website is being hosted and the data maintained at the Centre for Structural and Functional Genomics at Concordia University (Montreal, Quebec, Canada).. While early data release should aid scientific research and development, these pre-publication data are preliminary and may contain errors. The Genozymes for Bioproducts and Bioprocesses Development Project reserves the exclusive right to publish the genome annotation data, initial analyses on fungal gene expression under different growth conditions by means of transcriptomic and proteomic data analyses, comparative genomics analysis of these data with other fungal sequence data, and analyses of these data for distribution of protein domains and metabolic pathways.. By ...
BioAssay record AID 460553 submitted by ChEMBL: Antiaging effect in Saccharomyces cerevisiae K6001 expressing uth1 mutant assessed as extension of replicative life span after 2 days.
A.4 Naider, F., Son, C. A., Sargsyan, H., and Becker, J. M., Biochemical and mutagenic analysis of a G protein-coupled receptor: Photocrosslinking of the tridecapeptide alpha-Factor into Ste2p of Saccharomyces cerevisiae reveals contact points between the peptide and its receptor binding site. "3rd International Peptide Symposium/28th European Peptide Symposium", (2004), p.93-95 ...
The Snf1 protein kinase is a central component of the signaling pathway for glucose repression in yeast. Recent studies have addressed the regulation of Snf1 kinase activity and elucidated mechanisms by which Snf1 controls repression and activation of glucose-repressed genes. Important advances incl …
HapX positively regulates the levels of the CIR1 and RIM101 transcripts.Quantification of HAPX, CIR1 and RIM101 transcripts by quantitative RT-PCR in WT, hapXΔ
Preva*lence (?), n. [L. praevalentia: cf. F. prevalence. See Prevail.] The quality or condition of being prevalent; superior stre...
A central theme in biology is to understand how different signaling outputs can be accomplished by changes to signal transduction pathways. Here, we examined epigenetic differences between two cell states in the human fungal pathogen Candida albicans. We show that cells in the "white" state are sterile due to multiple bottlenecks in MAPK signaling relative to mating-competent "opaque" cells. Alleviation of these bottlenecks by reverse engineering effectively converts sterile white cells into sexually competent cells. These results have broad implications for understanding how epigenetic changes can impact MAPK expression and signaling output, including events associated with tumorigenesis. We also propose a model for how the white-opaque switch gained control of sexual reproduction in Candida during evolution.. ...
The last several years have been witness to significant developments in understanding transcriptional regulation of the yeast phospholipid structural genes. The response of most phospholipid structural genes to inositol is now understood on a mechanistic level. The roles of specific activators and repressors are also well established. The knowledge of specific regulatory factors that bind the promoters of phospholipid structural genes serves as a foundation for understanding the role of chromatin modification complexes. Collectively, these findings present a complex picture for transcriptional regulation of the phospholipid biosynthetic genes. The INO1 gene is an ideal example of the complexity of transcriptional control and continues to serve as a model for studying transcription in general. Furthermore, transcription of the regulatory genes is also subject to complex and essential regulation. In addition, databases resulting from a plethora of genome-wide studies have identified regulatory ...
Characterization of a glucose-repressed pyruvate kinase (Pyk2p) in Saccharomyces cerevisiae that is catalytically insensitive to fructose-1,6-bisphosphate ...
The analysis of nrg1Delta demonstrates that Nrg1 plays a role in glucose repression of the SUC2 and GAL genes of S. cerevisiae. Thus, three repressors, Nrg1, Mig1, and Mig2, are involved as the downstream targets of the glucose signaling in S. cerevisiae.
Saccharomyces cerevisiae sudah sejak lama digunakan sebagai starter fermentasi pembuatan roti dan minuman beralkohol. Dalam buku ini, Saccharomyces crervisiae dimanfaatkan sebagai agensia modifikasi dalam pengolahan pangan, kemampuan S. cerevisiae dalam merombak komponen pangan, produk metabolit yang dihasilkan oleh S. cerevisiae, modifikasi terhadap perubahan sifat beberapa produk pangan oleh S. cerevisiae seperti tapioka, tempe, dan modifikasi fermentasi kakao. Pengertian dasar mengenai khamir perlu dipahami oleh mahasiswa yang khususnya mempelajari mikrobiologi pangan, mikrobiologi industri dan teknologi pangan. S.cerevisiae adalah khamir ...
P. T. Spellman and G. Sherlock and M. Q. Zhang and V. R. Iyer and K. Anders and M. B. Eisen and P. O. Brown and D. Botstein and B. Futcher. "Comprehensive identification of cell cycle-regulated genes of the yeast Saccharomyces cerevisiae by microarray hybridization." Mol Biol Cell. 9(12):3273-97, 1998 ...
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
The Genetics Society of America (GSA), founded in 1931, is the professional membership organization for scientific researchers and educators in the field of genetics. Our members work to advance knowledge in the basic mechanisms of inheritance, from the molecular to the population level.. Online ISSN: 1943-2631. ...
