We provide here the underlying data of the scientific publication Product solubility control in cellooligosaccharide production by coupled cellobiose and cellodextrin phosphorylase. Please find the abstract below: Soluble cellodextrins (linear β‐1,4‐D‐gluco‐oligosaccharides) have interesting applications as ingredients for human and animal nutrition. Their bottom‐up synthesis from glucose is promising for bulk production, but to ensure a completely watersoluble product via degree of polymerization (DP) control (DP ≤ 6) is challenging. Here, we show biocatalytic production of cellodextrins with DP centered at 3 to 6 (~96 wt.% of total product) using coupled cellobiose and cellodextrin phosphorylase. The cascade reaction, wherein glucose was elongated sequentially from α‐glucose 1‐phosphate (αGlc1‐P), required optimization and control at two main points. First, kinetic and thermodynamic restrictions upon αGlc1‐P utilization (200 mM; 45°C, pH 7.0) were effectively overcome (53%

Ustilagic acid is an organic compound with the formula C36H64O18. The acid is a cellobiose lipid produced by the corn smut fungus Ustilago maydis under conditions of nitrogen starvation. The acid was discovered in 1950 and was proved to be an amphipathic glycolipid with surface active properties. The name comes from Latin ustus which means burnt and refers to the scorched appearance of the smut fungi. Cellobiose lipids are known as biosurfactants and natural detergents. They can be used in pharmaceutical, cosmetic, and food applications and are known for their strong fungicidal activity on many species.The yeast Pseudozyma fusiformata and Pseudozyma graminicola secrete ustilagic acids, 2-O-3-hydroxyhexanoyl-beta-D-glucopyranosyl-(1→4)-6-O-acetyl-beta-D-glucopyranosyl-(1→16)-2,15,16- trihydroxyhexadecanoic acid. Similar compounds are the extracellular cellobiose lipids of the yeasts Cryptococcus humicola and Trichosporon porosum : ...

Biodegradable plastics can be made from polylactate, which is a polymer made from lactic acid. This compound can be produced from renewable resources as substrates using microorganisms. Bacillus subtilis is a Gram-positive bacterium recognized as a GRAS microorganism (g enerally r egarded a s s afe) by the FDA. B. subtilis produces and secretes different kind of enzymes, such as proteases, cellulases, xylanases and amylases to utilize carbon sources more complex than the monosaccharides present in the environment. Thus, B. subtilis could be potentially used to hydrolyze carbohydrate polymers contained in lignocellulosic biomass to produce chemical commodities. Enzymatic hydrolysis of the cellulosic fraction of agroindustrial wastes produces cellobiose and a lower amount of glucose. Under aerobic conditions, B. subtilis grows using cellobiose as substrate. In this study, we proved that under non-aerated conditions, B. subtilis ferments cellobiose to produce L-lactate with 82% of the theoretical yield,

Two intracellular enzymes, cellobiose phosphorylase (CBP) and cellodextrin phosphorylase (CDP) are involved in the phosphorolytic pathway in cellulose degradation. Those enzymes are considered to be useful in syntheses of oligosaccharides because the reactions are reversible. CBP from Cellvibrio gilvus and Clostridium thermocellum YM4, and CDP from C. thermocellum YM4 were cloned and over-expressed in Escherichia coli. All the three enzymes showed ordered bi bi mechanism. However the orders of the substrate binding of the CBPs were different. It was found that CBP from C. gilvus strictly recognized the hydroxyl groups at positions β-1, 3, and 4 of the acceptor molecule in the reverse reaction. On the other hand, the recognition of the hydroxyl groups at positions 2 and 6 was not so strict. Three branched β-1, 4-glucosyl trisaccharides were synthesized by using the reverse reaction of C. gilvus CBP. A new substrate inhibition pattern, competitive substrate inhibition, was also found in the ...

Clostridium termitidis CT1112 is an anaerobic, Gram-positive, mesophilic, spore-forming, cellulolytic bacterium, originally isolated from the gut of a wood feeding termite Nasusitermes lujae. It has the ability to hydrolyze both cellulose and hemicellulose, and ferment the degradation products to acetate, formate, ethanol, lactate, H2, and CO2. It is therefore ges in gene and gene product expression during growth of C. termitidis on cellobiose, xylose, xylan, and α-cellulose. Correlation of transcriptome and proteome data with growth and fermentation profiles identified putative carbon-catabolism pathways in C. termitidis. The majority of the proteins associated with central metabolism were detected in high abundance. While major differences were not observed in gene and gene-product expression for enzymes associated with metabolic pathways under the different substrate conditions, xylulokinase and xylose isomerase of the pentose phosphate pathway were found to be highly up

As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.

