Viorel Florea - Research Output - Experts@Minnesota
Rossi, A., Cicoira, M., Florea, V. G., Golia, G., Florea, N. D., Khan, A. A., Murray, S. T. M., Nguyen, J. T., OCallaghan, P., Anand, I. S., Coats, A., Zardini, P., Vassanelli, C. & Henein, M., Jun 28 2006, In : International Journal of Cardiology. 110, 3, p. 386-392 7 p.. Research output: Contribution to journal › Article ...
Insights into a 429-million-year-old compound eye | Scientific Reports
In all arthropods the plesiomorphic (ancestral character state) kind of visual system commonly is considered to be the compound eye. Here we are able to show the excellently preserved internal structures of the compound eye of a 429 Mya old Silurian trilobite, Aulacopleura koninckii (Barrande, 1846). It shows the characteristic elements of a modern apposition eye, consisting of 8 (visible) receptor cells, a rhabdom, a thick lens, screening pigment (cells), and in contrast to a modern type, putatively just a very thin crystalline cone. Functionally the latter underlines the idea of a primarily calcitic character of the lens because of its high refractive properties. Perhaps the trilobite was translucent. We show that this Palaeozoic trilobite in principle was equipped with a fully modern type of visual system, a compound eye comparable to that of living bees, dragonflies and many diurnal crustaceans. It is an example of excellent preservation, and we hope that this manuscript will be a starting point for
The ocelli of Archaeognatha (Hexapoda): functional morphology, pigment migration and chemical nature of the reflective tapetum ...
The structure and function of compound eyes in crustaceans and insects has been the subject of intense study over the last 120 years (e.g. Exner, 1891; Horridge, 1975; Strausfeld, 2005; Warrant, 2006; Land and Nilsson, 2012); however, comparatively little is known about the ocelli (for reviews, see Goodman, 1981; Mizunami, 1995; Krapp, 2009). Adult winged insects usually have three ocelli on the frons or vertex, a median ocellus and two lateral ones - not to be confused with stemmata, which are sometimes termed lateral ocelli as well. From a morphological point of view, they are simple eyes in that they have a single lens. Ocelli are often more sensitive than compound eyes, because of a high convergence of photoreceptors onto secondary neurons, and the fewer neurons involved in processing the signals enable a faster response. The insight that the ocelli of some taxa are capable of any resolution at all is relatively recent (Schuppe and Hengstenberg, 1993; Stange et al., 2002; Berry et al., ...
What are compound eyes? | Reference.com
Compound eyes are types of eyes made up of many repeating units called ommatidia. These types of eyes are mainly present in insects, although some crustaceans, such as crayfish, also possess them. A...
Brasineura troglophilica Neto & Aldrete, 2015, n. sp. - Plazi TreatmentBank
n. sp.. ( Figs 8-14View FIGURES 8 - 14). Color. Body pale yellow, with brown and pale brown areas as indicated below. Compound eyes black, ocelli hyaline, with ochre centripetal crescents; head pattern ( Fig. 8View FIGURES 8 - 14); a brown area on vertex, close to each compound eye, as illustrated, also a brown band between compound eyes, below the level of the ocellar group, limited posteriorly by the postclypeus; a brown band on each gena, from lower compound eye to subgenal sulcus. Antennae and maxillary palps pale yellow, Mx 4 more pigmented distally. Tergal lobes of meso- and metathorax brown; thoracic pleura with an irregular pale brown band above the level of the coxae. Legs with coxae, trochanters and femora creamy white, tibiae and tarsomeres pale yellow. Forewings almost hyaline, as illustrated ( Fig. 9View FIGURES 8 - 14); a brown spot on confluence of Cu 2 - 1 A; veins brown. Hindwing ( Fig. 10View FIGURES 8 - 14), almost hyaline throughout, veins brown.. Structural characters. ...
COMUNICAT DE PRESĂ: FII INCLUS! TINERII SURZI ȘI PIAȚA MUNCII ~ ANPEDA Virgil Florea
Aceasta publicatie este distribuita gratuit si se adreseaza în special parintilor care au copii cu deficiente de auz dar si cadrelor didacti ...
Search publications - Research Database, The University of York
De Bruin, G., Li, N., Paniagua, G., Willems, L., Xin, B. T., Verdoes, M., Geurink, P. P., Van Der Linden, W., van der Stelt, M., Van Der Marel, G., Overkleeft, H. S. & Florea, B. I., 6 Oct 2014, Concepts and Case Studies in Chemical Biology. Wiley-Blackwell, p. 177-190 14 p.. Research output: Chapter in Book/Report/Conference proceeding › Chapter ...
Calibration of magnetic and celestial compass cues in migratory birds- a review of cue-conflict experiments | Journal of...