ISW1-N小鼠多克隆抗体(ab43434)可与酿酒酵母样本反应并经WB, IP, ICC/IF实验严格验证。中国75%以上现货,所有产品提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
China Wholesale Animal Additive Yeast Saccharomyces Cerevisiae with High-Quality, Leading Wholesale Animal Additive Yeast Saccharomyces Cerevisiae Manufacturers & Suppliers, find Wholesale Animal Additive Yeast Saccharomyces Cerevisiae Factory & Exporters.
Author summary Genetically identical cells, even when they are exposed to the same environmental conditions, display incredible diversity. Gene expression noise is attributed to be a key source of this phenotypic diversity. Transcriptional dynamics is a dominant source of expression noise. Although scores of theoretical and experimental studies have explored how noise is regulated at the level of transcription, most of them focus on the gene specific, cis regulatory elements, such as the number of transcription factor (TF) binding sites, their binding strength, etc. However, how the global properties of transcription, such as the limited availability of TFs impact noise in gene expression remains rather elusive. Here we build a theoretical model that incorporates the effect of limiting TF pool on gene expression noise. We find that competition between genes for TFs leads to enhanced variability in mRNA copy number across an isogenic population. Moreover, for gene copies sharing TFs with other competitor
TY - BOOK. T1 - Environmental Stress Responses and Biological Interactions Investigated in the Drosophila Model System. AU - Ørsted, Michael. N1 - PhD supervisor: Professor Torsten Nygaard Kristensen, Department of Chemistry and Bioscience Aalborg University, Denmark. PY - 2017. Y1 - 2017. N2 - When organisms are faced with changes in their environment, they are forced to respond, if they are to maintain optimal function. Especially ectotherms must deal with environmental changes in e.g. temperature on a regular basis, and thus their survival and reproductive success depend on their ability to respond on a behavioral, physiological, morphological and/or evolutionary level according to the environmental cues.At the same time, if populations are small and fragmented, and have limited gene flow, environmental change and environmental stress might interact with intrinsic genetic stress such as inbreeding and genetic drift, which can exacerbate the effects of one or more environmental stresses. ...
Evolution of multigene families are considered in the review on the example of the PHO gene family encoding the structure of acid phosphatases in the yeast Saccharomyces cerevisiae. Analysis of the...
Saccharomyces cerevisiae ATCC ® 201390D-5™ Designation: Genomic DNA from Saccharomyces cerevisiae Strain BY4743 (ATCC ® 201390™) Application:
Saccharomyces cerevisiae ATCC ® 201389D-5™ Designation: Genomic DNA from Saccharomyces cerevisiae Strain BY4742 (ATCC ® 201389™) Application:
MOTIZUKI, M., MITSUI, K., ENDO, Y. and TSURUGI, K. (1986), Detection and partial characterization of the chromatin-associated proteases of yeast Saccharomyces cerevisiae. European Journal of Biochemistry, 158: 345-350. doi: 10.1111/j.1432-1033.1986.tb09757.x ...
Yeast Saccharomyces cerevisiae in vivo Prp8 splicing assay(A) Schematic representation of the two-step splicing pathway (SS, splice site; BS, branch site). Brie
1P-022 Saccharomyces cerevisiaeの糖代謝における転写制御ネットワークの予測(遺伝子工学,一般講演)1P-022 Saccharomyces cerevisiaeの糖代謝における転写制御ネットワークの予測(遺伝子工学,一般講演)AN10549378 ...
The Saccharomyces Cerevisiae Morphological Database(SCMD) is a collection of micrographs of budding yeast mutants. Micorgraphs of mutants with altered cell morphology were taken at Ohya Group, University of Tokyo, from a set of the haploid MATa deleted strains obtained from EUROSCARF. From the micrographs, disruptant cells are automatically extracted by our novel cell-image processing software developed at Morishita Group, University of Tokyo. Heterozygous essential gene deletion set, DAmP collection set, natural yeast strain set and others were analyzed by this software. ...
Domain architecture and assignment details (superfamily, family, region, evalue) for YLR222C from Saccharomyces cerevisiae SGD. Plus protein sequence and external database links.
Tetes tebu merupakan limbah pengolahan gula yang mengandung gula cukup tinggi sehingga sangat potensial dimanfaatkan sebagai media fermentasi. Fermentasi tetes tebu untuk menghasilkan bioetanol menjadi salah satu upaya megurangi jumlah limbah dan memenuhi kebutuhan Bahan Bakar Minyak (BBM) yang semakin meningkat. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh pH dan lama fermentasi terhadap produksi bioetanol dari tetes tebu (molase) dengan cara fermentasi menggunakan Saccharomyces cerevisiae. Penelitian ini meliputi proses fermentasi dan pemisahan bioetanol dari media fermentasi. Proses fermentasi dilakukan dengan variasi pH 4, 4,5, dan 5, sedangkan variasi lama fermentasi dilakukan selama 3, 4, 5, dan 6 hari. Bioetanol hasil fermentasi dipisahkan dari media fermentasi dengan metode destilasi fraksinasi dan untuk mengukur kadar bioetanol digunakan metode kromatografi gas. Data yang diperoleh pada setiap perlakuan dianalisis menggunakan analisis varians (ANOVA) dan dilanjutkan ...