AA3 enzymes belong to the glucose-methanol-choline (GMC) oxidoreductases family. AA3 enzymes are flavoproteins containing a flavin-adenine dinucleotide (FAD)-binding domain. Family AA3 can be divided into 4 subfamilies: AA3_1 (mostly cellobiose dehydrogenases), AA3_2 (including both aryl alcohol oxidase and glucose 1-oxidase), AA3_3 (alcohol oxidase) and AA3_4 (pyranose 2-oxidase ...

High purity Cellotriose for use in research, biochemical enzyme assays and in vitro diagnostic analysis. Purchase Cellotriose here.

Heteropolyacids (H3PW12O40, H4SiW12O40) and salts of metal cations (Mn+) and PW12O403− (M3/nPW12O40) act as effective homogeneous catalysts for selective hydrolysis of cellobiose and cellulose to glucose and total reducing sugars (TRS), respectively, in an aqueous phase. For Brønsted acid catalysts,

Cytophaga hutchinsonii can rapidly digest crystalline cellulose without free cellulases or cellulosomes. Its cell-contact cellulose degradation mechanism is unknown. In this study, the four β-glucosidase (bgl) genes in C. hutchinsonii were singly and multiply deleted, and the functions of these β-glucosidases in cellobiose and cellulose degradation were investigated. We found that the constitutively expressed BglB played a key role in cellobiose utilization, while BglA which was induced by cellobiose could partially make up for the deletion of bglB. The double deletion mutant ΔbglA/bglB lost the ability to digest cellobiose and could not thrive in cellulose medium, indicating that β-glucosidases were important for cellulose degradation. When cultured in cellulose medium, a small amount of glucose accumulated in the medium in the initial stage of growth for the wild type, while almost no glucose accumulated for ΔbglA/bglB. When supplemented with a small amount of glucose, ΔbglA/bglB started to

During studies of human periodontal disease, a number of bacterial strains were encountered that, on the basis of results of standard biochemical tests, appeared to be Prevotella buccalis, Prevotella denticola, Prevotella melaninogenica, or Prevotella loescheii. However, use of the standard biochemical tests, cellular fatty acid analyses, and the polyacrylamide gel electrophoresis patterns of soluble proteins resulted in conflicting identifications of these strains. The results of tests for cellobiose fermentation, inulin fermentation, and pigment production were responsible for most of the discordant results. Cellular fatty acid analyses in which the Microbial Identification System was used did not differentiate these strains from validly described species, even though separate library entries were created for them. DNA reassociation determinations in which the S1 nuclease procedure was used showed that cellobiose fermentation and pigment production are variable among strains of P. melaninogenica and P

One-pot catalytic hydrolysis/hydrogenation of cellobiose into hexitols over Ru/Al-MCM-48 A. Romero, J.A. Díaz, A. Nieto-Márquez, N. Essayem, E. Alonso, C. Pinel Microporous and Mesoporous Materials Volume 271, 15 November 2018, Pages 186-195 Access to full-text (free available before July 25, 2018): https://authors.elsevier.com/c/1XArD4xQ95owkV Abstract The simultaneous catalytic hydrolysis and hydrogenation of cellobiose, as a model constituent […]. Read More. ...

WBGene00001198 not CELE_ in pgid 348 WBGene00001198 not CELE_ in pgid 350 WBGene00001198 not CELE_ in pgid 351 WBGene00001198 not CELE_ in pgid 352 WBGene00002126 not CELE_ in pgid 1424 WBGene00009821 not CELE_ in pgid 1520 WBGene00012263 not CELE_ in pgid 2914 WBGene00043408 not CELE_ in pgid 2914 WBGene00009175 not CELE_ in pgid 2914 WBGene00016878 not CELE_ in pgid 2914 WBGene00020512 not CELE_ in pgid 2914 WBGene00019252 not CELE_ in pgid 2914 WBGene00015732 not CELE_ in pgid 3033 WBGene00003454 not CELE_ in pgid 3330 WBGene00003440 not CELE_ in pgid 3330 WBGene00003441 not CELE_ in pgid 3330 WBGene00003427 not CELE_ in pgid 3330 WBGene00003461 not CELE_ in pgid 3330 WBGene00003459 not CELE_ in pgid 3330 WBGene00003428 not CELE_ in pgid 3330 WBGene00003447 not CELE_ in pgid 3330 WBGene00003455 not CELE_ in pgid 3330 WBGene00003453 not CELE_ in pgid 3330 WBGene00003436 not CELE_ in pgid 3330 WBGene00003439 not CELE_ in pgid 3330 WBGene00023572 not CELE_ in pgid 4733 WBGene00023572 not CELE_ ...

