Transcription factor p53 regulates its target genes through binding to DNA consensus sequence and activating the promoters of its downstream genes. The conventional p53 consensus binding sequence was defined as two copies of the 10-bp motif 5-PuPuPuC(A/T)(T/A)GPyPyPy-3 with a spacer of 0 to 13 bp, which exists in the regulatory regions of some p53 target genes. However, there is no such p53 cons
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
Thus, terms like natural laws or phenomena in complex, probabilistic fields should have significantly less force: they are less laws or phenomena of nature than they are laws or phenomena of a statistical, simulacrum account of observations of nature.. Similarly, defining a product of nature is also often an exercise in probabilism, complicated by natural complexity. What scientists refer to as a typical human gene, for example, actually encompasses a wide variety of genetic sequences within the human population.184 Determining the archetypal sequence of that gene, the consensus sequence, is therefore very much a product of statistics, rather than the specific identification of a gene with the consensus sequence as it actually exists in nature.185 Characterizing a particular genetic sequence as a natural product is consequently a two-step act of probabilism: using statistical methodology to determine a consensus sequence, and then using statistical methodology to ...
new feature: consensus sequence details now linked to list of all consensus sequences which are member of the same cluster or contig ...
new feature: consensus sequence details now linked to list of all consensus sequences which are member of the same cluster or contig ...
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
CLUSTAL W (1.82) multiple sequence alignment consensus_2681#0 ---ATTTCCATTTTCATCGGCCTCGTATCTTGAAAGATATACAAAGTAAGAAAAAAATTT 57 consensus_2681#1 GGGATCACTGACTT-ACTTTAAAAGCATCTAGGTTATTGCGTTGACCGATAAATTATGTA 59 ** * ** * * **** * * * * *** * * consensus_2681#0 TATTAAAAAAAAGATAAGGACAAAGAA-ATTGTTGCTCACTTAACAGAAATGGGAAGACC 116 consensus_2681#1 AAATAATTAAGAAGTGTGAATATGAAATATCGATAAAATTTTTGTTAAAA-GAGATCATG 118 * *** ** * * * * * ** ** * * ** *** * ** * consensus_2681#0 TTCGGGGCTTTTATAAGAGAAGCTTCCTTTTACAGTTCGCACT----AGTTCACCGTCCA 172 consensus_2681#1 ATGTTGAATTGTGAGAAAAAATTTATAATTCAAAATTTACTTTTTGAAATATAAGATCAA 178 * * ** * * * ** * ** * * ** * * * * * ** * consensus_2681#0 CTAATTTCAGCATTTCCGTTTCCTCTTTTTGCACGTTATTCACCGGTGCATTTACATTTG 232 consensus_2681#1 CAAA---AAATATTTTTATCCAAAATATTAAAGCATTGAAAGCTG----AATTAGAAGTA 231 * ** * **** * * ** * ** * * * *** * * consensus_2681#0 AAATCGGACGATTCCTGGCTTTATTGTCCTCGAAGGGCGTATTCAAGATCAATCCACCAG 292 consensus_2681#1 ...
This would be trouble if we merged it as-is: it changes networkstatus_compute_bw_weights_v10, which is invoked from networkstatus_compute_consensus. We need all the authorities who are using the same consensus_method to produce the same output for the consensus, or else it wont be a consensus ...
Collaboration practically does not exist without consensus, and consensus happens with collaboration. Consensus is give-and-take in information sharing. Its the ability to discuss differences calmly and come to some form of an agreement. By discussing
Hello, We are in need of software, preferably free of charge or not too expensive, with which we can make alignments of our forward and reverse ABI trace files and build consensus sequences. Anybody with suggestions? H at ns ...
No abstract is available; but the full text article can be downloaded by clciking on the link on the right side. This article can be cited as: R. Egel, On the Misgivings of Anthropomorphic Consensus Polling in Defining the Complexity of LifeJ. Biomo
Alnylams third quarter 2013 loss of 48 cents per share was wider than the Zacks Consensus Estimate of a loss of 38 cents per share.
