Transcription factor p53 regulates its target genes through binding to DNA consensus sequence and activating the promoters of its downstream genes. The conventional p53 consensus binding sequence was defined as two copies of the 10-bp motif 5-PuPuPuC(A/T)(T/A)GPyPyPy-3 with a spacer of 0 to 13 bp, which exists in the regulatory regions of some p53 target genes. However, there is no such p53 cons
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
Thus, terms like natural "laws" or "phenomena" in complex, probabilistic fields should have significantly less force: they are less "laws" or "phenomena" of nature than they are "laws" or "phenomena" of a statistical, "simulacrum account" of observations of nature.. Similarly, defining a "product" of nature is also often an exercise in probabilism, complicated by natural complexity. What scientists refer to as a "typical" human gene, for example, actually encompasses a wide variety of genetic sequences within the human population.184 Determining the archetypal sequence of that gene, the "consensus sequence," is therefore very much a product of statistics, rather than the specific identification of a gene with the consensus sequence as it actually exists in nature.185 Characterizing a particular genetic sequence as a "natural product" is consequently a two-step act of probabilism: using statistical methodology to determine a consensus sequence, and then using statistical methodology to ...
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
CLUSTAL W (1.82) multiple sequence alignment consensus_2681#0 ---ATTTCCATTTTCATCGGCCTCGTATCTTGAAAGATATACAAAGTAAGAAAAAAATTT 57 consensus_2681#1 GGGATCACTGACTT-ACTTTAAAAGCATCTAGGTTATTGCGTTGACCGATAAATTATGTA 59 ** * ** * * **** * * * * *** * * consensus_2681#0 TATTAAAAAAAAGATAAGGACAAAGAA-ATTGTTGCTCACTTAACAGAAATGGGAAGACC 116 consensus_2681#1 AAATAATTAAGAAGTGTGAATATGAAATATCGATAAAATTTTTGTTAAAA-GAGATCATG 118 * *** ** * * * * * ** ** * * ** *** * ** * consensus_2681#0 TTCGGGGCTTTTATAAGAGAAGCTTCCTTTTACAGTTCGCACT----AGTTCACCGTCCA 172 consensus_2681#1 ATGTTGAATTGTGAGAAAAAATTTATAATTCAAAATTTACTTTTTGAAATATAAGATCAA 178 * * ** * * * ** * ** * * ** * * * * * ** * consensus_2681#0 CTAATTTCAGCATTTCCGTTTCCTCTTTTTGCACGTTATTCACCGGTGCATTTACATTTG 232 consensus_2681#1 CAAA---AAATATTTTTATCCAAAATATTAAAGCATTGAAAGCTG----AATTAGAAGTA 231 * ** * **** * * ** * ** * * * *** * * consensus_2681#0 AAATCGGACGATTCCTGGCTTTATTGTCCTCGAAGGGCGTATTCAAGATCAATCCACCAG 292 consensus_2681#1 ...
No abstract is available; but the full text article can be downloaded by clciking on the link on the right side. This article can be cited as: R. Egel, On the Misgivings of Anthropomorphic Consensus Polling in Defining the Complexity of LifeJ. Biomo
Alnylams third quarter 2013 loss of 48 cents per share was wider than the Zacks Consensus Estimate of a loss of 38 cents per share.
AIDS has emerged as a significant pediatric disease with the rate of infection in neonates born to HIV-infected mothers reported to be from 20- 50%. The clinical disease that occurs in HIV-infected infants is similar to the adult, although pediatric AIDS has a more rapid clinical course with a higher rate of mortality. About one-third of HIV-infected infants have a rapidly fatal disease course and die within l year; remaining infants develop clinical disease more slowly and survive for more than five years. The timing of vertical transmission, levels or type of maternal antiviral antibodies and, transmission of distinct maternal viral variants have been proposed to explain this bimodal pattern of disease progression, with the more rapid, severe outcome associated with prenatal infection, and due to transmission of highly pathogenic virus strains. HIV-infected children are frequently small-for-gestational-age or growth- restricted, and continue to exhibit poor weight gain and growth throughout ...