Muheim, R., Moore, F. R. and Phillips, J. B. (2006). Calibration of magnetic and celestial compass cues in migratory birds - a review of cue-conflict experiments. J. Exp. Biol. 209, 2-17.. The final paragraph before the `General discussion (p. 11) was based on a misunderstanding and should be replaced by the following paragraph:. It was previously argued that during migration only one exposure to the cue conflict would lead to a dominance of celestial cues, and thus to a recalibration of the magnetic compass, while repeated exposures to the cue conflict would lead to a dominance of magnetic cues and to a recalibration of the celestial compass(es) (e.g. Wiltschko et al., 1997; Wiltschko et al., 1998a; Wiltschko and Wiltschko, 1999). According to our analysis, the birds did not show a significant reaction to the shifted magnetic field, i.e. they followed celestial rather than magnetic cues in four of 23 experiments in which birds were exposed to a shifted magnetic field with access to celestial ...
compound eye facts, information, pictures | Encyclopedia.com articles about compound eye
Proud Boys supporter Eduard Florea pleads guilty to Jan. 6 Capitol riot threats
The defendant, Eduard Florea, also admitted to storing a large collection of ammunition at his home in the New York City borough of Queens.
Dr. Andrew S Florea, MD | Redlands, CA | Otolaryngologist | Vitals
Dr. Andrew S Florea, MD, rated 3/5 by patients. 17 reviews, Phone number & practice locations, Otolaryngologist in Redlands, CA.
Yodel It! lyrics - Ilinca feat. Alex Florea (Romania, Eurovision...
Ilinca feat. Alex Florea will represent Romania at Eurovision 2017 with Yodel It!. Read the lyrics here. Yodeleeii, yodeleioo
Cytoneme-Mediated Contact-Dependent Transport of the Drosophila Decapentaplegic Signaling Protein | Science
Cells that received Dpp and activated Dpp signal transduction extended cytonemes that directly contacted Dpp-producing cells. The contacts were characterized by relative stability and membrane juxtaposition of less than 15 nm. Cytonemes that contained the Dpp receptor in motile puncta also contained Dpp taken up from Dpp-producing cells. In contrast, a different set of cytonemes that contacted fibroblast growth factor (FGF)-producing cells contained the FGF receptor but did not take up Dpp. The cytonemes were reduced in number and length in genetic loss-of-function conditions for diaphanous, which encodes a formin; for neuroglian, which encodes an L1-type cell adhesion molecule; and for shibire, which encodes a dynamin. Cytonemes were present in loss-of-function conditions for capricious, which encodes a leucine-rich repeat cell adhesion protein, but these cytonemes failed to contact Dpp-producing cells. Signaling was abrogated in all these conditions that created defective cytonemes, although ...
Wingless and patched are negative regulators of the morphogenetic furrow and can affect tissue polarity in the developing...
In the developing Drosophila compound eye, a wave of pattern formation and cell-type determination sweeps across the presumptive eye epithelium. This morphogenetic furrow coordinates the epithelial cells division cycle, shape and gene expression to produce evenly spaced neural cell clusters that will eventually form the adult ommatidia. As these clusters develop, they rotate inwards to face the eyes equator and establish tissue polarity. We have found that wingless is strongly expressed in the dorsal margin of the presumptive eye field, ahead of the morphogenetic furrow. We have shown that inactivation of Wingless results in the induction of an ectopic furrow that proceeds ventrally from the dorsal margin. This ectopic furrow is normal in most respects, however the clusters formed by it fail to rotate, and we propose a two-vector model to account for normal rotation and tissue polarity in the retina. A second consequence of this inactivation of Wingless is that the dorsal head is largely ...
The visuotectal projections made by Xenopus pie slice compound eyes | Development
In Xenopus embryos at stages 28-32 one quarter to one third of the left eye rudiment was replaced by a similarly sized piece from a different position in a right eye rudiment. Three groups of operations were performed: (1) temporal tissue was placed in a nasal position; (2) nasal tissue was placed temporally; (3) ventral tissue was placed dorsally. The visuotectal projections made by these pie-slice compound eyes were assessed electrophysiologically at 1 week to 6 months after metamorphosis. Of 97 animals, 71 yielded interpretable projections. In most cases two projections could be identified in each map. One, ascribed to the host part of the retina, extended over the entire tectal surface mapped. The other, identified as that from tissue derived from the pie-slice graft, projected to the tectum in register with that part of the host retina which matched the pie-slice in origin. Both projections were well ordered, and in the orientation expected if the corresponding piece of retinal tissue had ...
progression of morphogenetic furrow during compound eye morphogenesis QuickView - Correlation Engine
The morphogenetic furrow is a dorsoventral indentation which sweeps anteriorly across the eye disc. Ommatidia begin to form along the furrow, resulting in a graded series of ommatidial development across the anterior/posterior axis of the disc.