AIDS has emerged as a significant pediatric disease with the rate of infection in neonates born to HIV-infected mothers reported to be from 20- 50%. The clinical disease that occurs in HIV-infected infants is similar to the adult, although pediatric AIDS has a more rapid clinical course with a higher rate of mortality. About one-third of HIV-infected infants have a rapidly fatal disease course and die within l year; remaining infants develop clinical disease more slowly and survive for more than five years. The timing of vertical transmission, levels or type of maternal antiviral antibodies and, transmission of distinct maternal viral variants have been proposed to explain this bimodal pattern of disease progression, with the more rapid, severe outcome associated with prenatal infection, and due to transmission of highly pathogenic virus strains. HIV-infected children are frequently small-for-gestational-age or growth- restricted, and continue to exhibit poor weight gain and growth throughout ...
The Kozak consensus sequence, Kozak consensus or Kozak sequence is a sequence which occurs on eukaryotic mRNA and has the consensus (gcc)gccRccAUGG. The Kozak consensus sequence plays a major role in the initiation of the translation process. The sequence was named after the person who brought it to prominence, Marilyn Kozak. The sequence is identified by the notation (gcc)gccRccAUGG, which summarizes data analysed by Kozak from a wide variety of sources (about 699 in all) as follows: a lower-case letter denotes the most common base at a position where the base can nevertheless vary; upper-case letters indicate highly conserved bases, i.e. the AUGG sequence is constant or rarely, if ever, changes, with the exception being the IUPAC ambiguity code R which indicates that a purine (adenine or guanine) is always observed at this position (with adenine being claimed by Kozak to be more frequent); and the sequence in parentheses (gcc) is of uncertain significance. Kozaks paper was limited to a ...
Abstract:. Previous works from our laboratory demonstrated that the monoclonal antibody (MAb) called R7B4 is directed to an epitope shared by various receptors corresponding to the type I cytokine receptor family, containing the common motif WSXWS or the homologous F(Y)GEFS. Later a consensus peptide significantly recognized by the MAb was identified and synthesized (sequence HGYWSEWSPE). In the present work, an homologous of the consensus sequence (HHGYWSEWSPE) was conjugated to PADRE adjuvant to produce Ab that could simulate the MAb activity, that is, acting as hormone and/or cytokine antagonists. The covalently conjugated peptide-PADRE was a better immunogen than the consensus peptide alone according to the reactivity of sera from C57BL/6 immunized mice and, besides, no Ab to PADRE were detected. Furthermore, Ab to consensus peptide elicited after peptide-PADRE inoculation into mice behaved as immunomodulatory agents, since they improved the humoral response to a foreign antigen (in this ...
Our sequence dataset of HIV-1 subtype B Rev included 4725 sequences. In the following picture, HXB2 indices of individual proteins are shown on top of the colored bars. A consensus amino acid at each position is shown beneath the colored bar. Natural variations are shown below the consensus amino acids; proportions (%) are colored red if they were more than 5%; blue otherwise ...
Our sequence dataset of HIV-1 subtype B GP120 included 4725 sequences. In the following picture, HXB2 indices of individual proteins are shown on top of the colored bars. A consensus amino acid at each position is shown beneath the colored bar. Natural variations are shown below the consensus amino acids; proportions (%) are colored red if they were more than 5%; blue otherwise ...
Legend: The darker and larger the blue dots, the higher strength in covariance. Below we provide the list of the top [1.5 x length] gremlin predictions, sequence seperation , 3. The i and j are positions as given in the consensus sequence. Show Scaled Distribution ...
The consensus layer defines cryptographic commitment structures. Its purpose is ensuring that anyone can locally evaluate whether a particular state and history is valid, providing settlement guarantees, and assuring eventual convergence. The consensus layer is not concerned with how messages are propagated on a network. Disagreements over the consensus layer can result in network partitioning, or forks, where different nodes might end up accepting different incompatible histories. We further subdivide consensus layer changes into soft forks and hard forks. ...
The CCDS database identifies a core set of human protein coding regions that are consistently annotated by multiple public resources and pass quality tests.
The CCDS database identifies a core set of human protein coding regions that are consistently annotated by multiple public resources and pass quality tests.
Bitcoin Blasts Through $15,000 - Its A Consensus Hallucination by Tyler Durden Dec 7, 2017 5:13 AM In the last 36 hours, Bitcoin has blasted through $12,000, $13,000, $14,000, and now $15,000 levels in an unprecedented 28% surge...