WBGene00001198 not CELE_ in pgid 348 WBGene00001198 not CELE_ in pgid 350 WBGene00001198 not CELE_ in pgid 351 WBGene00001198 not CELE_ in pgid 352 WBGene00002126 not CELE_ in pgid 1424 WBGene00009821 not CELE_ in pgid 1520 WBGene00012263 not CELE_ in pgid 2914 WBGene00043408 not CELE_ in pgid 2914 WBGene00009175 not CELE_ in pgid 2914 WBGene00016878 not CELE_ in pgid 2914 WBGene00020512 not CELE_ in pgid 2914 WBGene00019252 not CELE_ in pgid 2914 WBGene00015732 not CELE_ in pgid 3033 WBGene00003454 not CELE_ in pgid 3330 WBGene00003440 not CELE_ in pgid 3330 WBGene00003441 not CELE_ in pgid 3330 WBGene00003427 not CELE_ in pgid 3330 WBGene00003461 not CELE_ in pgid 3330 WBGene00003459 not CELE_ in pgid 3330 WBGene00003428 not CELE_ in pgid 3330 WBGene00003447 not CELE_ in pgid 3330 WBGene00003455 not CELE_ in pgid 3330 WBGene00003453 not CELE_ in pgid 3330 WBGene00003436 not CELE_ in pgid 3330 WBGene00003439 not CELE_ in pgid 3330 WBGene00023572 not CELE_ in pgid 4733 WBGene00023572 not CELE_ ...

Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. Is also able to hydrolyze phospho-N,N-diacetylchitobiose.

And again, you drink a solution of lactulose and mannitol sugars. . than one child will tell you, just like adults, babies have preferences and likes and dislikes. . is usually in turn caused by nutrient deficiencies, specifically iron, folate, B12,

bsr:I33_4084 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) beta-glucosidase (A) MSSNAKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPYDESMTSLNLYHN GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLSFYDDLFDELLKHH IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL HAPFTGGGLVFEEGENKRNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY QKPLFIVENGLGAVDKVEDDGTIQDDYRINYLRDHLIEVREAIADGVELIGYTSWGPIDL VSASTAEMKKRYGFIYVDRDNEGNGTLNRIKKKSFIWYQQVIATNGESI ...

kpu:KP1_1806 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) putative family 1 glycoside hydrolase (A) MTSHIPRRSMKNRLPADFLWGNSVSSMQTEGAWNEGGKGMSVYDIRQPAEFASDWKVATD SYHRYREDFDLMQDLGMNCYRFQIAWSRVCPDGDGEFNEQGIAFYHQFIDELIARGIEPM ICLYHFDMPLSLAERYNGFTDRRVMDAFIRYGQKMIACYGDKVKYWLTFNEQNLYHSPEA FLISGYLQGEKTLRELYLIQHHVMMAHVHLTHYLHQTKPQCLMGGMLAHALVYPATCKPR DILCAQQLDEFLNQNLLRAYAGEGYSPEVMHFVAAEGFDDIYRPEDLALMATVKVDYLAF SFYASRTLNSDAIPPGTAVNNYMLFGNQDNPFLKATEWNWQIDPLGFRTIITRYYNDWRL PVFPIENGIGVIESWDGEHPIADDYRIAYHRDHINAMKAAIFEDGAQVIGYLGWGLIDIL SSQGDMRKRYGVVYVNRENHDLKDLRRVPKKSYAWLKQVFRSNGEAM ...