Submit a Revision
Ocelli : Two types of simple eyes can be found in the class Insecta: dorsal Ocelli and lateral Ocelli (=stemmata). Although both types of Ocelli are similar in structure, they are believed to have separate phylogenetic and embryological origins. Dorsal Ocelli are commonly found in adults and in the immature stages (nymphs) of many hemimetabolous species. They are not independent visual organs and never occur in species that lack compound eyes. Whenever present, dorsal Ocelli appear as two or three small, convex swellings on the dorsal or facial regions of the head. They differ from compound eyes in having only a single corneal lens covering an array of several dozen rhabdom-like sensory rods. These simple eyes do not form an image or perceive objects in the environment, but they are sensitive to a wide range of wavelengths, react to the polarization of light, and respond quickly to changes in light intensity. No exact function has been clearly established, but many physiologists believe they ...
Juddmonte Spinster S. (G1) - BloodHorse
Blocked by a wall of five horses exiting the final turn, Steve Mogers Stormy Lucy found space to the outside and just got up to catch Recepta at the wire to win the $300,000 Matriarch Stakes (gr. IT) Nov. 29 at Del Mar.. ...
Search publications - Research Database, The University of York
Willems, L. I., Beenakker, T. J. M., Murray, B. S., Scheij, S., Kallemeijn, W. W., Boot, R. G., Verhoek, M., Donker-Koopman, W. E., Ferraz, M. J., Rijssel, E. R. V., Florea, B. I., Codée, J. D. C., Van Der Marel, G. A., Aerts, J. M. F. G. & Overkleeft, H. S., 8 Aug 2014. Article in Journal of the American Chemical Society ...
HOT ChemComm articles for November - Chemical Communications Blog
Sybrin P. Schröder, Jasper W. van de Sande, Wouter W. Kallemeijn, Chi-Lin Kuo, Marta Artola, Eva J. van Rooden, Jianbing Jiang, Thomas J. M. Beenakker, Bogdan I. Florea, Wendy A. Offen, Gideon J. Davies, Adriaan J. Minnaard, Johannes M. F. G. Aerts, Jeroen D. C. Codée, Gijsbert A. van der Marel and Herman S. ...
Cerura vinula ssp. estonica Huene 1905 - Encyclopedia of Life
Definition: superposition compound eyes where each ommatidium is equipped with a lens cylinder arrangement, producing the equivalent of a pair of lenses, with the first lens producing a small image halfway down the structure and the second lens turning the image back into a parallel beam. In the process the ray direction is reversed. Thus, the emerging beam is on the same side of the axis as the entering beam-the condition for obtaining a superposition image from the whole array ...
Details of Relationship | Legacies of British Slave-ownership
1787 - 1835. Daughter of free Mulatto lodging-house-keeper Jane Charlotte Beckford (c. 1759-1825); possibly the daughter of George Ffrench, Clerk to the Jamaica Assembly. Spinster; independently wealthy slave-owner.. Visit the people of interest section. ...
Details of Relationship | Legacies of British Slave-ownership
1787 - 1835. Daughter of free Mulatto lodging-house-keeper Jane Charlotte Beckford (c. 1759-1825); possibly the daughter of George Ffrench, Clerk to the Jamaica Assembly. Spinster; independently wealthy slave-owner.. Visit the people of interest section. ...
Items where Subject is Physical Sciences | Chemistry - DORAS
DCU ConnectedconnectedWhat if you could work towards a world-class online Irish University degree on your own schedule, from the comfort of your own home, in your own town, in any place in the world? Online learning with DCU Connected gives you remote access to all the resources of an established university: an innovative curriculum, renowned teachers and lively exchange with your fellow learners.
Alina Dulau Florea, MD | Aplastic Anemia and MDS International Foundation
Our study involves the analysis of normal and abnormal cells in the bone marrow of patients with Paroxysmal Nocturnal Hemoglobinuria (PNH). In this condition, due to a gene mutation, some bone marrow cells and their progeny in the blood lack an important cell surface component that functions as an anchor for other proteins, some of which attach to blood cells and protect them from destruction by complement, part our immune system. The result of this deficiency is a breakdown of red cells. If large quantities of red cells are destroyed, people become very tired, or have pain in the belly, head or when swallowing, or develop blood clots. The cause of the gene mutation is unknown. Some patients with other conditions, such as aplastic anemia (AA, a disease where marrow stops producing blood cells), or myelodysplasia (MDS, a disease associated with a tendency to transform into leukemia), may develop PNH. It is not clear what makes this change occur, and when it happens, patient may not even be aware ...
Archaeognatha | What Bug Is That?