Bitcoin Blasts Through $15,000 - Its A Consensus Hallucination by Tyler Durden Dec 7, 2017 5:13 AM In the last 36 hours, Bitcoin has blasted through $12,000, $13,000, $14,000, and now $15,000 levels in an unprecedented 28% surge...
'Appallingly unmusical,' 'hirsute' and 'destined to fade away' - that pretty much sums up the general consensus.
Secondary structure prediction and consensus sequence of PelD and PleD. A. Secondary structure predication was made using the web-based ProteinPredict program h
The large number of protein consensus sequences that may be recognized without computer analysis are reviewed. These include the extensive range of known phosphorylation site motifs for protein kinase
Read Whole-genome consensus sequence analysis of a South African rotavirus SA11 sample reveals a mixed infection with two close derivatives of the SA11-H96 strain, Archives of Virology on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
L. Marsan, M.-F. Sagot. Algorithms for extracting structured motifs using a suffix tree with application to promoter and regulatory site consensus identification. Journal of Computational Biology, Mary Ann Liebert, 2000, 7, pp.345-360. ⟨hal-00427093⟩ ...
Transcriptional repressor with bimodal DNA-binding specificity. Represses transcription in a methyl-CpG-dependent manner. Binds with a higher affinity to methylated CpG dinucleotides in the consensus sequence 5-CGCG-3 but can also bind to the non-methylated consensus sequence 5-CTGCNA-3 also known as the consensus kaiso binding site (KBS). Can also bind specifically to a single methyl-CpG pair and can bind hemimethylated DNA but with a lower affinity compared to methylated DNA (PubMed:16354688 ...
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
I want to pause here and talk about this notion of consensus, and the rise of what has been called consensus science. I regard consensus science as an extremely pernicious development that ought to be stopped cold in its tracks. Historically, the claim of consensus has been the first refuge of scoundrels; it is a way to avoid debate by claiming that the matter is already settled. Whenever you hear the consensus of scientists agrees on something or other, reach for your wallet, because youre being had ...
Something elese comes into my mind: Do you have ribosome biding site , (Kozak consensus element, reads gccaccaccATGg or similar) in your , construct? Not sure if applicable: Do you get expression, when you , transfect the construct in cells? Yes, there is a ribosome binding site (luciferase ATG translation start site). Although the flanking sequence surrounding the ATG may not be the optimal Kozak consensus sequence. I have not tried in-vivo transformation yet, but considering my in-vitro results I would expect the same results ...
Type: HE alpha-beta. Class of length: 4. Class: 4.1 , Consensus Ramachandran - aappplbb Subclass: 4.1.1 , Consensus Sequence - pphpXGpV. ...
We investigate to what extent the market uses information that is predictive of whether earnings will meet or beat the analyst consensus forecast of earnings (M
Cel-Sci Corporation with ticker code (CVM) have now 1 analysts in total covering the stock. The consensus rating is Buy. The target price ranges between
The idea behind Copenhagen Consensus 2012 is to prioritize some of the worlds most important spending, with the latest economic analysis providing us ...
Italian lawmakers will begin voting on Thursday to elect a new president, in the hope that they can end the countrys political impasse, over which concerns are growing.
Start End Score Size Count Identity Consensus 109775 110239 158 93 5 77.0 gactccatctcggactccaactcgggtccatctcgggtcctacttgggctccatttcggactccatctcgg actccatctcgggtccatctcg 116809 117552 142 186 4 72.0 gtcaaagtgggaatttgtacaaagccatgaagatgttcgattggatgccagacaagaatttgatctcatgg aactcaattctaagagcctttgctcatcatgggcaacttgacgaagcaaagatattatttgataaaatgcc cgagtgggacctaatgtcgttgaattcaatgcttgcggcatata 117603 118253 106 93 7 65.3 cctgagcgaaatcttgtttcttggaacgctatgcttgcagcatatgctcaacatgggcatattgaagatgc aaaggtgctgtttgataacatg 34251 34462 104 106 2 99.5 nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnna 32398 32553 71 39 4 85.3 actctccaacttactttgattcatcgcagtagctccatc 19938 20059 47 61 2 94.3 accgaaacacatcaagaaaaggaagacctcgaaactaggattgatagaacaagagctcacc 5405 5500 42 32 3 88.5 cgcaagaacaacaccatgaatcgcaaagaaaa 109582 109773 38 96 2 84.9 ggcctcggtctcggtctcggtcccgatctcggtctcggtctcggtctcggtcccggtctcggtctcgactt cggactccatctcggactccatctc 113787 114065 34 93 3 72.8 ...