Saccharomyces cerevisiae Y12 - Organisms are classified by taxonomy into specified groups such as the multicellular animals, plants, and fungi; or unicellular microorganisms such as a protists, bacteria, and archaea.
Gene target information for PRB1 - proteinase B (Saccharomyces cerevisiae S288C). Find diseases associated with this biological target and compounds tested against it in bioassay experiments.
Pl ss baba mikr b form ban, alkalmas mint sz rakoztat aj nd k, vagy mint tan t eszk z sz l knek s tan roknak. Az leszt gomba vagy s r leszt (Saccharomyces cerevisiae) a sarjadz - vagy leszt gomb k egy fajt ja. A korai id k ta ez a legfontosabb leszt faj - a keny rs t sn l s s rf z sn l haszn lj k. Els k nt a sz l h j n izol lt k (a s t t sz n gy m lcs k mint a...
Author: Stagge, F.; Genre: Thesis; Published in Print: 2010; Title: Etablierung neuartiger Fluoreszenzmarkierungen in der Bäckerhefe Saccharomyces cerevisiae für die hochauflösende Mikroskopie mitochondrialer Proteine.
Please enjoy this information on EpiCor made available through the generosity of Embrias adoption. Information on EpiCor, yeast fermentate, Saccharomyces cerevisiae.
Shop Transcriptional regulator of filamentous growth ELISA Kit, Recombinant Protein and Transcriptional regulator of filamentous growth Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Conidiation in the filamentous ascomycete Aspergillus nidulans requires activation of brlA, a well-characterized transcriptional regulator of genes that are induced specifically during asexual develop
A BioProject is a collection of biological data related to a single initiative, originating from a single organization or from a consortium. A BioProject record provides users a single place to find links to the diverse data types generated for that project
tgctgcttgtgccgcaagggacgcagacgttgaaaaagctgctctaaaaatgtttactga ttattgcagcggtaataaggaagccatcccagcattgattaaaccaattgtatttaacac tgtggcaagagttggtggtgcagaaaactatgaaaaagtttacaaaatctacttagatcc aatctctaacgatgaaaaattagccgcattaagatctttaggcagatttaaagaacctaa attattagaaagaaccttaggatatttgtttgatggcactgtcttaaaccaagacattta tattccaatgcaaggaatgagagctcatcaagaaggtgtagaggctttgtggaattgggt taaaaagaactgggacgaactcgtaaagagactacctcctggtctttcaatgctaggctc cgtcgtcacattaggtacctctggctttacatcaatgcaaaaaatagatgagattaagaa attctttgccactaaatccacgaaaggtttcgatcaaagtttggctcaatcactggacac tattacttcgaaagcgcagtggggttaacagagaccgtgatgtcgtcaacaagtatttga aggaaaatggttactattaagaaaaaatctcttttctagccattttgcctttttatatag tcaagtatctatatgtgacaaatacttcttctaagcttggccttctgataggcttagctt gcagtggttgcaaacatacataaatcaacaaaaaagtacggcttaaaattttggtattca tttatttcaacccgtgcacactggaaataaatctgtacataacagcatattttgtttttg aaaaaatttctgtgttcctccgatgtgggaagaattttaggatcggctaaatttcgtaaa gtatcagtaacttggtatctctgtataagcggagtctaatttcgataacaagcaacttca ...
Riles, L., Dutchik, J.E., Baktha, A., McCauley, B.K., Thayer, E.C., Leckie, M.P., Braden, V.V., Depke, J.E., Olson, M.V. (1993) Physical maps of the six smallest chromosomes of Saccharomyces cerevisiae at a resolution of 2.6 kilobase pairs. Genetics 134(1):81-150. PMID:8514151 ...
Riles, L., Dutchik, J.E., Baktha, A., McCauley, B.K., Thayer, E.C., Leckie, M.P., Braden, V.V., Depke, J.E., Olson, M.V. (1993) Physical maps of the six smallest chromosomes of Saccharomyces cerevisiae at a resolution of 2.6 kilobase pairs. Genetics 134(1):81-150. PMID:8514151 ...
Saccharomyces cerevisiae cells require two genes, CSG1/SUR1 and CSG2, for growth in 50 mM Ca2+, but not 50 mM Sr2+. CSG2 was… Expand ...
File Title: An Improved Method for the Isolation of A^2-IPP:tRNA Isopente-nyltransferase Activity from Saccharomyces cerevisiae ...