Bristletails are primitive wingless insects. At first glance they resemble silverfish, however silverfish have three abdominal filaments nearly equal in length. In bristletails, the central filament is much longer than the side two. Unlike silverfish, bristletails have well developed compound eyes. The compound eyes are large and meet on the back of the head. Three simple eyes (ocelli) also occur on bristletails. Bristletails have well developed mandibles which are partially hidden in the head. The antennae are long and resemble a chain of beads (moniliform). Bristletails are usually nocturnal and have an interesting habit of arching and flexing the body to give a springing action similar to springtails. Bristletails are found in litter, moss, lichens and other similar habitats ...
Map of Life | Senses
An organisms senses connect it to the outside world and are essential in allowing it to react adequately to environmental stimuli. As the structure of sensory organs is limited by the physical properties of the signals they are supposed to pick up (e.g. light, sound), it is not surprising that they represent prime examples of evolutionary convergence.. With respect to vision, classic cases of convergence include the camera eye (which has not only been invented by cephalopods and vertebrates but also by several other groups) and the compound eye (famously found in arthropods as well as in other invertebrates). Colour vision has evolved multiple times in insects and vertebrates, but remarkably is also found in mantid shrimps, highly effective predators with complex compound eyes. Vertebrates are primitively tetrachromatic (having four different types of cone cells with different light absorption spectra), but most mammals are dichromatic, which might reflect a transition to a nocturnal way of ...
Sub-cellular localisation of the white/scarlet ABC transporter to pigment granule membranes within the compound eye of...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
SPINSTER STITCHER
Coni, you need to get your shit together. Excuse my bluntness, but you are a mess and you are seemingly oblivious to the consequences. You can joke and make funny snappy comebacks but it is way past the time for you to get serious. This is your life at stake. Not a missed stitch, not a lost house, not an asshole sister - your life. Does anything else even matter? Or come close? Stop calling your port by a silly little name. It is not a silly little personality, its a medical intervention to help save your life. It doesnt have moods or feelings, if its hurting, something is wrong, fix it and move on with your treatments ...
Byrnes, J.<...
Florea, V., Rieger, A. C., DiFede, D. L., El-Khorazaty, J., Natsumeda, M., Banerjee, M. N., Tompkins, B. A., Khan, A., Schulman, I. H., Landin, A. M., Mushtaq, M., Golpanian, S., Lowery, M., Byrnes, J., Hendel, R., Cohen, M. G., Valasaki, K., Pujol, M. V., Ghersin, E., Miki, R. & 11 others, Delgado, C., Abuzeid, F., Vidro-Casiano, M., Saltzman, R. G., DaFonseca, D., Caceres, L. V., Ramdas, K. N., Mendizabal, A., Heldman, A. W., Mitrani, R. & Hare, J., Nov 10 2017, In : Circulation Research. 121, 11, p. 1279-1290 12 p.. Research output: Contribution to journal › Article ...
PMC Links for BioProject (Select 62397) - PMC - NCBI
Rami A. Dalloul, Julie A. Long, Aleksey V. Zimin, Luqman Aslam, Kathryn Beal, Le Ann Blomberg, Pascal Bouffard, David W. Burt, Oswald Crasta, Richard P. M. A. Crooijmans, Kristal Cooper, Roger A. Coulombe, Supriyo De, Mary E. Delany, Jerry B. Dodgson, Jennifer J. Dong, Clive Evans, Karin M. Frederickson, Paul Flicek, Liliana Florea, Otto Folkerts, Martien A. M. Groenen, Tim T. Harkins, Javier Herrero, Steve Hoffmann, Hendrik-Jan Megens, Andrew Jiang, Pieter de Jong, Pete Kaiser, Heebal Kim, Kyu-Won Kim, Sungwon Kim, David Langenberger, Mi-Kyung Lee, Taeheon Lee, Shrinivasrao Mane, Guillaume Marcais, Manja Marz, Audrey P. McElroy, Thero Modise, Mikhail Nefedov, Cédric Notredame, Ian R. Paton, William S. Payne, Geo Pertea, Dennis Prickett, Daniela Puiu, Dan Qioa, Emanuele Raineri, Magali Ruffier, Steven L. Salzberg, Michael C. Schatz, Chantel Scheuring, Carl J. Schmidt, Steven Schroeder, Stephen M. J. Searle, Edward J. Smith, Jacqueline Smith, Tad S. Sonstegard, Peter F. Stadler, Hakim Tafer, ...
1998 | MTA ÁOTI
Publications in 1998 (The underlined authors are from the Institute.) Barrow, P. A., Lovell, M. A., Szmolleny, G., and Murphy, C. K. (1998): Effect of enrofloxacin administration on excretion of Salmonella enteritidis by experimentally infected chickens and on quinolone resistance of their Esherichia coli florea. Avian Pathology 27. 586-590.