Recent fate-mapping studies establish that microglia, the resident mononuclear phagocytes of the CNS, are distinct in origin from the bone marrow-derived myeloid lineage. Interferon regulatory factor 8 (IRF8, also known as interferon consensus sequence binding protein) plays essential roles in development and function of the bone marrow-derived myeloid lineage. However, little is known about its roles in microglia. The CNS tissues of IRF8-deficient mice were immunohistochemically analyzed. Pure microglia isolated from wild-type and IRF8-deficient mice were studied in vitro by proliferation, immunocytochemical and phagocytosis assays. Microglial response in vivo was compared between wild-type and IRF8-deficient mice in the cuprizon-induced demyelination model. Our analysis of IRF8-deficient mice revealed that, in contrast to compromised development of IRF8-deficient bone marrow myeloid lineage cells, development and colonization of microglia are not obviously affected by loss of IRF8. However, IRF8
Rabbit anti IRF8 antibody recognizes Interferon regulatory factor 8, (IRF8) also known as Interferon consensus sequence-binding protein (I
Selectins represent a new family of adhesion molecules, expressed by leukocytes and endothelial cells, that are involved in the regulation of leukocyte traffic.
The leader-following consensus problem of higher order multiagent systems is considered. The dynamics of each agent are given in general form of linear system, and the communication topology among the agents is assumed to be directed and switching. To track the leader, two kinds of distributed observer-based consensus protocols are proposed for each following agent, whose distributed observers are used to estimate the leader’s state and tracking error based on the relative outputs of the neighboring agents, respectively. Some sufficient consensus conditions are established by using parameter-dependent Lyapunov function method under a class of directed interaction topologies. As special cases, the consensus conditions for balanced and undirected interconnection topology cases can be obtained directly. The protocol design technique is based on algebraic graph theory, Riccati equation, and Sylvester equation. Finally, a simulation example is given to illustrate our obtained result.
Winterling KW, Chafin D, Hayes JJ, Sun J, Levine AS, Yasbin RE, Woodgate R (1998) The Bacillus subtilis DinR binding site: redefinition of the consensus sequence. J Bacteriol 180:2201-11.[PMID:9555905 ...
Probab=100.00 E-value=0 Score=636.12 Aligned_cols=238 Identities=42% Similarity=0.741 Sum_probs=223.6 Q ss_pred HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH Q ss_conf 99999999831231023222212468888751248999999999999999999999748999999999995302022433 Q gi,254780372,r 4 YCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPP 83 (246) Q Consensus 4 ~~~~~~~~~~~~~a~aq~~~~~~~~~~~~~~~~~~~iqll~llt~LsL~P~ilim~TsFtrIvIVLsilRnALG~QQ~PP 83 (246) T Consensus 140 ~~~~~~~~~~~p~~~~~~p~~~~~~~~~g~q~~S~~iQ~Li~lT~LsllPaiLiM~TSFtRIvIVLslLRnALG~QQ~PP 219 (379) T PRK12430 140 IIPLCFLLLFCPSAYADIPGVTSHILSDGSQTWSIPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPP 219 (379) T ss_pred HHHHHHHHHHCHHHHHCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH T ss_conf 79799999967497853885215305899801230899999999999999999998520899999999987307688986 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCC Q ss_conf ...
This strategy guide introduces Consensus Decision Making, a method for facilitating and engaging students in a critical discussion of the central ideas of a text.
An organization headed by a senior IPCC official (Working Group 3 Vice-Chair, Carlo Carraro) has ranked TERI, an organization headed by the IPCCs chairman, first in the world ...
Uffe Ravnskov, MD, PhD is a Danish independent researcher and author.Famous for questioning the scientific consensus regarding the Lipid Hypothesis.
Curis reported fourth quarter 2013 net loss per share of 5 cents, narrower than the Zacks Consensus Estimate of a loss of 7 cents.
