Class I proteins form a protonated Schiff base intermediate linking a highly conserved active site lysine with the DHAP carbonyl carbon. Additionally, tyrosine residues are crucial to this mechanism in acting as stabilizing hydrogen acceptors. Class II proteins use a different mechanism which polarizes the carbonyl group with a divalent cation like Zn2+. The Escherichia coli galactitol operon protein, gatY, and N-acetyl galactosamine operon protein, agaY, which are tagatose-bisphosphate aldolase, are homologs of class II fructose-bisphosphate aldolase. Two histidine residues in the first half of the sequence of these homologs have been shown to be involved in binding zinc.[1] The protein subunits of both classes each have an α/β domain folded into a TIM barrel containing the active site. Several subunits are assembled into the complete protein. The two classes share little sequence identity. With few exceptions only class I proteins have been found in animals, plants, and green algae.[2] With ...
Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related housekeeping genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. [provided by RefSeq, ...
CP001966.PE498 Location/Qualifiers FT CDS 540292..541320 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Tpau_0511" FT /product="fructose-bisphosphate aldolase, class II" FT /note="KEGG: rha:RHA1_ro05536 fructose-bisphosphate FT aldolase; TIGRFAM: fructose-bisphosphate aldolase, class FT II; ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate FT aldolase class-II" FT /db_xref="EnsemblGenomes-Gn:Tpau_0511" FT /db_xref="EnsemblGenomes-Tr:ADG77152" FT /db_xref="GOA:D5US85" FT /db_xref="InterPro:IPR000771" FT /db_xref="InterPro:IPR006411" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:D5US85" FT /inference="protein motif:TFAM:TIGR01520" FT /protein_id="ADG77152.1" FT /translation="MPIATPEAYREMLDRARKGGYAFPAINCTSSETINAAIKGFADAG FT SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFAHVVAAKYDVTVALHTDHCPKDKLDG FT LVRPLLEISQERVNNGQNPLFQSHMWDGSAVPLEENLEIAQELLAKCKAANIILEIEIG FT VVGGEEDGVENEINDKLFTSNEDFAKTVDALGTDGYLLAATFGNVHGVYKPGNVKLRPS FT VLRDGQAVAAQKQGLPEGSKPFSFVFHGGSGSLKSEIEESLSYGVVKMNVDTDTQYAFT ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Aldolase A (ALDOA, or ALDA), also known as fructose-bisphosphate aldolase, is an enzyme that in humans is encoded by the ALDOA gene on chromosome 16. The protein encoded by this gene is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Aug 2011] ALDOA is a homotetramer and one of the ...
The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10 ...
Fructose-bisphosphate aldolase (EC 4.1.2.13), often just aldolase, is an enzyme catalyzing a reversible reaction that splits the aldol, fructose 1,6-bisphosphate, into th
Fructose 1-phosphate, also known as D-fructose-1-p, belongs to the class of organic compounds known as hexose phosphates. These are carbohydrate derivatives containing a hexose substituted by one or more phosphate groups. Fructose 1-phosphate is an extremely weak basic (essentially neutral) compound (based on its pKa). Metabolism of fructose thus essentially results in intermediates of glycolysis. The final product of glycolysis (pyruvate) may then undergo gluconeogenesis, enter the TCA cycle or be stored as fatty acids. Fructose 1-phosphate exists in all living organisms, ranging from bacteria to humans. Within humans, fructose 1-phosphate participates in a number of enzymatic reactions. In particular, fructose 1-phosphate can be biosynthesized from D-fructose through the action of the enzyme ketohexokinase. In addition, fructose 1-phosphate can be converted into dihydroxyacetone phosphate and glyceraldehyde; which is catalyzed by the enzyme fructose-bisphosphate aldolase a. Because ...
Beta-D-Fructose 6 phosphate (b-F6P) is the beta-anomer of fructose-6-phosphate. There are two anomers of fructose 6 phosphate, the alpha anomer and the beta anomer. Specifically, beta-D-fructose 6-phosphate is fructose sugar phosphorylated on carbon 6. Beta-D-Fructose 6-phosphate is a substrate for Fructose-1,6-bisphosphatase, Pyruvate kinase (isozymes R/L), Hexokinase (type I), Fructose-bisphosphate aldolase A, L-lactate dehydrogenase B chain, Glyceraldehyde-3-phosphate dehydrogenase (liver) and Transaldolase ...