多种适用的INO80BELISA试剂盒,如等。在antibodies-online.cn对比INO80BELISA试剂盒,以便找到您需要的产品。
Gentaur molecular products has all kinds of products like :search , SibEm \ Sbf I \ E101 for more molecular products just contact us
This chapter examines how cell identity influences mating-type determination, particularly in fungal pathogens. It explores cases where cell identity plays roles outside of mating type, affects cell morphology, and influences pathogenesis. The chapter begins with a description of cell type determination in the budding yeast Saccharomyces cerevisiae and uses this as a platform for exploring mechanisms in the human fungal pathogens Candida albicans and Cryptococcus neoformans as well as the plant fungal pathogen Ustilago maydis. It concludes with a short description of the influence of cell identity on the behaviors of several other plant and human fungal pathogens and how cell identity in fungi is evolving to encompass a more diverse array of fungal behaviors. A fungal pathogen in which cell identity determination has come to the fore is in the basidiomycete fungus C. neoformans. There are two obvious possibilities for specifying haploid cell identity: either the pheromone and pheromone receptor alleles
The Saccharomyces cerevisiae deletion collection was screened for impaired growth on glucose-based complex medium containing 6% ethanol. Forty-six mutants were found. Genes encoding proteins involved in vacuolar function, the cell integrity pathway, mitochondrial function, subunits of the co-chaperone complex GimC and components of the SAGA transcription factor complex were in this way found to be important for the growth of wild-type Saccharomyces yeast in the presence of ethanol. Several mutants were also sensitive to Calcofluor white (14 mutants), sorbic acid (9), increased temperature (5) and NaCl (3). The transcription factors Msn2p and Ars1p, tagged with green fluorescent protein, were translocated to the nucleus upon ethanol stress. Only one of the genes that contain STRE elements in the promoter was important under ethanol stress; this was TPS1, encoding trehalose 6-phosphate synthase. The map kinase of the cell integrity pathway, Slt2p, was phosphorylated when cells were treated with 6% ...
THE opportunistic fungal pathogen, Candida albicans, grows invasively in tissues of candidiasis patients by converting from budding yeast form cells to filamentous forms. The ability to convert from one morphology to another is important for virulence (Sobelet al. 1984; Shepherd 1985; Ryley and Ryley 1990; Lebereret al. 1997; Loet al. 1997). To understand the mechanisms by which filamentous growth is stimulated during infection, regulation of hyphal development has been studied extensively (for review, see Gow 1997). Conditions that promote hyphal growth in the laboratory include growth at elevated temperature in medium containing special components. In the absence of these conditions, growth within a matrix also promotes hyphal growth (Brownet al. 1999). The embedded condition may simulate conditions encountered by the pathogen during growth in human tissue.. Several genes whose products regulate filamentous growth have been identified (for review, see Ernst 2000), including CPH1 (Liuet al. ...
During the production of wine and beer, the yeast Saccharomyces cerevisiae can encounter an environment that is deficient in zinc, resulting in a sluggish or a stuck ferment. It has been shown that the Zap1p-transcription factor induces the expression of a regulon in response to zinc deficiency; however, it was evident that a separate regulon was also activated during zinc deficiency in a Zap1p-independent manner. This study discovered the Msn2p and Msn4p (Msn2/4p) transcriptional activator proteins to be an additional control mechanism inducing the stress response during zinc deficiency. Promoter sequence analysis identified the stress response element (STRE) motif, recognized by Msn2/4p, and was significantly enriched in the promoters of genes induced by zinc deficiency. An investigation using genome-wide analyses revealed a distinct regulon consisting of STREcontaining genes whose zinc-responsive expression was abolished in an msn2 msn4 double mutant. An STRE-driven lacZ reporter ...
We have cloned a Candida albicans gene (CaMIG1) that encodes a protein homologous to the DNA-binding protein Mig1 from Saccharomyces cerevisiae (ScMig1). The C. albicans Mig1 protein (CaMig1) differs from ScMig1, in that, among other things, it lacks a putative phosphorylation site for Snf1 and presents several long stretches rich in glutamine or in asparagine, serine, and threonine and has the effector domain located at some distance (50 amino acids) from the carboxy terminus. Expression of CaMIG1 was low and was similar in glucose-, sucrose-, or ethanol-containing media. Disruption of the two CaMIG1 genomic copies had no effect in filamentation or infectivity. Levels of a glucose-repressible alpha-glucosidase, implicated in both sucrose and maltose utilization, were similar in wild-type or mig1/mig1 cells. Disruption of CaMIG1 had also no effect on the expression of the glucose-repressed gene CaGAL1. CaMIG1 was functional in S. cerevisiae, as judged by its ability to suppress the phenotypes ...
The highly conserved pheromone response MAP kinase and nutrient-sensing cAMP/PKA signal pathways are critical for filamentation, mating and virulence in many pathogenic fungi. A comparison of their functions in two human pathogens Candida albicans and Cryptococcus neoformans, and in two plant pathogens, Magnaporthe grisea and Ustilago maydis, shows that virulence is tightly associated with filamentation and mating in these fungi, suggesting an evolutionary link between pathogenesis and cellular development. ...