TY - JOUR. T1 - Extracting Best Consensus Motifs from Positive and Negative Examples. AU - Tateishi, Erika. AU - Maruyama, Osamu. AU - Miyano, Satoru. PY - 1995/10/27. Y1 - 1995/10/27. N2 - We define the best consensus motif (BCM) problem motivated by the problem of extracting motifs from nucleic acid and amino acid sequences. A type over an alphabetΣ is a familyΩ of subsets of Σ. A motif π of type Ω is a stringπ=π_1…π_n of motif components, each of which stands for an element in Ω. The BCM problem for Ω is, given a yes-no sample S={(α^,(1),, β^,(1),),...,(α^,(m),, β^,(m),)} of pairs of strings inΣ with α^,(i),≠β^,(i), for 1≤i≤m, to find a motif π of type Ω that maximizes the number of good pairs in S, where (α^,(i),,β^,(i),) is good forπ if π accepts α^,(i), and rejects β^,(i),. We prove that the BCM problem is NP-complete even for a very simple type Ω_1={z,φ≠z⊆Σ}, which is used, in practice, for describing protein motifs in the PROSITE database. We also ...
I describe a technique for screening peptide libraries of over 10(9) independent clones for substrates of peptide-modifying enzymes. The peptides, linked to their genetic material by the lac repressor, are exposed to the enzyme and then screened by affinity purification on a receptor specific for th …
2The promoter region of the recN gene contains two 16-bp sequences, separated by 6 bp, that match the consensus sequence (SOS box) for binding LexA protein Rostas K,19872The promoter region of the recN gene contains two 16-bp sequences, separated by 6 bp, that match the consensus sequence (SOS box) for binding LexA protein Rostas K,1987 ...
TSNAX Full-Length MS Protein Standard (NP_005990), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs.
Downloadable (with restrictions)! In this paper we consider the dynamic process of race track betting. We show that there is a close connection between the dynamic race track betting process and the pari-mutuel method for constructing consensus of subjective probabilities considered in Eisenberg and Gale. This enables us to show that there exists a unique equilibrium point for the betting process. We further show that the dynamic betting process converges to this equilibrium point almost surely. Therefore the sequential race track betting gives a natural approach to inducing the consensus probabilities in Eisenberg and Gale. These consensus probabilities are different from the average of the subjective probabilities which is used in the conventional way of combining individually held opinions into a collective group statement. We compare these probabilities and this leads to a potential explanation of the favorite-longshot bias consistently observed in the studies of race track betting.
Diabetes has reached serious proportions and accounts for around 5% of the population of India. Its complications are the cause of tremendous socioeconomic problems.It is the single largest cause leading to atherosclerosis and its attendant complications such as heart attacks, strokes, paralysis, and non-healing ulcers of the foot
Diabetes has reached serious proportions and accounts for around 5% of the population of India. Its complications are the cause of tremendous socioeconomic problems.It is the single largest cause leading to atherosclerosis and its attendant complications such as heart attacks, strokes, paralysis, and non-healing ulcers of the foot
1Salmon KA,2005 identified another putative ArcA-binding site ~140 bp upstream of the nuoA gene, but the sequence was not reported.1Salmon K,2003 did not find an FNR site in the nuo promoter region, but Bongaerts et al. Bongaerts J,1995 did. Therefore, we do not know if the FNR-mediated repression of this promoter under anaerobiosis is direct or indirect.1Upstream of -120, a sequence corresponding to the NarL consensus has been found. Other potential (but less-well-conserved) NarL consensus sites are located upstream of -260 and of -201.1Upstream of -120, a sequence corresponding to the NarL consensus has been found. Other potential (but less-well-conserved) NarL consensus sites are located upstream of -260 and of -201 ...
These oligonucleotides contain consensus DNA-binding sites for individual transcription factors and have 5´ OH blunt ends, allowing labeling to high specific activity with T4 PNK.
mouse Gbp3 protein: 71-kDa guanylate-binding protein; mGBP3 lacks CAAX consensus sequence for isoprenylation and methylation and thus is cytosolic, unlike other GBP3 proteins; RefSeq NM_018734
By using a consensus spot pattern in Delta2D (a), complete expression profiles (b) are generated. Profiles can be imported into DNA array analysis software (her
Is British Columbias carbon offset scheme really just a green slush fund - one in which the well-connected receive money that should have been spent on sick people ...
Synergy Pharma reported a loss of 17 cents per share in the fourth quarter, wider than the year-ago loss and the Zacks Consensus Estimate of a loss of 15 cents