TY - JOUR. T1 - Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino-terminal sequence. AU - Teizo, Yoshimura. AU - Robinson, Elizabeth A.. AU - Appella, Ettore. AU - Matsushima, Kouji. AU - Showalter, Stephen D.. AU - Skeel, Alison. AU - Leonard, Edward J.. PY - 1989/1. Y1 - 1989/1. N2 - Human monocyte-derived neutrophil chemotactic factor (MDNCF) was purified from culture supernatant of lipopolysaccharide-stimulated human peripheral blood mononuclear leukocytes on a column of Sepharose-bound murine monoclonal anti-MDNCF. About 65% of the culture fluid chemotactic activity was bound to the column. The unbound 35% probably represents chemotactic activity of other cytokines in the culture fluid. More than 85% of the bound activity was eluted by pH 2.5 glycine buffer. When this material was applied to an HPLC-CM column, gradient elution produced four well-separated A280 peaks, each of which had chemotactic activity. N-terminal amino ...
Define macrophage chemotactic factor (MCF). macrophage chemotactic factor (MCF) synonyms, macrophage chemotactic factor (MCF) pronunciation, macrophage chemotactic factor (MCF) translation, English dictionary definition of macrophage chemotactic factor (MCF). n. Any of various large, phagocytic white blood cells that develop from monocytes, are found in the spleen, liver, and other tissues, and have a variety of...
Treatment of serum with 10 mg/ml of nanoparticle carbon black generated substances that induced a 1.8-fold increase in macrophage migration (P < 0.001) compared with untreated serum. This effect was partially inhibited by antioxidant intervention. Serum treated with an equivalent mass of fine carbon black did not display any chemotactic potential. tBHP treatment of the serum did not result in the generation of macrophage chemotactic factors ...
Inflammatory cytokines induce synthesis and secretion of gro protein and a neutrophil chemotactic factor but not beta 2-microglobulin in human synovial cells an
Primobolan side effects is a selective agonist of beta2-adrenergic receptors. At therapeutic doses it acts on beta2-adrenergic receptors of smooth muscles of the bronchi, providing pronounced bronchodilator effect, prevents and relieves bronchospasm, increases lung capacity. It prevents the release of histamine, slow reacting substances from mast cells and neutrophil chemotactic factors. It is a small …. Read more ...
Primobolan side effects is a selective agonist of beta2-adrenergic receptors. At therapeutic doses it acts on beta2-adrenergic receptors of smooth muscles of the bronchi, providing pronounced bronchodilator effect, prevents and relieves bronchospasm, increases lung capacity. It prevents the release of histamine, slow reacting substances from mast cells and neutrophil chemotactic factors. It is a small …. Read more ...
Shop Leukocyte cell-derived chemotaxin ELISA Kit, Recombinant Protein and Leukocyte cell-derived chemotaxin Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Cytokines and chemokines play critical roles in the pathogenesis of asthma. Azithromycin, a macrolides, is frequently used in asthmatic children with lower resp
Chemical substances that attract or repel cells. The concept denotes especially those factors released as a result of tissue injury, microbial invasion, or immunologic activity, that attract LEUKOCYTES; MACROPHAGES; or other cells to the site of infection or insult.
Lect2 - Lect2 (untagged) - Mouse leukocyte cell-derived chemotaxin 2 (Lect2), (10ug) available for purchase from OriGene - Your Gene Company.
1988 chev trans takes high rpm to shift from 1st to 2nd and some times it wont down shift when you slow down and - Chevrolet 1988 C1500 question
Kimball Medical Center News 2013, 2014. Barnabas Health delivers comprehensive healthcare services to the residents of New Jersey. Cancer, pediatrics, cardiac, and womens health treatments available.
TY - JOUR. T1 - Differential regulation of the expression of cytokine-induced neutrophil chemoattractant by mouse macrophages. AU - Crippen, Tawni L.. AU - Riches, David W H. AU - Hyde, Dallas M.. PY - 1998. Y1 - 1998. N2 - The production of cytokine-induced neutrophil chemoattractant (CINC) by functionally diverse mouse bone-marrow-derived macrophages was determined. Studies showed that β1,3-glucan, IL-1β, TNFα and IFNγ/TNFα induced expression and production of CINC in macrophages while neither IFNγ nor TGFβ alone induced detectable CINC expression. Pretreatment or simultaneous treatment of macrophages with TGFβ resulted in suppression of CINC protein production. These studies demonstrate that IFNγ and TNFα, found early during the inflammatory response, induce production of CINC, as well as induce macrophages into a cytocidal state that are capable of killing transformed cells, parasites and bacteria, and recruiting neutrophils. In contrast, TGFβ, found during reparative stages of ...