Complete information for CELSR3 gene (Protein Coding), Cadherin EGF LAG Seven-Pass G-Type Receptor 3, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium

Today Leerink is publishing its second of two notes on Celgene Corporations (NASDAQ:CELG) ozanimod that focuses on the products value; in its current forecast the firm estimates that ozanimod is worth $19/ share (13% of its PT) in the base case scen

SUMMIT, N.J.--(BUSINESS WIRE)--Oct. 24, 2013-- Celgene Corporation (NASDAQ:CELG) reported third quarter 2013 total revenue of $1,674 million compared to $1,419 million in the third quarter 2012. Net product sales were $1,644 million, an 18 perce...

SUMMIT, N.J.--(BUSINESS WIRE)-- Celgene Corporation (NASDAQ:CELG) today announced more than 65 presentations reporting on investigational studies in blood and solid tumor cancers will be pres...

Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.

Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.

Florile mele- infloresc si reinfloresc . Altele pier.. Cele care rezista , daruiesc cu generozitate din cele primite in dar - parfum si bucuria culorilor.. #gallery-1 { margin: auto; } #gallery-1 .gallery-item { float: left; margin-top: 10px; text-align: center; width: 33%; } #gallery-1 img { border: 2px solid #cfcfcf; } #gallery-1 .gallery-caption { margin-left: 0; } /* see gallery_shortcode() in wp-includes/media.php */ ...

Research from Citrix and Cebr has found that more flexible working could save the UK economy billions as well as including more people into the workforce

Date privind reconcilierea calculelor trimestriale a produsului intern brut cu cele anuale; Ajustarea sezoniera a produsului intern brut, principalelor activitati economice ...

Am citit, am inteles si sunt de acord cu cele specificate in sectiunea referitoare la prelucrarea datelor cu caracter personal ...

Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Isolation and characterization of Selenomonas ruminantium strains capable of 2-deoxyribose utilization

Effects of kraft pulp and lignin on Trametes versicolor carbon metabolism. Purification and characterization of cellobiose dehydrogenases from the white rot fungus Trametes versicolor

TY - GEN. T1 - Enhanced xylitol production through simultaneous co-consumption of cellobiose and xylose by an engineereed saccharomyces cerevisiae strain. AU - Oh, Eun Joong. AU - Ha, Suk Jin. AU - Kim, Soo Rin. AU - Galazka, Jonathan M.. AU - Cate, Jamie H.D.. AU - Su Jin, Yong. PY - 2011/1/1. Y1 - 2011/1/1. UR - http://www.scopus.com/inward/record.url?scp=85054765849&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=85054765849&partnerID=8YFLogxK. M3 - Conference contribution. AN - SCOPUS:85054765849. SN - 9781618397362. T3 - Fuels and Petrochemicals Division - Core Programming Topic at the 2011 AIChE Annual Meeting. BT - Fuels and Petrochemicals Division - Core Programming Topic at the 2011 AIChE Annual Meeting. PB - AIChE. ER - ...

PURPOSE: Recent evidence suggests that taurine and myoinositol may serve as organic osmolytes in a number of cells, including lens and retinal pigment epithelia, but the mechanism for their increased accumulation in response to hypertonic stress is not known. To assess whether NaK ATPase contributed to the elevated levels of taurine and myoinositol in cells exposed to hypertonic media, we measured the activity of NaK ATPase, which is known to be implicated in the transport of these substances, in human lens and retinal pigment epithelia cultured in isotonic and hypertonic media. METHODS: Primary cultures of human lens epithelial (HLE) and human retinal pigment epithelial (HRPE) cells were maintained in isotonic and hypertonic media for varying periods of time, and the activity of NaK ATPase and the levels of taurine and myoinositol were measured in cells cultured under two different conditions. The possible involvement of the transport enzyme in the accumulation of the two osmolytes was also ...

Ferulic acid acylation of oligosaccharides catalyzed by feruloyl esterases (FAE) is a promising route to produce feruloylated oligosaccharides. However, modulation of FAE synthetic properties is a key step to improve the acylation. The efficiency of H. insolens FAE to catalyze the feruloylation in six different surfactantless microemulsions reaction systems was evaluated. The highest yield (57%) w ...