The Kozak consensus sequence, Kozak consensus or Kozak sequence is a sequence which occurs on eukaryotic mRNA and has the consensus (gcc)gccRccAUGG. The Kozak consensus sequence plays a major role in the initiation of the translation process. The sequence was named after the person who brought it to prominence, Marilyn Kozak. The sequence is identified by the notation (gcc)gccRccAUGG, which summarizes data analysed by Kozak from a wide variety of sources (about 699 in all) as follows: a lower-case letter denotes the most common base at a position where the base can nevertheless vary; upper-case letters indicate highly conserved bases, i.e. the AUGG sequence is constant or rarely, if ever, changes, with the exception being the IUPAC ambiguity code R which indicates that a purine (adenine or guanine) is always observed at this position (with adenine being claimed by Kozak to be more frequent); and the sequence in parentheses (gcc) is of uncertain significance. Kozaks paper was limited to a ...
Abstract:. Previous works from our laboratory demonstrated that the monoclonal antibody (MAb) called R7B4 is directed to an epitope shared by various receptors corresponding to the type I cytokine receptor family, containing the common motif WSXWS or the homologous F(Y)GEFS. Later a consensus peptide significantly recognized by the MAb was identified and synthesized (sequence HGYWSEWSPE). In the present work, an homologous of the consensus sequence (HHGYWSEWSPE) was conjugated to PADRE adjuvant to produce Ab that could simulate the MAb activity, that is, acting as hormone and/or cytokine antagonists. The covalently conjugated peptide-PADRE was a better immunogen than the consensus peptide alone according to the reactivity of sera from C57BL/6 immunized mice and, besides, no Ab to PADRE were detected. Furthermore, Ab to consensus peptide elicited after peptide-PADRE inoculation into mice behaved as immunomodulatory agents, since they improved the humoral response to a foreign antigen (in this ...
Legend: The darker and larger the blue dots, the higher strength in covariance. Below we provide the list of the top [1.5 x length] gremlin predictions, sequence seperation , 3. The i and j are positions as given in the consensus sequence. Show Scaled Distribution ...
The consensus layer defines cryptographic commitment structures. Its purpose is ensuring that anyone can locally evaluate whether a particular state and history is valid, providing settlement guarantees, and assuring eventual convergence. The consensus layer is not concerned with how messages are propagated on a network. Disagreements over the consensus layer can result in network partitioning, or forks, where different nodes might end up accepting different incompatible histories. We further subdivide consensus layer changes into soft forks and hard forks. ...
The CCDS database identifies a core set of human protein coding regions that are consistently annotated by multiple public resources and pass quality tests.
The CCDS database identifies a core set of human protein coding regions that are consistently annotated by multiple public resources and pass quality tests.
Bitcoin Blasts Through $15,000 - Its A Consensus Hallucination by Tyler Durden Dec 7, 2017 5:13 AM In the last 36 hours, Bitcoin has blasted through $12,000, $13,000, $14,000, and now $15,000 levels in an unprecedented 28% surge...
Bitcoin Blasts Through $15,000 - Its A Consensus Hallucination by Tyler Durden Dec 7, 2017 5:13 AM In the last 36 hours, Bitcoin has blasted through $12,000, $13,000, $14,000, and now $15,000 levels in an unprecedented 28% surge...
'Appallingly unmusical,' 'hirsute' and 'destined to fade away' - that pretty much sums up the general consensus.
Secondary structure prediction and consensus sequence of PelD and PleD. A. Secondary structure predication was made using the web-based ProteinPredict program h
The large number of protein consensus sequences that may be recognized without computer analysis are reviewed. These include the extensive range of known phosphorylation site motifs for protein kinase
Read "Whole-genome consensus sequence analysis of a South African rotavirus SA11 sample reveals a mixed infection with two close derivatives of the SA11-H96 strain, Archives of Virology" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Transcriptional repressor with bimodal DNA-binding specificity. Represses transcription in a methyl-CpG-dependent manner. Binds with a higher affinity to methylated CpG dinucleotides in the consensus sequence 5-CGCG-3 but can also bind to the non-methylated consensus sequence 5-CTGCNA-3 also known as the consensus kaiso binding site (KBS). Can also bind specifically to a single methyl-CpG pair and can bind hemimethylated DNA but with a lower affinity compared to methylated DNA (PubMed:16354688 ...
I want to pause here and talk about this notion of consensus, and the rise of what has been called consensus science. I regard consensus science as an extremely pernicious development that ought to be stopped cold in its tracks. Historically, the claim of consensus has been the first refuge of scoundrels; it is a way to avoid debate by claiming that the matter is already settled. Whenever you hear the consensus of scientists agrees on something or other, reach for your wallet, because youre being had ...