If you wish to reuse any or all of this article please use the link below which will take you to the Copyright Clearance Centers RightsLink service. You will be able to get a quick price and instant permission to reuse the content in many different ways.. ...
CP002355.PE262 Location/Qualifiers FT CDS_pept 251606..252700 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Sulku_0263 FT /product=methyl-accepting chemotaxis sensory transducer FT /note=COGs: COG0840 Methyl-accepting chemotaxis protein; FT InterPro IPR004090: IPR004089; KEGG: cla:Cla_1032 FT MCP-domain signal transduction protein; PFAM: chemotaxis FT sensory transducer; SMART: chemotaxis sensory transducer; FT SPTR: Methyl-accepting chemotaxis protein; PFAM: FT Methyl-accepting chemotaxis protein (MCP) signaling domain; FT Myosin-like coiled-coil protein FT /db_xref=EnsemblGenomes-Gn:Sulku_0263 FT /db_xref=EnsemblGenomes-Tr:ADR32930 FT /db_xref=GOA:E4TY17 FT /db_xref=InterPro:IPR004089 FT /db_xref=InterPro:IPR004090 FT /db_xref=InterPro:IPR025991 FT /db_xref=UniProtKB/TrEMBL:E4TY17 FT /protein_id=ADR32930.1 FT /translation=MGWFSDDTELKEELSVLQKENTALRDENQELARKLQECEAKIAKE FT DERHRCENASMIMTYQNEQLKKNLVDVQGNMASSVASSKENIAQSTALLENIVELGQKA FT ...
The presence of neutrophils in the synovial joint of patients with rheumatoid arthritis (RA) is thought to be due to the activity of chemotactic factors released by activated cells in the joint. We have shown in this report, for the first time, the abundance of one such factor, interleukin 8 (IL 8), in the synovial fluid of patients both with RA and other non-RA joint diseases, and the spontaneous production of IL 8 mRNA by RA synovial cells in culture. There was no correlation between the levels of chemotactic activity and IL 8 protein, suggesting that other factors with similar neutrophil chemotactic activity are also present in the synovial fluid exudate. In support of this concept neither the level of chemotactic activity nor IL 8 protein levels correlated with neutrophil or leukocyte infiltration, indicating that the mechanism of migration into the inflammatory environment of the joint is complex. Such migration is likely to be due to a number of chemotactic signals in addition to IL 8, which may
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Rat CXCL2/MIP-2 (macrophage inflammatory protein-2) is a 69-amino acid CXC chemokine. MIP-2 is induced during acute inflammation in rat models of disease. It is a potent neutrophil chemotactic factor both |i|in vitro|/i| and|i| in vivo|/i|.
The recruitment of mononuclear leukocytes, and the migration, growth and activation of macrophages, lymphocytes and smooth muscle cells within lesions, are critical features of the chronic inflammatory response that typifies atherogenesis. Chemokines are members of a superfamily of small polypeptides that mediate not only migration, but also growth and activation of leukocytes and a variety of other cells. Monocyte chemoattractant and activating protein-1 was the first chemokine to be implicated in leukocyte-mediated inflammation in atherosclerosis. This review emphasizes new information on the potential atherogenic roles of monocyte chemoattractant and activating protein-1 and several other closely related chemokines of the C-C subfamily. We focus particular attention on the newly recognized atherogenic role of a subgroup of closely related chemokines of the C-X-C subfamily that includes interleukin-8 and growth regulated oncogene alpha. We also discuss new studies that reveal how CD40 ligand ...
Bacterial lipopolysaccharides (LPS) derived from a variety of organisms effectively induced C consumption in humans, bovines, and porcines with developmental agammaglobulinemia; birds with experimental agammaglobulinemia; and humans with agammaglobulinemia syndromes. This interaction proceeded even in precolostral piglet sera which contained less than 2.5 x 10-6 mg/ml gamma globulin, and led to generation of neutrophil chemotactic factor and anaphylatoxin in these sera. Hence, the LPS-C interaction can proceed in sera markedly deficient in immunoglobulin. The question of whether immunoglobulins can be bypassed in the LPS-C interaction, or whether they are regularly utilized in a way so efficient that their participation is masked, was considered. ...