Lysine acetylation is a major posttranslational modification involved in a broad array of physiological functions. Here, we provide an organ-wide map of lysine acetylation sites from 16 rat tissues analyzed by high-resolution tandem mass spectrometry. We quantify 15,474 modification sites on 4,541 proteins and provide the data set as a web-based database. We demonstrate that lysine acetylation displays site-specific sequence motifs that diverge between cellular compartments, with a significant fraction of nuclear sites conforming to the consensus motifs G-AcK and AcK-P. Our data set reveals that the subcellular acetylation distribution is tissue-type dependent and that acetylation targets tissue-specific pathways involved in fundamental physiological processes. We compare lysine acetylation patterns for rat as well as human skeletal muscle biopsies and demonstrate its general involvement in muscle contraction. Furthermore, we illustrate that acetylation of fructose-bisphosphate aldolase and ...
The enzyme plays a key role in an alternative pathway of the biosynthesis of 3-dehydroquinate (DHQ), which is involved in the canonical pathway for the biosynthesis of aromatic amino acids. The enzyme can also catalyse the reaction of EC 4.1.2.13, fructose-bisphosphate aldolase ...
Recombinant Human Aldolase C protein is an Escherichia coli Full length protein 1 to 364 aa range, | 95% purity and validated in SDS-PAGE, MS.
Shop Fructose-1,6-/sedoheptulose-1,7-bisphosphate aldolase ELISA Kit, Recombinant Protein and Fructose-1,6-/sedoheptulose-1,7-bisphosphate aldolase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Complete information for ALDOB gene (Protein Coding), Aldolase, Fructose-Bisphosphate B, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for ALDOB gene (Protein Coding), Aldolase, Fructose-Bisphosphate B, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Gentaur molecular products has all kinds of products like :search , AbD \ GOAT ANTI RABBIT ALDOLASE, Product Type Polyclonal Antibody, Specificity ALDOLASE, Target Species Rabbit, Host Goat, Format Purified, Isotypes Polyclonal IgG, Applications E, WB, Clone \ 0279-9988 for more molecular products just contact us
Lai C.-Y., Nakai N., Chang D.. Elucidation of the amino acid sequence of fructose-1,6-bis-phosphate aldolase from rabbit muscle has made it possible to assign the positions of the functional groups known to play specific roles in the catalytic activity, and also to locate the buried, exposed, and active site cysteine residues. The results indicate that the middle portion of the polypeptide chain, including Cys-134, Cys-149, Cys-177, and Cys-l99, is buried in the native structure, with regions containing Cys-72, Lys-107, Lys-227, Cys-336, His-359, and the COOH-terminal residue (Tyr-361) folded into the active center of the enzyme, at or near the surface of the enzyme molecule.. Science 183:1204-1206(1974) [PubMed] [Europe PMC] ...
Preparation of polyclonal antibody against aldolase C. A peptide (CGAATEEFIKRAEMNGLAAQGKYE) that consisted of the amino acid sequence 322-344 of rat aldolase C (Mukai et al., 1991), plus a cysteine residue at the N terminus to facilitate conjugation to the carrier protein KLH, was synthesized and purified. This peptide was used for immunization, an ELISA test, affinity purification of antisera, and a blocking test in immunohistochemistry. Two rabbits (69075 and 69076) were immunized by five subcutaneous injections of 0.2 mg of the peptide conjugated with KLH at 2, 3, 2, and 2 week intervals. The rabbits were exsanguinated 2 weeks after the final boost. Crude antisera of both rabbits were affinity purified against the immobilized immunizing peptide. Some purified antibody of 69076 was conjugated with biotin. The above procedures were performed by Sawady Technologies (Itabashi, Tokyo, Japan).. Western blot analysis. To test the specificity of the affinity-purified antibody, the whole cerebellum ...
1GVF: Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
Shop Probable fructose-6-phosphate aldolase ELISA Kit, Recombinant Protein and Probable fructose-6-phosphate aldolase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
ALDOA is a key enzyme in the fourth step of glycolysis, as well as in the reverse pathway gluconeogenesis. It catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehydes-3-phosphate and dihydroxyacetone phosphate by aldol cleavage of the C3-C4 bond. As a result, it is a crucial player in ATP biosynthesis.[6][8][9][10][11] ALDOA also contributes to other "moonlighting" functions such as muscle maintenance, regulation of cell shape and motility, striated muscle contraction, actin cytoskeleton organization, and regulation of cell proliferation.[6][9][10] ALDOA likely regulates actin cytoskeleton remodeling through interacting with cytohesin-2 (ARNO) and Arf6.[10]. ALDOA is ubiquitously expressed in most tissues, though it is predominantly expressed in developing embryo and adult muscle.[6][11] In lymphocytes, ALDOA is the predominant aldolase isoform.[11] Within the cell, ALDOA typically localizes to the cytoplasm, but it can localize to the nucleus during DNA synthesis of ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Mouse polyclonal antibody raised against a full-length recombinant ALDOA. ALDOA (AAH10660.1, 1 a.a. ~ 364 a.a) full-length recombinant protein with GST tag. (H00000226-A01) - Products - Abnova
Anti-human ALDOC mAb, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human ALDOC.