Something elese comes into my mind: Do you have ribosome biding site , (Kozak consensus element, reads gccaccaccATGg or similar) in your , construct? Not sure if applicable: Do you get expression, when you , transfect the construct in cells? Yes, there is a ribosome binding site (luciferase ATG translation start site). Although the flanking sequence surrounding the ATG may not be the optimal Kozak consensus sequence. I have not tried in-vivo transformation yet, but considering my in-vitro results I would expect the same results ...
Type: HE alpha-beta. Class of length: 4. Class: 4.1 , Consensus Ramachandran - aappplbb Subclass: 4.1.1 , Consensus Sequence - pphpXGpV. ...
We investigate to what extent the market uses information that is predictive of whether earnings will meet or beat the analyst consensus forecast of earnings (M
The idea behind Copenhagen Consensus 2012 is to prioritize some of the worlds most important spending, with the latest economic analysis providing us ...
Italian lawmakers will begin voting on Thursday to elect a new president, in the hope that they can end the countrys political impasse, over which concerns are growing.
Start End Score Size Count Identity Consensus 109775 110239 158 93 5 77.0 gactccatctcggactccaactcgggtccatctcgggtcctacttgggctccatttcggactccatctcgg actccatctcgggtccatctcg 116809 117552 142 186 4 72.0 gtcaaagtgggaatttgtacaaagccatgaagatgttcgattggatgccagacaagaatttgatctcatgg aactcaattctaagagcctttgctcatcatgggcaacttgacgaagcaaagatattatttgataaaatgcc cgagtgggacctaatgtcgttgaattcaatgcttgcggcatata 117603 118253 106 93 7 65.3 cctgagcgaaatcttgtttcttggaacgctatgcttgcagcatatgctcaacatgggcatattgaagatgc aaaggtgctgtttgataacatg 34251 34462 104 106 2 99.5 nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnna 32398 32553 71 39 4 85.3 actctccaacttactttgattcatcgcagtagctccatc 19938 20059 47 61 2 94.3 accgaaacacatcaagaaaaggaagacctcgaaactaggattgatagaacaagagctcacc 5405 5500 42 32 3 88.5 cgcaagaacaacaccatgaatcgcaaagaaaa 109582 109773 38 96 2 84.9 ggcctcggtctcggtctcggtcccgatctcggtctcggtctcggtctcggtcccggtctcggtctcgactt cggactccatctcggactccatctc 113787 114065 34 93 3 72.8 ...
Rabbit anti IRF8 antibody recognizes Interferon regulatory factor 8, (IRF8) also known as Interferon consensus sequence-binding protein (I
Winterling KW, Chafin D, Hayes JJ, Sun J, Levine AS, Yasbin RE, Woodgate R (1998) The Bacillus subtilis DinR binding site: redefinition of the consensus sequence. J Bacteriol 180:2201-11.[PMID:9555905 ...
Probab=100.00 E-value=0 Score=636.12 Aligned_cols=238 Identities=42% Similarity=0.741 Sum_probs=223.6 Q ss_pred HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH Q ss_conf 99999999831231023222212468888751248999999999999999999999748999999999995302022433 Q gi,254780372,r 4 YCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPP 83 (246) Q Consensus 4 ~~~~~~~~~~~~~a~aq~~~~~~~~~~~~~~~~~~~iqll~llt~LsL~P~ilim~TsFtrIvIVLsilRnALG~QQ~PP 83 (246) T Consensus 140 ~~~~~~~~~~~p~~~~~~p~~~~~~~~~g~q~~S~~iQ~Li~lT~LsllPaiLiM~TSFtRIvIVLslLRnALG~QQ~PP 219 (379) T PRK12430 140 IIPLCFLLLFCPSAYADIPGVTSHILSDGSQTWSIPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPP 219 (379) T ss_pred HHHHHHHHHHCHHHHHCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH T ss_conf 79799999967497853885215305899801230899999999999999999998520899999999987307688986 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCC Q ss_conf ...
This strategy guide introduces Consensus Decision Making, a method for facilitating and engaging students in a critical discussion of the central ideas of a text.