Methods Quiescent cultured RASMCs were pretreated with E2 or vehicle for 24 hours before tumor necrosis factor (TNF)-α was added. After 6 hours of treatment, total RNA was extracted from cells using TRIzol reagent, and SYBR green real-time RT-PCR was used to detect expression of CINC-2 mRNA. Conditioned media was collected and concentrated to measure CINC-2 protein level by ELISA. To assess neutrophil chemotactic activity of conditioned media, in vitro chemotaxis assays were performed using differentiated HL-60 cells in a 96-well modified Boyden chamber appropriate for the evaluation of leukocyte chemotaxis. The nonselective ER antagonist ICI-182780 was given to cells 2 hours prior to E2 incubation to study the mechanism of E2 effect. ...
PH-domain translocation with uniform stimulus. Kinetic analysis of the translocation from the cytoplasm to the plasma membrane of GFP-tagged CRAC (Cytosolic Regulator of Adenylyl Cyclase-a PH domain containing protein) in response to a uniform increase in chemoattractant concentration. Frames were taken every 2 seconds. The chemoattractant was added just before the cell goes out of focus. From C.A. Parent and P.N. Devreotes, Johns Hopkins Medical Institutions ...
During chemotaxis large eosinophils from newts exhibit a gradient of [Ca2+]i from rear to front. The direction of the gradient changes on relocation of the chemoattractant source, suggesting that the Ca2+ signal may trigger the cytoskeletal reorganization required for cell reorientation during chemotaxis. The initial stimulatory effect of chemoattractant on [Ca2+]i and the opposite orientations of the intracellular Ca2+ gradient and the external stimulus gradient suggest that more than one chemoattractant-sensitive messenger pathway may be responsible for the generation of spatially graded Ca2+ signals. To identify these messengers, Ca2+ changes were measured in single live cells stimulated with spatially uniform chemoattractant. On stimulation spatially averaged [Ca2+]i increased rapidly from | or = 100 nM to | or = 400 nM and was accompanied by formation of lamellipods. Subsequently cells flattened, polarized and crawled, and [Ca2+]i fluctuated around a mean value of approximately 200 nM. The initial
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
The mobilisation of leukocytes to inflammatory sites is crucial to host defense. Over the years a wealth of information has evolved concerning the mechanism of leukocyte locomotion and factors with...
DI-fusion, le Dépôt institutionnel numérique de lULB, est loutil de référencementde la production scientifique de lULB.Linterface de recherche DI-fusion permet de consulter les publications des chercheurs de lULB et les thèses qui y ont été défendues.
Affiliation:熊本大学,医学部,助手, Research Field:Experimental pathology, Keywords:Immunohistochemistry,組織分布,Chemotactic factor,Hageman factor,Dhemical mediator,アレルギー,血管透過因子,Kinetics,Delayed hypersensitivity,血管透過性亢進, # of Research Projects:1, # of Research Products:0
An apparatus and method of use for assaying cellular motility in response to a concentration gradient of a chemotactic agent. Generally, the apparatus includes a chamber having a region for receiving
Definition of Eosinophil Chemotactic Factor in the Financial Dictionary - by Free online English dictionary and encyclopedia. What is Eosinophil Chemotactic Factor? Meaning of Eosinophil Chemotactic Factor as a finance term. What does Eosinophil Chemotactic Factor mean in finance?
Looking for eosinophil chemotactic factor? Find out information about eosinophil chemotactic factor. A peptide released from mast cell granules that stimulates chemotaxis of eosinophils; may be responsible for accumulation of eosinophils at sites of... Explanation of eosinophil chemotactic factor
Im doing a project for my cell class (sorry if this is in the wrong forum--I couldnt find a homework forum) about the eosinophil chemotactic factor. I was wondering if someone could point me in the right direction for a few answers. My professor seemed to think everything could be found online and I dont doubt him, Im just getting conflicting answers. Heres what I have so far ...
Cultured rabbit aortic and human carotid artery endothelial cells produced a factor that was chemotactic for monocytes but not for neutrophils. Checkerboard analysis showed that the activity was due to chemotaxis and not to chemokinesis. The factor was produced in both serum-containing and serumless media. Treatment with carboxypeptidase and trypsin resulted in inhibition of chemotactic activity, indicating that the factor is a peptide. Medium from cultures of rabbit aortic, human carotid artery, and human umbilical vein endothelial cells previously exposed to beta migrating very low density lipoprotein (beta-VLDL) had substantially more chemotactic activity than medium from untreated cells or cells exposed to low density lipoprotein. beta-VLDL alone had no chemotactic activity. We conclude that large vessel endothelial cells produce a monocyte chemotactic factor that is increased after exposure of the cells to beta-VLDL. ...