我們可以幫您構建一個更高穩定性和安全性的物流體系,降低運輸的難度和運營成本,讓您可以減少花在貨運上的精力和時間,更專注于您的業務創新。 ...
Looking for online definition of fructose 1,6-diphosphate aldolase in the Medical Dictionary? fructose 1,6-diphosphate aldolase explanation free. What is fructose 1,6-diphosphate aldolase? Meaning of fructose 1,6-diphosphate aldolase medical term. What does fructose 1,6-diphosphate aldolase mean?
A case of hereditary fructose intolerance is reported in a girl aged 2 years at the time of her death. She had apparently progressed normally until the age of 14 months. At 19 months she was admitted to hospital with failure to thrive, hepatomegaly, and superficial infections. Investigations revealed hypoglycaemia, persistent acidosis, aminoaciduria, and a high liver glycogen level which suggested that she had glycogen storage disease. There was also some evidence of malabsorption.. At necropsy the liver enzyme estimations showed that fructose 1-phosphate aldolase activity was absent and that fructose 1,6-diphosphate aldolase activity was reduced. Hereditary fructose intolerance and glycogen storage disease have been confused in the past on clinical grounds, but a high liver glycogen level has not previously been reported in hereditary fructose intolerance.. ...
In order for Candida species to adhere and colonize human host cells they must express cell wall proteins (CWP) and adapt to reactive oxygen species (ROS) generated by phagocytic cells of the human host during the respiratory burst. However, how these pathogens change the expression of CWP in response to oxidative stress (OSR) is not known. Here, fifteen moonlight-like CWP were identified that expressed differentially in four species of Candida after they were exposed to H2O2 or menadione (O2(-)). These proteins included: (i) glycolytic enzymes, such as glyceraldehyde-3-phosphate dehydrogenase (Gapdh), fructose-bisphosphate aldolase (Fba1), phosphoglycerate mutase (Gpm1), phosphoglycerate kinase (Pgk), pyruvate kinase (Pk) and enolase (Eno1); (ii) the heat shock proteins Ssb1 and Ssa2; (iii) OSR proteins such as peroxyredoxin (Tsa1), the stress protein Ddr48 (Ddr48) and glutathione reductase (Glr1); (iv) other metabolic enzymes such as ketol-acid reductoisomerase (Ilv5) and pyruvate ...
Background & Aims: Celiac disease (CD) has been associated with several genetic disorders, but has not been associated with hereditary fructose intolerance (HFI). Methods: We identified CD in 4 female patients affected by HFI from among 38 Italian HFI patients. Results: Three of these patients were children in whom the CD-associated signs were hypertransaminasemia, failure to thrive, low weight, and short stature, whereas the adult patient had protracted diarrhea notwithstanding a fructose-free diet. The incidence of CD in our group of HFI patients was higher (,10%) than in the general population (1%-3%) (P , .02). Conclusions: The possibility of an association between these 2 gastrointestinal disorders is important, particularly in the management of HFI patients with persisting symptoms.. ...
Fructose intolerance may cause inexplicable GI symptoms. The elevated yield of positive tests in our preliminary study may be due to recommendation bias or testing conditions; lesser test dose formed a lower yield. Nevertheless, credit and management of fructose intolerance may facilitate several patients. The researchers recommended that patients with arcane symptoms must be tested with a noninvasive breath test before dismissing their symptoms as either imprecise or ahead of making a diagnosis of functional bowel disorder, because fructose intolerance is treatable.. ...
The potential of dihydroxyacetone phosphate (DHAP)-dependent aldolases to catalyze stereoselective aldol additions is, in many instances, limited by the solubility of the acceptor aldehyde in aqueous/co-solvent mixtures. Herein, we demonstrate the efficiency of emulsion systems as reaction media for the class I fructose-1,6-bisphosphate aldolase (RAMA) and class II recombinant rhamnulose-1-phosphate aldolase from E. coli (RhuA)-catalyzed aldol addition between DHAP and N-benzyloxycarbonyl (N-Cbz) aminoaldehydes. The use of emulsions improved the RAMA-catalyzed aldol conversions by three to tenfold relative to those in conventional DMF/water mixtures. RhuA was more reactive than RAMA towards the N-Cbz aminoaldehydes regardless of the reaction medium. With (S)- or (R)-Cbz-alaninal, RAMA exhibited preference for the R enantiomer, while RhuA had no enantiomeric discrimination. The linear N-Cbz aminopolyols thus obtained were submitted to catalytic intramolecular reductive amination to afford the ...