1998 | MTA ÁOTI
Publications in 1998 (The underlined authors are from the Institute.) Barrow, P. A., Lovell, M. A., Szmolleny, G., and Murphy, C. K. (1998): Effect of enrofloxacin administration on excretion of Salmonella enteritidis by experimentally infected chickens and on quinolone resistance of their Esherichia coli florea. Avian Pathology 27. 586-590.
Morphology of a Butterfly | Major Body Parts of A Butterfly | Thorax | Abdomen
The Eye - An Incredible Creation of Nature - Stories and Articles
The basic structure of eyes that we see today was present during the Cambrian era, but there is a lot of variety. The male version of the mayfly has a large compound eye which allows it to watch the sky for the form of a female. The four-eyed fish is able to look up to the surface of the water, and also keep watch below for any danger. Human eyes are fast, but birds of prey have superior resolution.. Nilssons research has shed light on an ongoing debate about the evolution of eyes. Some scientists believed there were many origins; others suggested there was only one step in their evolution. This latter idea was based on the discovery of a gene, called Pax6, which controls the development of eyes.. They are all right. The eyes of many organisms have evolved from Nilssons first stage. All eyes begin with the same building block, a protein called an opsin. Opsins hold a chromophore which is able to take in the energy of a photon. The chromophore and the opsin set off the start of ...
owlet moths data - Encyclopedia of Life
Definition: superposition compound eyes where each ommatidium is equipped with a lens cylinder arrangement, producing the equivalent of a pair of lenses, with the first lens producing a small image halfway down the structure and the second lens turning the image back into a parallel beam. In the process the ray direction is reversed. Thus, the emerging beam is on the same side of the axis as the entering beam-the condition for obtaining a superposition image from the whole array ...
Balkan Ecology Project : Aphid Life Cycle
Life history. In October the females lay eggs usually on the stems of trees or shrubs. The eggs are black, with thick shells and can withstand extremes of temperature. It is in the egg form only that aphids pass the winter. In March the eggs hatch out into wingless female nymphs which are similar to the adults, with three pairs of legs, compound eyes, antennae, etc. There is no larval or pupal stage comparable to those of the butterfly, but with successive moults and continuous growth the nymphs become mature females. No males are hatched at all ...
Colleen McCullough dies at 77; author of 'Thorn Birds,' mysteries - LA Times
When she was young, Colleen McCullough realized she would spend her old age in poverty unless she started to write. As I moved through my 20s and 30s, I became aware that I was going to be a 70-year-old spinster living in a cold-water, walk-up flat with a single 60-watt light bulb, she later...
Kensington Publishing Corp: : Faking It: The It Girls #1
Havent you ever told a little lie in the name of love?. Vivia Grant couldnt be happier. She has her dream job and is about to marry her dream man. Does it really matter that shes led him to believe shes a virgin? After all, being in love makes every experience feel like the first time anyway! But an unexpected encounter with an ex-lover is about to expose her embarrassing lie…. When Vivias fiancé discovers the truth, he ends their engagement-via text-and uses his connections to get her fired. Unemployed and heartbroken, Vivia begins planning her new future-as a homeless spinster. But her best friend has a better idea. Theyll skip the Ben & Jerrys binge and go on Vivias honeymoon instead. Two weeks cycling through Provence and Tuscany, with Luc de Caumont, a sexy French bike guide. Too bad Vivias not a big fan of biking. And shes abysmal at languages. Will she fib her way through the adventure, or finally learn to love herself-and Luc-flaws and all? Leah Marie Brown has a wily way ...
Gyimie Is Too Much In Ghana - Uncle Ebo Whyte » Globecalls.Com
On A to Z Showbiz with George Quaye on JoyFM, the author revealed that Ghanaian society makes life unbearable for young ladies who are spinsters when young
Savi-Ruchi: Uddina Vade(MedhuVada)
Back at home, my mom prepares this vada only on Vaideeka/Tithi/Shraddha & on Mahalaya Amavasye (New moon day of Pitrupaksha). She says, we are not supposed to prepare this on other days. Spinsters are not allowed to help their moms on that day or for that matter, they are not allowed to enter the kitchen too. Only married women shall observe fast & cook the food for all of us. Hence, I never got an opportunity to look & learn this recipe. But my mom used to always share her experiences while cooking this vada. She doesnt use either mixer or grinder to prepare the paste. She does it using the age old oralukallu. She briefed me about this recipe & TADA.., it was super soft & tasted great. I have never gone wrong while preparing this ...
wrd.wthiin.woord: Wingless eliminates ommatidia from the edge of the developing eye through activation of apoptosis, also known...
and i was struck with the neato microscopy images & highly specialized language & thot id make a post out of it & hopefully it wont offend any of the involved biologists & their work can be said to have poetic qualities as just about everything does but context is context & flyeyes are flyeyes. ...