TY - JOUR. T1 - Antigenic identification of chemotactic factor inactivator in normal human serum and bronchoalveolar lavage fluid. AU - Robbins, Richard A.. AU - Rasmussen, Julie K.. AU - Clayton, Marcia E.. AU - Gossman, Gail L.. AU - Kendall, Todd J.. AU - Rennard, Stephen I.. PY - 1987/9. Y1 - 1987/9. N2 - Several proteins have been described that can modulate the activity of the complement component C5a, a potent chemoattractant for neutrophils. One of these inhibitors has been termed chemotactic factor inactivator (CFI). We hypothesized that CFI was antigenically present in normal human serum and that antigenic levels would correlate with the ability of serum to inhibit C5a. To test this hypothesis, CFI was purified from normal human serum, antibodies to CFI were developed in rabbits, and these reagents were used to develop an enzyme-linked immunoadsorbent assay to measure CFI. Sera from 32 normal volunteers were assayed for CFI and found to contain 77 ± 29 μg/ml (range 17 to 137 μg/ml). ...
Four subjects with clinical histories of milk-induced asthma were studied (three allergic to cows milk; one to soya milk). In each instance, skin prick tests, RAST (IgE and IgG4), the basophil histamine release, and serum precipitins, using appropri
Studies in Dictyostelium have shown that the p110-related phosphatidylinositol-3-kinases PI3K1 and PI3K2 are required for proper development, pinocytosis chemotaxis, and chemoattractant-mediated activation of PKB. Insights into the mechanism by which PI3K regulates chemotaxis derive from studies on PKB in mammalian leukocytes and Dictyostelium cells. PKB activation requires its translocation to the plasma membrane by binding of its PH domain to PtdIns(3,4,5)P3 and PtdIns(3,4)P2 produced upon activation of PI3K, leading to PKB activation. In leukocytes and Dictyostelium cells, chemoattractants mediate PKB activation through a G-protein-coupled pathway that requires the activity of the respective PI3Ks. Chemoattractant stimulation of neutrophils and Dictyostelium cells results in a transient localization of a GFP fusion of the PH domains from the Dictyostelium and mammalian PKBs to the plasma membrane. When these cells are placed in a chemoattractant gradient, membrane localization of the ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Chemokines play the key role in initiating immune responses by regulating the attraction and homing of immune cells to the lymphoid and nonlymphoid tissues. CXCL14 is a chemokine that in tumors may act as chemoattractant for monocytes and dendritic cells (DC), which may modulate antitumor immune responses in certain cancers. In this study, we investigated the mechanisms of loss of CXCL14 in prostate cancer cells. Cell treatment with the demethylating agent 5-aza-2-deoxycytidine resulted in the recovery of CXCL14 mRNA and protein expression. Hypermethylated CpG island sequences encompassing the CXCL14 gene promoter were identified. The restoration of CXCL14 by 5-aza-2-deoxycytidine treatment had functional impact, based on the DC chemoattractant activity of conditioned medium from drug-treated cells. Conversely, CXCL14 removal from conditioned media by affinity chromatography abolished its chemotactic properties, confirming that functionally active CXCL14 was generated in prostate cancer cells by ...
We demonstrated that PRT-201 fragments elastin, a protein present in blood vessel walls. The fragmentation of elastin in the outside wall of the blood vessel is thought to inhibit formation of neointimal hyperplasia thereby reducing the risk of patency loss. Elastase causes localized fragmentation of elastin protein fibers present in blood vessel walls. The elastin fragments generated by elastase are chemoattractants for scar forming cells, meaning that the fragments attract these scar forming cells, inhibiting their migration to the lumen. The cells recognize the elastin fragments via receptors present on the cell surface that bind to specific elastin fragment sub-types. The importance of elastin fragments in vascular biology, including the response to vascular injury has been established in the scientific literature over three decades. Published academic studies conducted in animals provide evidence that fragmentation of elastin in the outer wall of the blood vessels from administration of ...