Aldolase plays essential catalytic roles in glycolysis and gluconeogenesis. However, aldolase is a highly abundant protein that is remarkably promiscuous in its interactions with other cellular proteins. In particular, aldolase binds to highly acidic amino acid sequences, including the C terminus of the Wiskott-Aldrich syndrome protein, an actin nucleation-promoting factor. Here we report the crystal structure of tetrameric rabbit muscle aldolase in complex with a C-terminal peptide of Wiskott-Aldrich syndrome protein. Aldolase recognizes a short, four-residue DEWD motif (residues 498-501), which adopts a loose hairpin turn that folds around the central aromatic residue, enabling its tryptophan side chain to fit into a hydrophobic pocket in the active site of aldolase. The flanking acidic residues in this binding motif provide further interactions with conserved aldolase active site residues Arg-42 and Arg-303, aligning their side chains and forming the sides of the hydrophobic pocket. The ...
Looking for online definition of Aldolase A in the Medical Dictionary? Aldolase A explanation free. What is Aldolase A? Meaning of Aldolase A medical term. What does Aldolase A mean?
TY - JOUR. T1 - Degradation of the gluconeogenic enzyme fructose-1, 6-bisphosphatase is dependent on the vacuolar ATPase.. AU - Liu, Jingjing. AU - Brown, C. Randell. AU - Chiang, Hui-ling. PY - 2005/1/1. Y1 - 2005/1/1. N2 - The key gluconeogenic enzyme fructose-1,6-bisphosphatase (FBPase) is induced during glucose starvation. After the addition of glucose, inactivated FBPase is selectively targeted to Vid (vacuolar import and degradation) vesicles and then to the vacuole for degradation. To identify proteins involved in this pathway, we screened various libraries for mutants that failed to degrade FBPase. Via these approaches, subunits of the vacuolar- H+ -ATPase (V-ATPase) have been identified repeatedly. The V-ATPase has established roles in endocytosis, sorting of carboxypeptidase Y and homotypic vacuole fusion. Here, we show that mutants lacking Stv1p, Vph1p, and other subunits of the V-ATPase are defective for FBPase degradation. FBPase was detected in Vid vesicles. However, most FBPase ...
Fructose Intolerance, Hereditary. In: Hay, Jr WW, Levin MJ, Deterding RR, Abzug MJ. Hay, Jr W.W., Levin M.J., Deterding R.R., Abzug M.J. Eds. William W. Hay, Jr, et al.eds. Quick Medical Diagnosis & Treatment Pediatrics New York, NY: McGraw-Hill; . http://accesspediatrics.mhmedical.com/content.aspx?bookid=2196§ionid=166957338. Accessed January 18, 2018 ...
Dr. Berookim is a colonoscopy Los Angeles doctor that specializes in all types of digestive health issues. Fructose intolerance can be a pain to deal with that is why Dr. Berookim is giving his patients all the information they need to avoid any health issues related to this. The colonoscopy Los Angeles gives their ...
On the stringent fructose-absolutely free diet regime, her third pregnancy proceeded nicely; the kid, who was also identified to get fructose intolerance, did well on a fructose-totally free food plan. Analysis of fructose intolerance was claimed to are already verified during the mother by biopsy from the liver. Presumably the father of those youngsters was at least heterozygous to the fructose intolerance gene ...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Zinc atom in PDB 2v9o: L-Rhamnulose-1-Phosphate Aldolase From Escherichia Coli ( Mutant A87M-T109F-E192A)
1J4E: Snapshots of catalysis: the structure of fructose-1,6-(bis)phosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate.
Fructose is a simple sugar that occurs naturally in some foods -- notably, fruit. Its 1.2 times sweeter than sucrose, or table sugar, and because of this, manufacturers often use it as an added ...
I know you are searching for a way to get well, to get thin, to have more energy, to feel better. But… unfortunately, especially in a country where everyone is an immigrant, you have literally nothing in common with most of the people you know.. In addition to that, you may have been exposed to gluten, to fructose, and now you are sensitive, or intolerant to one or both.. In addition to that: you live on a different budget, you like and eat different foods, and the foods you eat therefore lack this or that or most minerals you need for health.. You may have any of four different energy body types, three different Ayurvedic body types, Any of four different blood types… not even mentioning your ethnicity, your food sensitivities and intolerances… your nutritional deficiencies that you are unaware of.. Your mutt factor.. Your water intake and the quality of water you drink. Your activity level. Your ancestry.. So if you want to do this Wildfit program, you owe it to yourself to have your ...