Protein KASH5
MDLPEGPVGGPTAEMYLRERPEEARLGMPVSLEEQILNSTFEACDPQRTGTVAVAQVLAYLEAVTGQGPQ 1 - 70 DARLQTLANSLDPNGEGPKATVDLDTFLVVMRDWIAACQLHGGLELEEETAFQGALTSRQLPSGCPEAEE 71 - 140 PANLESFGGEDPRPELQATADLLSSLEDLELSNRRLVGENAKLQRSMETAEEGSARLGEEILALRKQLHS 141 - 210 TQQALQFAKAMDEELEDLKTLARSLEEQNRSLLAQARQAEKEQQHLVAEMETLQEENGKLLAERDGVKKR 211 - 280 SQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLAQTLEEYRVTTQELRLEISRLEEQLSQTYEG 281 - 350 PDELPEGAQLRRVGWTELLPPSLGLEIEAIRQKQEVATADLSNPLCGVWQWEEVIHETSEETEFPSEAPA 351 - 420 GGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDAESQVTADLPVPLGAPRPGDIPENPPERPARRELQQAL 421 - 490 VPVMKKLVPVRRRAWGQLCLPPQRLRVTRHPLIPAPVLGLLLLLLLSVLLLGPSPPPTWPHLQLCYLQPP 491 - 560 PV 561 - 562 ...
Author: Delaney, Colm - DORAS - DCU
Bruen, Danielle and McColgan, Adam and Delaney, Colm and Florea, Larisa and Diamond, Dermot (2016) Fluorescence Sensing for Non-Invasive and Continuous Glucose Detection. In: American Advanced Materials Congress 2016, 4th-9th Dec 2016, The Caribbean Sea.. Daikuzono, Cristiane and Florea, Larisa and Delaney, Colm and Tesfay, Henok and Morrin, Aoife and Diamond, Dermot and Novais de Oliveira Jr., Osvaldo (2016) Impedance spectroscopy for the detection of monosaccharides using functionalized carbon screen-printed electrodes on paper. In: E-MRS 2016 Fall Meeting, 19 to 22 Sept 2016., Warsaw, Poland.. Bruen, Danielle and Delaney, Colm and Florea, Larisa and Diamond, Dermot (2016) Boronic acid derivatives for indirect fluorescent glucose sensing. In: 3rd Insight Student Conference 2016, 14 Sept. 2016, Dublin City University, Dublin, Ireland.. Tudor, Alexandru and McColgan, Adam and Delaney, Colm and Florea, Larisa and Diamond, Dermot (2016) Functional ionic liquids for solvent sensing. In: The 3rd ...
Local band Spinster to plant new roots in Colorado, reimagines musical project with Annie Oakley
Full headline: Local band Spinster to plant new roots in Colorado, reimagines musical project with Annie Oakley members Originally published by OU Daily, Sept. 15, 2019. Spinster is packing its bags. Jo Babb, the frontwoman of the indie-rock band, said after five years of performing in one group or another in the OKC metro area - its time for her to move on. Babb plans to move to Fort Collins, Colorado, in November to re-imagine the musical project and continue to create music with her twin sis
Ommatidia | definition of ommatidia by Medical dictionary
Looking for online definition of ommatidia in the Medical Dictionary? ommatidia explanation free. What is ommatidia? Meaning of ommatidia medical term. What does ommatidia mean?
Triops - Wikipedia
The name Triops comes from the Greek τρία (tría) meaning three and ὤψ (ops) meaning eye.[8] The head of T. longicaudatus bears a pair of dorsal compound eyes that lie close to each other and are nearly fused together. The compound eyes are generally sessile (not stalked). In addition, there is a naupliar ocellus (the third eye) between them. The compound eyes are on the surface of the head, but the ocellus is deep within the head. All the eyes, however, are easily visible through the shell covering of the head. Franz von Paula Schrank was the first author to use the genus name Triops,[9] coining it in his 1803 work on the fauna of Bavaria. Their German name was Dreyauge, which means three-eye. He collected and described specimens from the same locality in Regensburg from which Schäffer, another naturalist who had studied the Notostraca, obtained his specimens in the 1750s. However, other authors, starting with Louis Augustin Guillaume Bosc, had adopted the genus name Apus for ...
Beyond the Human Eye: Four-eyed Fly
These remarkable eyes belong to a male St. Marks fly Bibio marci - which has not one pair of compound eyes, but two. This is the black fly that dances just above the grass on spring days, dangling its long hind legs. You can find a picture of this behaviour on Nyctaluss Stand and Stare blog. These dancing males are on the lookout for females, which they approach from below, and the conjecture is that those long, fine hairs in between each individual compound eye lens (ommatidium) somehow help in the flys detection of movement above and precise positioning when he grabs a female. ...