EN] Mot3 and Rox1 are transcriptional repressors of hypoxic genes. Both factors recently have been found to be involved in the adaptive response to hyperosmotic stress, with an important function in the adjustment of ergosterol biosynthesis. Here, we determine the gene expression profile of a mot3 rox1 double mutant under acute osmostress at the genomic scale in order to identify the target genes affected by both transcription factors upon stress. Unexpectedly, we find a specific subgroup of osmostress-inducible genes to be under positive control of Mot3. These Mot3-activated stress genes also depend on the general stress activators Msn2 and Msn4. We confirm that both Mot3 and Msn4 bind directly to some promoter regions of this gene group. Further-more, osmostress-induced binding of the Msn2 and Msn4 factors to these target promoters is severely affected by the loss of Mot3 function. The genes repressed by Mot3 and Rox1 preferentially encode proteins of the cell wall and plasma membrane. Cell ...
gi,7493813,pir,,T18235 transcription activator GAL11 homolog - yeast (Candida albicans) gi,3859719,emb,CAA21993.1, possible regulatory protein [Candida albicans] Length = 1145 Score = 1094 bits (2830), Expect = 0.0 Identities = 678/1145 (59%), Positives = 678/1145 (59%) Query: 1 MNIPPNQNSLQQMGGGSNPNASWRAMYSGEERQKVVQIIINTLTELHGSNPNFNVQRLSK 60 MNIPPNQNSLQQMGGGSNPNASWRAMYSGEERQKVVQIIINTLTELHGSNPNFNVQRLSK Sbjct: 1 MNIPPNQNSLQQMGGGSNPNASWRAMYSGEERQKVVQIIINTLTELHGSNPNFNVQRLSK 60 Query: 61 MAQDFEKLVYERSASKEDYLRAIKMKVHQLRVQKQQIAAXXXXXXXXXXXXXXXXXXXXX 120 MAQDFEKLVYERSASKEDYLRAIKMKVHQLRVQKQQIAA Sbjct: 61 MAQDFEKLVYERSASKEDYLRAIKMKVHQLRVQKQQIAANQGGQINPQQRQQQQQQQISN 120 Query: 121 XXSMNPVNAQNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180 SMNPVNAQNV Sbjct: 121 SNSMNPVNAQNVQFLRQQAQARSQSQAQIQARQQQLRNMVNQQSQQQQQPQPQQTVQPQS 180 Query: 181 XXXXXXXXXXXXXXXXXNVXXXXXXXXXXXXXXTQGQLPPQLVNLMRTSXXXXXXXXXXX 240 NV TQGQLPPQLVNLMRTS Sbjct: 181 QEHQQDQQNTSSQSTQQNVASGAGSGGRGNASSTQGQLPPQLVNLMRTSPIPPPLLNKMP 240 Query: ...
Read "The Genetic Control of Cell Growth and Development in Yeast Saccharomyces cerevisiae: Disturbed Sporulation in Diploids with a Decreased Activity of the Ras/cAMP Signal Transduction Pathway, Russian Journal of Genetics" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
TY - JOUR. T1 - Increased stress parameter synthesis in the yeast Saccharomyces cerevisiae after treatment with 4-hydroxy-2-nonenal. AU - Wonisch, Willibald. AU - Hayn, Marianne. AU - Schaur, Jörg. AU - Tatzber, Franz. AU - Kranner, Ilse. AU - Grill, Dieter. AU - Winkler, Rudolf. AU - Bilinski, Tomasz. AU - Kohlwein, Sepp-Dieter. AU - Esterbauer, Hermann. PY - 1997. Y1 - 1997. U2 - 10.1016/S0014-5793(97)00123-3. DO - 10.1016/S0014-5793(97)00123-3. M3 - Article. VL - 405. SP - 11. EP - 15. JO - FEBS letters. JF - FEBS letters. SN - 0014-5793. IS - 1. ER - ...
This unit presents detailed protocols for a range of centrifugation‐based subcellular fractionation procedures for the yeast Saccharomyces cerevisiae
Getting Better Intestinal Health through the Addition of Yeast (Saccharomyces Cerevisiae) Combined with Threonine in Broilers Diets
I use this paper in my graduate genetics course. It describes a global screen for synthetic defects involving DNA integrity, which reveals a network of 16 functional modules. The paper illustrates screens based on genetic interactions (in this case, synthetic lethality or fitness defects) and the systems biology used to evaluate the results of such a screen. It also illustrates the use of Saccharomyces cerevisiae as a model system ...
Biosprint® is an active yeast (Saccharomyces cerevisiae MUCL 39885) used for animal feed. Biosprint is authorized by the European Union as feed additive for piglets, cattle for fattening, dairy cows, horses and sows.
Candida albicans CZF1 protein: Candida albicans gene that interferes with Saccharomyces cerevisiae mating factor-induced cell cycle arrest; amino acid sequence given in first source
Domain architecture and assignment details (superfamily, family, region, evalue) for YDR316W-B from Saccharomyces cerevisiae SGD. Plus protein sequence and external database links.
We present experimental evidence for the existence of multiple activator-binding sites in the upstream sequence of the ompC promoter, the expression of which is activated by the positive regulator OmpR in response to the osmolarity of the medium. We also found that a single OmpR-binding site can activate the ompC promoter, providing that the binding site is close and placed stereospecifically with respect to the canonical-35 and -10 regions. ...
A time lapse experiment of Saccharomyces cerevisiae expressing GFP tagged Cdc15, a protein kinase involves in cytokinesis. These phase and GFPimages ...