An organization headed by a senior IPCC official (Working Group 3 Vice-Chair, Carlo Carraro) has ranked TERI, an organization headed by the IPCCs chairman, first in the world ...
Uffe Ravnskov, MD, PhD is a Danish independent researcher and author.Famous for questioning the scientific consensus regarding the Lipid Hypothesis.
Curis reported fourth quarter 2013 net loss per share of 5 cents, narrower than the Zacks Consensus Estimate of a loss of 7 cents.
TSNAX Full-Length MS Protein Standard (NP_005990), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs.
Downloadable (with restrictions)! In this paper we consider the dynamic process of race track betting. We show that there is a close connection between the dynamic race track betting process and the pari-mutuel method for constructing consensus of subjective probabilities considered in Eisenberg and Gale. This enables us to show that there exists a unique equilibrium point for the betting process. We further show that the dynamic betting process converges to this equilibrium point almost surely. Therefore the sequential race track betting gives a natural approach to inducing the consensus probabilities in Eisenberg and Gale. These consensus probabilities are different from the average of the subjective probabilities which is used in the conventional way of combining individually held opinions into a collective group statement. We compare these probabilities and this leads to a potential explanation of the favorite-longshot bias consistently observed in the studies of race track betting.
Diabetes has reached serious proportions and accounts for around 5% of the population of India. Its complications are the cause of tremendous socioeconomic problems.It is the single largest cause leading to atherosclerosis and its attendant complications such as heart attacks, strokes, paralysis, and non-healing ulcers of the foot
Diabetes has reached serious proportions and accounts for around 5% of the population of India. Its complications are the cause of tremendous socioeconomic problems.It is the single largest cause leading to atherosclerosis and its attendant complications such as heart attacks, strokes, paralysis, and non-healing ulcers of the foot
These oligonucleotides contain consensus DNA-binding sites for individual transcription factors and have 5ยด OH blunt ends, allowing labeling to high specific activity with T4 PNK.
mouse Gbp3 protein: 71-kDa guanylate-binding protein; mGBP3 lacks CAAX consensus sequence for isoprenylation and methylation and thus is cytosolic, unlike other GBP3 proteins; RefSeq NM_018734
By using a consensus spot pattern in Delta2D (a), complete expression profiles (b) are generated. Profiles can be imported into DNA array analysis software (her
Is British Columbias carbon offset scheme really just a green slush fund - one in which the well-connected receive money that should have been spent on sick people ...
Synergy Pharma reported a loss of 17 cents per share in the fourth quarter, wider than the year-ago loss and the Zacks Consensus Estimate of a loss of 15 cents
This paper considers the consensus problem of nonlinear multi-agent systems under switching directed topologies. Specifically, the dynamics of each agent incorporates an intrinsic nonlinear term and the interaction topology may not contain a spanning tree at any time. By designing a state-controlled switching law, we show that the multi-agent system with the neighbor-based protocol can achieve consensus if the switching topologies jointly contain a spanning tree. Moreover, an easily manageable algebraic criterion is deduced to unravel the underlying mechanisms in reaching consensus. Finally, a numerical example is exploited to illustrate the effectiveness of the developed theoretical results.
Botswana Democratic Party (BDP) has resolved to promote a safe-mode of settling for consensus candidates in next years by-elections in 2017. BDP secretary general Botsalo Ntuane told local media on Tuesday that the decision was made because it has been realised that the party tends to do better when fielding a consensus candidate. BDP will contend in four by-elections in 2017 - three council seats and one parliamentary seat. Council by-elections will be held at Boikaelo Madiba in Palapye, Tsabong North an
Text of H.R. 979 (110th): Bipartisan Consensus Managed Care Improvement ... as of Feb 12, 2007 (Introduced version). H.R. 979 (110th): Bipartisan Consensus Managed Care Improvement Act of 2007
Guidelines, released by Prostate Cancer Foundation of Australia and Cancer Council Australia have established consensus on the use of PSA blood tests.
In business and procurement, there has been a greater focus over the last 20 years or so on consensus decision making, which is seen as a positive approach that motivates staff and helps to get buy-in from our teams and stakeholders in a business context. But is this truly the right approach?. ...
The Lok Satta Party will be organizing public meetings in all the three regions of the State shortly to educate and enlighten people on issues arising out of the Centers decision to form Telangana State and strive for a consensus on practical solutions.