ADW: : INFORMATION
Panstrongylus megistus is similar to other members of the Triatominae in physical appearance. The species have hemielytra (modified forewings) and mouthparts adapted for piercing blood vessels. Their heads are forwardly directed, freely moveable, and are set on an identifiable neck. The head is flattened, though elevated on the posterior half, and has 3 sclerite sections, the clypeus and two genae. For the mouthparts, the rostrum is the modified labium that protects the stylets. The stylets consist of transformed mandibles and maxillae which assist in feeding. The compound eyes on the head are associated laterally and are usually black. There are also two smaller ocelli, or simple eyes, behind the compound eyes. The thorax consists of a pronotum, a dorsal shield-like sclerite which covers the first two-thirds of the thorax, and a scutellum, which covers the final third. The ventral sclerite is called the prosternum which is smaller than the pronotum. There are two pairs of wings: the hindwings ...
Search
In this paper, metamorphosis of laboratory-reared cyprids of the pedunculate cirripede, Capitulum mitella was successfully induced. A timeline and a detailed description of morphological events during metamorphosis were derived from light microscopy and scanning electron microscopy analyses. The metamorphic process of cyprids involves five main events. (1) Triggering of metamorphosis: after 0-6 h of reagent exposure, the epidermis ventral to the compound eyes gradually invaginates. (2) Invagination and separation of epidermis: after 6-36 h, the invagination bypasses the compound eyes, the cypris epidermis separates slightly from the carapace and the nauplius eye gradually migrates ventrally. (3) Formation of juvenile rudiment: after 36-72 h, the metamorphosing specimen shape slightly resembles that of a juvenile. (4) Shedding of thoracopodal exuvium: after 72-96 h, the cyprid finally sheds the thoracopodal exuvium and metamorphoses into a juvenile barnacle. (5) Early development of juvenile ...
RightWingRocker: Spinster Preview #1: A State of the Union Carole - Chapter 1
The President stared at the door as it closed behind the hapless young man who had proved to be such a disappointment. A good speech writer was invaluable to a man of his elevated stature, and he needed some time to review the speech before he had to stand in the full House of Representatives and read the speech before the joint houses of Congress. He could read off the teleprompter with a skill and ease that few people possessed, but it helped to feel at least a little comfortable with the text. He already received a bit of flack from those nasty right wing zealots over the way he looked down his nose when he spoke, but it was the only way he could read the teleprompter and keep his head up. And everybody knew those crazies on the right were just looking for something bad to say about him, but he had his revenge. He worked in a way to blame them in nearly every speech and, though he had done interviews with Oprah and The View, he still refused to appear on that other network. The one he ...
INFLAMMATION AND DEPRESSION | Vegan Spinster
INFLAMMATION AND DEPRESSION Judging by my rheumie doctors reactions to my statements about yoga and other forms of exercise, diet, and stress management, he would be against or know nothing about any article in this issue of Arthritis Today magazine. Studies have reported a general link between inflammation and depression. Johns Hopkins University researchers reported in…
Integration of polarization and chromatic cues in the insect sky compass.
Animals relying on a celestial compass for spatial orientation may use the position of the sun, the chromatic or intensity gradient of the sky, the polarization pattern of the sky, or a combination of these cues as compass signals. Behavioral experim
Kempnyia goiana Bispo & Froehlich 2004 - Plazi TreatmentBank
In some specimens, sternum 9, 10 and 11 colorless. Egg oval ( Fig. 3DView FIGURES 3), 0.375 x 0.225 mm. Description of nymph. General color varying from dark yellow to brown. Head brown, but lighter around eyes, frontoclypeal and near posterior ocelli; presence of two small lighter spots above a conspicuous M-line; compound eyes black; below eyes a dendritic brown spot; three ocelli black, the third being smaller; post-frontal line not exceeding the paired ocelli ( Fig. 4AView FIGURES 4). Antennae yellow to dark yellow. Clypeus yellow to brown. Labrum dark yellow; maxillae varying from brown to dark yellow with lacinia dark yellow and galea yellow; mandible yellow to dark brown, 5 pointed teeth on distal margin, mostly decreasing in size toward base, but teeth 2 and 4 similar in size ( Figs. 5A, 5B and 5CView FIGURES 5). Pronotum rectangular, lateral band in some specimens larger ( Fig. 4AView FIGURES 4). Pronotum, mesonotum, and metanotum varying from dark yellow to brown, with light spots ...
Fishman, J. E.<...