A time lapse experiment of Saccharomyces cerevisiae expressing GFP-tagged TEM1. TEM1 is a GTP-binding protein of the ras superfamily involved in te...
Functional Overlap between eIF4G Isoforms in Saccharomyces cerevisiae. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
The optimum pH range of saccharomyces cerevisiae is typically between four and six in the pH scale, as claimed by a 2005 study conducted by Neelakantam V. Narendranath and Ronan Power, which was...
Du, N., Stillman, B. (2001) Identification and characterization of ORC-interacting protein: Yph1p in Saccharomyces cerevisiae. Clinical Cancer Research, 7 (11). 3793S-3793S. ISSN 1078-0432 ...
Saccharomyces cerevisiae is a species of yeast. It is believed to be isolated from the skin of grapes. It is one of the most intensively studied eukaryot..
The filamentous fungus, Aspergillus nidulans, genome contains at least five chitin synthase-encoding genes. chsB is essential for normal hyphal growth. chsA and chsC are likely to be cooperatively req
Yeast relevance is related to the easy determination of the link between gene and protein function (Botstein and Fink 1988). Based on the high evoluti...
Your basket is currently empty. i ,p>When browsing through different UniProt proteins, you can use the basket to save them, so that you can back to find or analyse them later.,p>,a href=/help/basket target=_top>More...,/a>,/p> ...
is a top fermenter, meaning it tends to migrate to the top of fluids in which it feeds by maintaining contact with the bubbles of carbon dioxide it ...
Nothing is more precious than life…" Phileo Lesaffre Animal Care: Working at the Cross Roads of Nutrition and Health By Steve Weisman Consumers are becoming more and more in tune with what they eat, where their food comes from and how it is grown. At the same time, farmers ...
Die Universität zu Köln ist eine Exzellenzuniversität mit dem klassischen Fächerspektrum einer Volluniversität. Als eine der größen Hochschulen Europas arbeitet sie in Forschung und Lehre auch international auf höchstem Niveau.
Do you really want to delete this prezi? Neither you, nor the coeditors you shared it with will be able to recover it again. DeleteCancel ...
We are having trouble making good native S. cerevisiae lysates. Generally (in the cold room) we beat a concentrated cell slurry with an equal volume of 0.45 uM glass beads for 5 x 30 sec using a hand vortexer set at the highest speed or for 2 min using a VWR multi vortexer. While we dont have much of a problem with protein degradation using this method, our yields of protein are quite low. When we have tried increasing the time we beat the cells, we get degradation. Does anyone have a breakage method they really like for native lysates? Thanks. Debbie Nathan ...
garsejades precisessen esbardissesses aixaragallà gallofejàssiu coacerven acugulà acensaran aulari sobrealimento deslliguéssiu cercaran desclassaríem ...
SALEH, D., XU, P., SHEN, Y., LI, C., ADREIT, H., MILAZZO, J., RAVIGNÉ, V., BAZIN, E., NOTTÉGHEM, J.-L., FOURNIER, E. and THARREAU, D. (2012), Sex at the origin: an Asian population of the rice blast fungus Magnaporthe oryzae reproduces sexually. Molecular Ecology, 21: 1330-1344. doi: 10.1111/j.1365-294X.2012.05469.x ...
Molecular Plant-Microbe Interactions 23:317-331...Ya Li,1 Xia Yan,1 Hong Wang,1 Shen Liang,1 Wei-Bin Ma,1 Min-Yan Fang,1 Nicholas J. Talbot,2 and Zheng-Yi Wang1,3...© 2010 The American Phytopathological Society...
TY - JOUR. T1 - Candida albicans ABG1 gene is involved in endocytosis. AU - Veses, Veronica. AU - Casanova, Manuel. AU - Murgui, Amelia. AU - Gow, Neil A R. AU - Martínez, José P. PY - 2009/3. Y1 - 2009/3. N2 - The human fungal pathogen Candida albicans undergoes reversible morphogenetic transitions between yeast, hyphal and pseudohyphal forms. The fungal vacuole actively participates in differentiation processes and plays a key role supporting hyphal growth. The ABG1 gene of C. albicans encodes an essential protein located in the vacuolar membranes of both yeast and hyphae. Using fluorescence microscopy of a green fluorescent protein-tagged version of Abg1p, a fraction of the protein was detected in hyphal tips, not associated with vacuolar membranes. Live cell imaging of emerging germ tubes showed that Abg1p migrated to the polarized growth site and colocalized with endocytic vesicles. Phenotypic analysis of a methionine-regulated conditional mutant confirmed that Abg1p is involved in ...