The knowledge and ideas check these guys out In this particular Web-site are intended for educational applications only. Their intention would be to really encourage the reader to Consider, and to query present healthcare practices and guidance, along with other elements of visit site our fashionable technique for residing. They do not discover this info here present clinical tips or prognosis, or prescribe the use or discontinuance of any solution or treatment method, directly or indirectly, without the information and cooperation home of your customers medical professional or wellness Qualified ...
The human aldolase A gene is transcribed from three different promoters, pN, pM, and pH, all of which are clustered within a small 1.6-kbp DNA domain. pM, which is highly specific to adult skeletal muscle, lies in between pN and pH, which are ubiquitous but particularly active in heart and skeletal muscle. A ubiquitous enhancer, located just upstream of pH start sites, is necessary for the activity of both pH and pN in transient transfection assays. Using transgenic mice, we studied the sequence controlling the muscle-specific promoter pM and the relations between the three promoters and the ubiquitous enhancer. A 4.3-kbp fragment containing the three promoters and the ubiquitous enhancer showed an expression pattern consistent with that known in humans. In addition, while pH was active in both fast and slow skeletal muscles, pM was active only in fast muscle. pM activity was unaltered by the deletion of a 1.8-kbp region containing the ubiquitous enhancer and the pH promoter, whereas pN remained ...
Enzimler E-kitap okumak için tıklayın İçindekiler Enzimlerin kimyasal yapıları Enzimlerin tesir mekanizması Aktivatörler Spesifik İon Aktivatörleri Koenzimler İnhibitörler Non kompetetif inhibitörler Kompetitif inhibitörler Diğer inhibitörler Enzimatik reaksiyonların hızı üzerine tesir eden faktörler Enzim konsantrasyonu Substrat konsantrasyonu pH hidrogen ion konsantrasyonu Isı Reaksiyon ürünleri Kofaktör konsantrasyonu ve diğer fiziksel faktörler Zaman Enzimatik […]. ...
Book Aldolase with Pathcare Laboratories Ltd online in bangalore at 1mgLabs. Get best prices & free home sample pick up. View online reports and pre-test requirements | 1mgLabs
In this research, an improved method for preparation of optically pure β-hydroxy-α-amino acids, catalyzed by serine hydroxymethyl transferase with threonine aldolase activity, is reported. Using recom
ALDOC Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 364 amino acids (1-364 a.a.).
GT:ID BAD56000.1 GT:GENE BAD56000.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1281657..1282379 GB:FROM 1281657 GB:TO 1282379 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56000.1 LENGTH 240 SQ:AASEQ MTGDLMTTTETRLPAAVADFAAAAARDAERALRVFRETGTVTGNGTVNFVERVPGEEIAVALNAPGPWADDPTVRPIVATFDGTVLDGAGPAGFVTGYAEVFRRHPEITSVVHVHSPWLGGWAQTHRTLPIRYAAAQRLTLSREIPPHIDRSIGAGEFILQRLAEDPDLVAIFEANGGANVIGRSGLLELAKFVVLLEEGAQYQAIAETLGGSVEFDPSNLAVQWGRTGLADEARRRGLI GT:EXON 1,1-240:0, BL:SWS:NREP 1 BL:SWS:REP 77-,130,ARAD_BACSU,4e-06,33.3,54/229, SEG 15-,31,aavadfaaaaardaera, SEG 38-,48,tgtvtgngtvn, RP:PDB:NREP 1 RP:PDB:REP 52-,222,1e4bP,3e-19,15.7,166/206, RP:PFM:NREP 1 RP:PFM:REP 77-,204,PF00596,9e-07,36.0,125/181,Aldolase_II, HM:PFM:NREP 1 HM:PFM:REP 35-,204,PF00596,2.5e-12,28.4,162/183,Aldolase_II, GO:PFM:NREP 1 GO:PFM GO:0046872,GO:metal ion binding,PF00596,IPR001303, RP:SCP:NREP 1 RP:SCP:REP 60-,222,1dzuP,8e-18,15.5,161/209,c.74.1.1, ...
This test has been cleared or approved by the U.S. Food and Drug Administration and is used per manufacturers instructions. Performance characteristics were verified by Mayo Clinic in a manner consistent with CLIA requirements ...