Hare, J., DiFede, D. L., Rieger, A. C., Florea, V., Landin, A. M., El-Khorazaty, J., Khan, A., Mushtaq, M., Lowery, M., Byrnes, J., Hendel, R., Cohen, M. G., Alfonso, C. E., Valasaki, K., Pujol, M. V., Golpanian, S., Ghersin, E., Fishman, J., Pattany, P., Gomes, S. A. & 12 others, Delgado, C., Miki, R., Abuzeid, F., Vidro-Casiano, M., Premer, C., Medina, A., Porras, V., Hatzistergos, K. E., Anderson, E., Mendizabal, A., Mitrani, R. & Heldman, A. W., Feb 7 2017, In : Journal of the American College of Cardiology. 69, 5, p. 526-537 12 p.. Research output: Contribution to journal › Article ...
NLCS Achieves Savings With New Internet Contract | WBIW
(BEDFORD) - The North Lawrence Community Schools reduced internet costs by more than $40,000 with the new eRate/WAN contract. This saving is attributed to fewer facilities needing internet services within the corporation due to consolidation. The original contract was more than $80,000. In other ...
Les phénomènes de pseudopupille dans lœil composé de Drosophila | SpringerLink
In the compound eyes of the fruitflyDrosophila, the dioptric system of each ommatidium is able to form virtual images of the receptor terminals (rhabdomere
Midge head, SEM - Stock Image C001/1838 - Science Photo Library
Midge head. Coloured scanning electron micrograph (SEM) of part of the head of a midge, showing an antenna (yellow, lower right) and a compound eye (purple, top). The eye is formed from numerous lens structures known as ommatidia. Midges are tiny flies that feed on the blood of animals by inserting a needle-like proboscis (not seen). Magnification: x350 when printed 10 centimetres wide. - Stock Image C001/1838
About UnRipe - unRipe Community
After forming a local childless womens Facebook group from a desperation to meet up with other women just like me, I soon knew that I had found my tribe.. I have have seen firsthand the need for women to talk about our journeys as childless and childfree women. Weve been silent too long and Im here to tell you that our community of not made up of the sad spinsters or unhappily married and desperate for kids and wondering what the hell life is about. Actually, that last part is sometimes true. Were seekers. Were all the things that women can be, and I know we need to talk about it all!. This community has experienced childlessness in a variety of ways - some are single and have not met an appropriate partner, some are married and have gone through IVF, and for some, their decision to be childfree has always been clear.. For those of us whose choices were made for us, we have had to re-evaluate our lives - weve lost our best friends because were not part of the mum community, other women ...
Susan Boyle Dreams Dream ... Falls Short - ABC News
Britain has talent, but millions of Brits decided Susan Boyle, the ample Scottish spinster, didnt have the most. Boyle was bested by the 11-person street dance group Diversity, which performed a high-energy dance number that got the crowd and the country roaring.
The Bookish Type: The Rectors Daughter by F.M. Mayor
Mary Jocelyns life is not what one would call exciting by any standard. In The Rectors Daughter by F.M. Mayor, Mary lives a quiet country life caring for her disabled sister and aging father, the county rector. Canon Jocelyn was a handsome man in his day, not to mention brilliant, and still retains vestiges of his younger appearance and every shred of his mental faculties. Mary, on the other hand, has always been plain. As a middle-aged spinster, this is more true than ever. She did inherit her fathers intelligence, but could not sharpen her wits to the same degree because of the lack of an established womens education system. Still, her smarts are enough to set her up as a oddity to the villagers surrounding her. Her father is by no means an affectionate man and her mother died when she was very young - as a result, Marys always been alone. However, shes never really minded solitude. She passes her days in a kind of empty contentment, and shes perfectly fine with it. All of that changes, ...
Generations have trod - Reginald Angus Fleming
He married Stella Jolliffe on 31 January 1929 in All Saints Church, Canowindra, AustraliaG. The consent of both fathers was obtained. Charles Taylor Fleming was a Shire Clerk while James Jolliffe was a Contractor. The groom, a Bachelor Bank Clerk, was aged 20 from Orange and the bride, a Spinster Clerk, was 18 and lived at Cowra.1,2 He and Stella Jolliffe were divorced circa 1943. He married Winifred Hanigan on 23 October 1948 in Sydney, AustraliaG.2 ...
Letters from Nicaragua | Rebecca Gordon
U.S.A. Spinster/Aunt Lute, 1986. Paperback. Very Good. Item #166884 ISBN: 093321622X 093321622X Thumbed with small creasing to cover, minor crease to spine, name to first page, else tight and clean.
Ocelli Cream/Charcoal textil från Sanderson - Tapetorama
Ocelli Cream/Charcoal är en av många tyger från Sanderson ur kollektionen Madison Prints som finns att köpa på Tapetorama - Mängdrabatter - Personlig service - Beställ prover
人ELMO2肽(ab22879)|Abcam中国
购买我们的人ELMO2肽。ab22879可作为ab2240的封闭肽并经过Blocking实验验证。Abcam提供免费的实验方案,操作技巧及专业的支持。中国80%以上现货。