MITUSHI BIOPHARMA- Manufacturer & Supplier Of Saccharomyces Cerevisiae Dry Yeast In Gujarat,India. Find More Detail For Saccharomyces Cerevisiae Dry Yeast Manufacturers & Suppliers In Gujarat,India
Phosphomannosylation is a modification of cell wall proteins that occurs in some species of yeast-like organisms, including the human pathogen Candida albicans. These modified mannans confer a negative charge to the wall, which is important for the interactions with phagocytic cells of the immune systems and cationic antimicrobial peptides. In Saccharomyces cerevisiae, the synthesis of phosphomannan relies on two enzymes, the phosphomannosyltransferase Ktr6 and its positive regulator Mnn4. However, in C. albicans, at least three phosphomannosyltransferases, Mnn4, Mnt3 and Mnt5, participate in the addition of phosphomannan. In addition to MNN4, C. albicans has a MNN4-like gene family composed of seven other homologous members that have no known function. Here, using the classical mini-Ura-blaster approach and the new gene knockout CRISPR-Cas9 system for gene disruption, we generated mutants lacking single and multiple genes of the MNN4 family; and demonstrate that, although Mnn4 has a major impact on the
Largescale analysis of filamentous growth in. Largescale analysis of filamentous growth in saccharomyces cerevisiae candida albicans by especially like to thank my thesis committee members, Saccharomyces cerevisiae and candida albicansderived. Saccharomyces cerevisiae and candida albicansderived mannan triggered production of tumor necrosis thing alpha by way of saccharomyces cerevisiae/metabolism; sign. Pali area proteins of saccharomyces cerevisiae […]. Continue reading ...
AIM: The aim of this study was to analyse the relevance of the general amino acid permease gene (GAP1) of the wine yeast Saccharomyces cerevisiae on nitrogen metabolism and fermentation performance. METHODS AND RESULTS: We constructed a gap1 mutant i
To determine whether the C. albicans MTL gene cluster was required for the a1/α2-like repression activity, theGFP reporters were transformed into MTLa1deletion strains and evaluated for fluorescence. In contrast to the wild-type C. albicans strains, the MTLa1 mutant strains showed the same levels of fluorescence for all of the reporter constructs, indicating that the MTLa1 gene is required for the transcriptional repression activity (Fig. 4). Similar behavior was seen for both the complete deletion of the MTLa1 gene and for the MTLa1 homeodomain deletion, consistent with the DNA-binding domain of a1 being required for the repression activity (9). Northern (RNA) analysis also showed that transcription from the reporter constructs containing the functional hsg operators was derepressed in the MTLa1deletion mutants compared with the wild-type strain; however, in the absence of a1, the functional hsg operators still showed a slight amount of repression when compared with the mutated hsg operators ...
Autophagy is an intracellular process responsible for the degradation and recycling of cytoplasmic components. It selectively removes harmful cellular material and enables the cell to survive starvation by mobilizing nutrients via the bulk degradation of cytoplasmic components. While research over the last decades has led to the discovery of the key factors involved in autophagy, the pathway is not yet completely understood. The first studies of autophagy on a molecular level were conducted in the yeast Saccharomyces cerevisiae. Building up on these studies, many homologs have been found in higher eukaryotes. Yeast remains a highly relevant model organism for studying autophagy, with a wide range of established methods to elucidate the molecular details of the autophagy pathway. In this review, we provide an overview of methods to study both selective and bulk autophagy, including intermediate steps in the yeast Saccharomyces cerevisiae. We compare different assays, discuss their advantages and
The Pumilio family (PUF) proteins are conserved among the eukaryotes (42). They bind to specific sequences in the 3′ untranslated region (3′UTR) of target transcripts via their conserved and characteristic PUF domain and thereby inhibit the stability or translatability of these target mRNAs (32, 50). Indeed, the PUF domain appears sufficient for PUF proteins to affect their target transcripts (32, 50). Five PUF proteins, Puf1p to Puf5p, were thought to exist in the budding yeast Saccharomyces cerevisiae (37, 49). A sixth, Puf6p, has recently been reported (9). None are essential (9, 37, 49). One of the yeast PUF proteins, Mpt5p, also known as Htr1p (23), Puf5p (37), or Uth4p (20), promotes replicative life span (3, 20, 21), the number of generations a virgin daughter cell can undergo before becoming senescent. Mpt5p is a robust regulator of ageing, since it also affects life span in a long-lived genetic background (17).. In addition to displaying a short replicative life span, mutants ...
In Saccharomyces cerevisiae, disruption of the YCF1 gene increases the sensitivity of cell growth to mercury. Transformation of the resulting ycf1 null mutant with a plasmid harbouring YCF1 under the control of the GAL promoter largely restores the wild-type resistance to the metal ion. The protective effect of Ycf1p against the toxicity of mercury is especially pronounced when yeast cells are grown in rich medium or in minimal medium supplemented with glutathione. Secretory vesicles from S. cerevisiae cells overproducing Ycf1p are shown to exhibit ATP-dependent transport of bis(glutathionato)mercury. Moreover, using beta-galactosidase as a reporter protein, a relationship between mercury addition and the activity of the YCF1 promoter can be shown. Altogether, these observations indicate a defence mechanism involving an induction of the expression of Ycf1p and transport by this protein of mercury-glutathione adducts into the vacuole. Finally, possible coparticipation in mercury tolerance of other ABC
Saccharomyces Cerevisiae Yeast Cells Sem Scanning as a 8x6 Glass Mount from CMSP Photo Prints. Fast and safe delivery. Saccharomyces Cerevisiae Yeast Cells. these Microorganisms Fungi are Used to Raise Bread Dough the Yeasts Produce
It is essential when studying the circadian rhythm in cells to be able to effectively stop them in time. In this experiment, we tested what would be the most successful killing agent on Saccharomyces cerevisiae. Six different agents were tested at different concentrations and amounts. After the S. cerevisiae was added to the test tube containing the agent, it was streaked on a plate after 5 and 10 minutes. The plates were incubated and then checked for growth. Ethanol was the most efficient killing agent. After an effective killing agent is determined, it can be used in further experiments measuring Gapdehydrogenase activity using a colorimetric assay to examine the circadian rhythm in Saccharomyces cerevisiae. Gapdehydrogenase results will also be presented.