Chemerin is a leukocyte chemoattractant and adipokine with important immune and metabolic roles. Chemerin, secreted in an inactive form prochemerin, undergoes C-terminal proteolytic cleavage to generate active chemerin, a ligand for the chemokine-like receptor-1 (CMKLR1). We previously identified that adipocytes secrete and activate chemerin. Following treatment with the obesity-associated inflammatory mediator TNF alpha, unknown adipocyte mechanisms are altered resulting in an increased ratio of active to total chemerin production. Based on these findings we hypothesized adipocytes produce proteases capable of modifying chemerin and its ability to activate CMKRL1. 3T3-L1 adipocytes expressed mRNA of immunocyte and fibrinolytic proteases known to activate chemerin in vitro. Following treatment with a general protease inhibitor cocktail (PIC), the TNF alpha-stimulated increase in apparent active chemerin concentration in adipocyte media was amplified 10-fold, as measured by CMKLR1 activation. ...
If you are a society or association member and require assistance with obtaining online access instructions please contact our Journal Customer Services team ...
Human IL-16 (hIL-16) is a homotetrameric cytokine with chemotactic properties towards cells expressing the CD4 receptor. This chemotactic cytokine plays an important role in attracting cells of the immune system to the site where CD8+ T-cells were activated for example by a foreign antigen. In addition to the chemotactic activity, hIL-16 also induces expression of IL-2 receptor, increasing the responsiveness to IL-2 and therefore implying a role for specific expansion of the CD4+ T-cell population in an area of induced inflammation. In this report we describe the cloning, sequencing and the expression of feline IL-16 (fIL-16). At the nucleotide level, fIL-16 shows 84.6 and 84.5%, on the amino acid level 93 and 91.5% identity to the human and African green monkey (agm) IL-16, respectively. ...
购买GRO gamma山羊多克隆抗体(ab10367),GRO gamma抗体经WB,ELISA验证,可与人,小鼠,大鼠样本反应。产品出库一年都在质保范围内。中国现货速达。
Principal Investigator:SHOJI Shunsuke, Project Period (FY):1993 - 1995, Research Category:Grant-in-Aid for General Scientific Research (C), Research Field:Respiratory organ internal medicine
Reactivity: Chicken, Cow, Human and more. Compare 11 different LECT1 ELISA Kits & buy the right one directly at antibodies-online.com!
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP ...
小鼠GRO alpha ELISA试剂盒(CXCL1) ELISA试剂盒datasheet (ab100717).Abcam抗体、ELISA、激动剂拮抗剂、表观遗传试剂、蛋白多肽,使用效果保证,中国70%以上现货。
References for Abcams Recombinant human GRO alpha protein (ab73810). Please let us know if you have used this product in your publication
Dirofilaria immitis neutrophil chemotactic factor: aa sequence given in first source; isolated from the adult worm; GenBank D11438
The heterogeneity of the H460 large cell lung cancer cell line was investigated by selecting for chemokinetic cells from a CON population that demonstrated both chemokinesis and chemotaxis. Using Boyden chambers, cells that migrated under chemokinetic conditions were collected and their numbers expanded. Time-lapsed microscopy under isotropic conditions showed that KINE cells moved faster and changed directions more frequently than CON confirming their chemokinetic character. KINE cells which lacked stable focal adhesion were also less adhesive to culture plates compared to CON cells which had focal adhesions at the leading edge shown by phospho-Paxillin-tyr118 antibody labeling. Weak substrate adhesion in KINE cells may account for motile characteristics of rapid and random movement [16-19]. Furthermore, the selection for increased chemokinesis did not compromise the ability of KINE cells to chemotax. KINE cells were also significantly more invasive compared to CON.. These results underscore ...
Bachem offers H-4606 Interferon-Inducible T Cell α-Chemoattractant (human) for your research. Find all specific details here. Find product specific information including available pack sizes, CAS, detailed description and references here.
Combined influence of quartz dust, ozone and NO₂ on chemotactic mobility, release of chemotactic factors and other cytokines by macrophages in ...
The delta psi of R. sphaeroides, grown under high light to reduce the levels of light-harvesting bacteriochlorophyll, was naturally manipulated using light intensity. The relationship between delta psi and the swimming speed of free swimming populations of cells was investigated. After de-energisation by incubation in the dark there was an apparent threshold of about -13 mV which had to be overcome before functional motor rotation could resume and at -45 mV the motor saturated. Further increases in delta psi over -45 mV did not increase the free swimming velocity. However, when a chemokinetic effector was added there was an increase in swimming speed, even though the delta psi was well above saturation, indicating that the chemokinetic response is independent of normal relationship between motor rotation and delta psi.