Marques De Gelida Reserva, Macabeo Xarel-Lo Parellada Chardonnay 2004: Charismatic! This bubbly is a blend of 35% Macabeo, 30% ... Natalie's Rating >

1,4-β-D-Cellotriitol (borohydride reduced cellotriose) [MO-CTRRD] - CAS: 61473-64-1 Molecular Formula: C18H34O16 Molecular Weight: 506.4 Purity: | 95% High purity 1,4-β-D-Cellotriitol (borohydride reduced cellotriose) for use in research, biochemical enzyme assays and in vitro diagnostic analysis. Trisaccharides from hydrolysis of cellulose and borohydride reduced. Store at room temperature.

tr:B2VKZ2_ERWT9] bglA; BglA protein, 6-phospho-beta-glucosidase (involved in beta-glucoside utilization); K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] ...

Cellulose. Glucose-based Polymeric Fibres. The cellulose is an organic compound of polymeric nature. The reaction of the condensation of D-Glucose monomers gives rise to the synthesis of a linear macromolecule (polymer). The glucose molecules are united by a glyosidic bond called beta (1-4) that connects the site 1 of a unity with the site 4 of the following unit with the OH equatorial anomeric.. The partial cell hydrolysis creates a cellobiose, made of two glucose units always with beta bond (1-4). Unlike the cellulose, the starch has alfa glyosidic bonds. The mammals have enzymes (amylases) that can hydrolyse only the alfa bond. Therefore they can metabolize the starch but not the cellulose.. The cellulose does not have a homogeneous chemical-physical structure, in fact we can distinguish phases with a different crystallization grade. The presence of many OH-groups entails the formation of many hydrogen bonds among different sites of the polymeric chain and therefore supports the ...

This record was replaced or removed. The sequence YP_006173076 is 100% identical to WP_000012618.1 over its full length. Be aware that a NCBI nonredundant RefSeq protein (WP_) can be annotated on large numbers of bacterial genomes that encode that identical protein.. Old YP_006173076.1 New WP_000012618.1 Identical proteins Re-annotation project. ...

p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...

In enzymology, a 6-phospho-beta-glucosidase (EC 3.2.1.86) is an enzyme that catalyzes the chemical reaction: 6-phospho-beta-D-glucosyl-(1,4)-D-glucose + H2O → D-glucose

Ad everti virtute adversarium usu. Errem legere adolescens ut cum. Te quo purto altera, mei nisl causae laboramus no. Te liber graeco quo, nam velit intellegebat an. Vis et sumo temporibus. In ius illud idque nobis. Sed ut equidem omittam. Ius enim nullam insolens ex, munere insolens tractatos vel an, sea iriure virtute adipiscing ex.…. ...

Assume the role of bioengineer as you extract, assess, and optimize cellobiase function for biofuel production and connect enzyme activity with mushroom ecology.

Make Your Selection Below for Quantity and Type of Hole if you wish to have the cels punched. Your choices are; Acme PUNCHED, Round PUNCHED or UnPUNCHED. Select Carefully Before You Place Your Order. ...

1J83: Recognition of cello-oligosaccharides by a family 17 carbohydrate-binding module: an X-ray crystallographic, thermodynamic and mutagenic study.

Costurile Arbitrajului comparativ cu cele din instanța de drept comun - între mit și realitate Author: Alina Cobuz Băgnaru, Partener Fondator, Cobuz şi Asociaţii S-a subliniat în numeroase rânduri că unul din avantajele arbitrajului este și costul scăzut al acestei proceduri, în comparație cu costurile din instanța de drept comun. Această afirmație trebuie analizată…

Clinica stomatologica SOLdentaX Buzau iti ofera cele mai profesionale servicii de stomatologie. SOLutia problemelor tale stomatologice!

Pensiuni Neptun-Olimp, cele mai bune preturi la pensiuni Neptun-Olimp 2022, vezi lista cu pensiuni din statiunea Neptun-Olimp - Litoralul Romanesc

Explicatii la cateva din cele mai des intalnite constante biologice sau analize medicale: Acid uric, Aglutinine, Alanin-amino-transferaza, Aloimunizare, Anatoxina, Antiser, Antistreptokinaza, Antistre

Aici gasesti toate produsele din Caiete. Preturi, poze, descrieri. Sortezi, compari si cumperi cele mai bune oferte de produse ale magazinelor online.

Produse Cosmetice - Bvlgari. Cumpara online de pe Esteto.ro produse din categoria Produse Cosmetice marca Bvlgari la cele mai bune preturi. Livrare rapida prin curier.

Produse Cosmetice - B-Touch. Cumpara online de pe Esteto.ro produse din categoria Produse Cosmetice marca B-Touch la cele mai bune preturi. Livrare rapida prin curier.