TamA interacts with LeuB, the homologue of Saccharomyces cerevisiae Leu3p, to regulate gdhA expression in Aspergillus nidulans Journal Articles Refereed ...
Algerghina, L.; Porro, D.; Martegani, E.; Ranzi, B.M., 1991: Ethanol and biomass production from whey lactose by an engineered Saccharomyces cerevisiae strain
The addition of glucose to Saccharomyces cerevisiae cells causes reprogramming of gene expression. Glucose is sensed by membrane receptors as well as (so far elusive) intracellular sensing mechanisms. The availability of four yeast strains that display different hexose uptake capacities allowed us to study glucose-induced effects at different glycolytic rates. Rapid glucose responses were observed in all strains able to take up glucose, consistent with intracellular sensing. The degree of long-term responses, however, clearly correlated with the glycolytic rate: glucose-stimulated expression of genes encoding enzymes of the lower part of glycolysis showed an almost linear correlation with the glycolytic rate, while expression levels of genes encoding gluconeogenic enzymes and invertase (SUC2) showed an inverse correlation. Glucose control of SUC2 expression is mediated by the Snf1-Mig1 pathway. Mig1 dephosphorylation upon glucose addition is known to lead to repression of target genes. Mig1 was
Studies in yeast and mammalian cells have identified the cyclin C-Cdk8p complex as a critical component of gene expression in response to extracellular signals during stress response, differentiation, and development [reviewed in Nemet et al. (2014)]. Work in yeast demonstrated that cyclin C-Cdk8p repress the transcription of many genes involved in diauxic shift and metabolism (Holstege et al. 1998; van de Peppel et al. 2005). Many molecular targets have been identified as important mediators of locus-specific transcriptional controls by cyclin C-Cdk8p. First, in vitro and in vivo studies indicate that the CDK8 complex prevents association between RNA pol II and the core mediator, thus inhibiting transcription (Naar et al. 2002; Knuesel et al. 2009; Ebmeier and Taatjes 2010). Second, the cyclin C-Cdk8p kinase phosphorylates transcriptional activators of stress responsive genes, including Ste12p, Phd1p, Msn2p, and Gcn4p, to stimulate their proteolysis (Nelson et al. 2003; Raithatha et al. 2012). ...
The angelic acid moiety represents an essential modification in many biologically active products. These products are commonly known as angelates and several studies have demonstrated their therapeutic benefits, including anti-inflammatory and anti-cancer effects. However, their availability for use in the development of therapeutics is limited due to poor extraction yields. Chemical synthesis has been achieved but its complexity prevents application, therefore microbial production may offer a promising alternative. Here, we engineered the budding yeast Saccharomyces cerevisiae to produce angelyl-CoA, the CoA-activated form of angelic acid. For yeast-based production of angelyl-CoA we first expressed genes recently identified in the biosynthetic cluster ssf of Streptomyces sp. SF2575 in S. cerevisiae. Exogenous feeding of propionate and heterologous expression of a propionyl-CoA synthase from Streptomyces sp. were initially employed to increase the intracellular propionyl-CoA level, resulting in
The biological interpretation of genetic interactions is a major challenge. Recently, Kelley and Ideker proposed a method to analyze together genetic and physical networks, which explains many of the known genetic interactions as linking different pathways in the physical network. Here, we extend this method and devise novel analytic tools for interpreting genetic interactions in a physical context. Applying these tools on a large-scale Saccharomyces cerevisiae data set, our analysis reveals 140 between-pathway models that explain 3765 genetic interactions, roughly doubling those that were previously explained. Model genes tend to have short mRNA half-lives and many phosphorylation sites, suggesting that their stringent regulation is linked to pathway redundancy. We also identify pivot proteins that have many physical interactions with both pathways in our models, and show that pivots tend to be essential and highly conserved. Our analysis of models and pivots sheds light on the organization of the
Isolation and Characterization of Essential Genes of Saccharomyces cerevisiae Required for the Efficient Nucleocytoplasmic Trafficking of mRNA A thesis submitted to the faculty in partial fulfillment of the requirements for the degree of Doctor of Philosophy by David Charles Amberg Dartmouth College Hanover, New Hampshire July 21, 1992 ...
Winters MJ, Pryciak PM. Interaction with the SH3 domain protein Bem1 regulates signaling by the Saccharomyces cerevisiae p21-activated kinase Ste20. Mol Cell Biol. 2005 Mar; 25(6):2177-90 ...