TNF-α (tumor necrosis factor) is an endogenous pyrogen, able to induce fever, sepsis, cachexia, inflammation and it is implicated in many auto-immune diseases and is linked to cancer progression.. IL-8 (inteleukin-8) causes neutrophils and granulocyte to migrate toward the site of infection. IL-8 is also known to be a potent promoter of angiogenesis.. MCP-1 (monocyte chemotactic protine-1; CCL2) regulates migration and infiltration of monocytes/macrophages. It is implicated in pathogeneses of diseases such as atherosclerosis and neuroinflammatory diseases. Its also highly elevated in breast cancer cells.. RANTES (regulated and normal T cell expressed and secreted) plays an important role in allergic inflammatory processes, carcinogenesis, and are markedly elevated in primary tumor and metastatic lesions from patients with breast or cervical cancer. GROα (CXCL1) has neutrophil chemoattractant activity. It is involved in angiogenesis, inflammation, wound healing and tumorigenesis. ...
CCL5 is an 8kDa protein classified as a chemotactic cytokine or chemokine. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. With the help of particular cytokines (i.e., IL-2 and IFN-γ) that are released by T cells, CCL5 also induces the proliferation and activation of certain natural-killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells.[6] It is also an HIV-suppressive factor released from CD8+ T cells[citation needed]. This chemokine has been localized to chromosome 17 in humans.[5]. RANTES was first identified in a search for genes expressed late (3-5 days) after T cell activation. It was subsequently determined to be a CC chemokine and expressed in more than 100 human diseases. RANTES expression is regulated in T lymphocytes by Kruppel like factor 13 (KLF13).[7][8][9][10] RANTES, along with the related chemokines MIP-1alpha and MIP-1beta, has been identified as a natural HIV-suppressive ...
Bacterial chemotaxis, a remarkable behavioral trait which allows bacteria to sense and respond to chemical gradients in the environment, has implications in a broad range of fields including but not limited to disease pathogenesis, in-situ bioremediation and marine biogeochemistry. And therefore, studying bacterial chemotaxis is of significant importance to scientists and engineers alike. Microfluidics has revolutionized the way we study the motile behavior of cells by enabling observations at high spatial and temporal resolution in carefully controlled microenvironments. This thesis aims to explore the potential of microfluidic technology in studying bacterial behavior by investigating different aspects of bacterial chemotaxis on a microfluidic platform. We quantified population-scale transport parameters of bacteria using videomicroscopy and cell tracking in controlled chemoattractant gradients. Previously, transport parameters have been derived theoretically from single-cell swimming behavior ...
The interactions of tumorigenic cells with the extracellular matrix play a critical role in the establishment of metastases. Thrombospondin (TSP) is prominent at sites of tissue injury and promotes the attachment, spreading, and motility of several cell types. We have investigated the relationship between human carcinoma cell metastatic potential and TSP-mediated cell motility by comparing highly metastatic 11B carcinoma cells with a nonmetastatic counterpart, 22B carcinoma cells. 11B cells demonstrated motility in response to soluble TSP with a maximal effect observed at 1 µm TSP. Checkerboard analysis indicated that motility was directional with a significant chemokinetic component. Monoclonal antibody C6.7, specific for the distal COOH terminus of TSP, inhibited chemotaxis by 60%. Studies with TSP fragments demonstrated that the Mr 140,000 COOH-terminal domain (140K) supported chemotaxis to the same extent as intact TSP. The NH2-terminal heparin-binding domain was ineffective in stimulating ...
Abcams GRO alpha ELISA Kit suitable for Cell culture supernatant, Serum, Plasma in mouse. Reliably quantify 1 pg/ml of GRO alpha.
Synthetic peptide MMK-1 is a highly specific chemotactic agonist for leukocyte FPRL1.: Human phagocytic leukocytes express the seven-transmembrane G-protein-cou
Recruitment of macrophages to sites of cell death is critical for induction of an immunologic response. Calcium concentrations in extracellular fluids vary markedly, and are particularly high at sites of injury or infection. We hypothesized that extracellular calcium participates in modulating the i …
K 76 carboxylic acid: effective in blocking formation of chemotactic factor for tumor cells from human complement; oxidized product of sesquiterpene derivative K 76 from fungus Stachybotrys complementi; do not confuse with hydroxamic acid K-76
Define attractant: a substance (such as a pheromone) that attracts specific animals (such as insects or individuals of the opposite sex)
View Notes - Bio 201 F11 Lect 16 (True) v2r from BIO 201 at SUNY Stony Brook. BiologyintheNews[seefolderonBB] Whyaresomeplantspeciesverysuccessful atinvadingnewgeographicalareas(e.g. NorthAmericafromA