TY - JOUR. T1 - Mn tolerance in rice is mediated by MTP8.1, a member of the cation diffusion facilitator family. AU - Chen, Zonghui. AU - Fujii, Yumi. AU - Yamaji, Naoki. AU - Masuda, Sakine. AU - Takemoto, Yuma. AU - Kamiya, Takehiro. AU - Yusuyin, Yusufujiang. AU - Iwasaki, Kozo. AU - Kato, Shin Ichiro. AU - Maeshima, Masayoshi. AU - Ma, Jian Feng. AU - Ueno, Daisei. PY - 2013/11. Y1 - 2013/11. N2 - Manganese (Mn) is an essential micronutrient for plants, but is toxic when present in excess. The rice plant (Oryza sativa L.) accumulates high concentrations of Mn in the aerial parts; however, the molecular basis for Mn tolerance is poorly understood. In the present study, genes encoding Mn tolerance were screened for by expressing cDNAs of genes from rice shoots in Saccharomyces cerevisiae. A gene encoding a cation diffusion facilitator (CDF) family member, OsMTP8.1, was isolated, and its expression was found to enhance Mn accumulation and tolerance in S. cer-evisiae. In plants, OsMTP8.1 and its ...
Legumes are key to world agriculture (Graham and Vance, 2003). They are the main protein source in many areas of the world and, because of SNF, a viable alternative to the use of nitrogen fertilizers in agriculture (Smil, 1999). As in any plant, iron uptake and systemic distribution is critical in legumes. Like in other nongraminaceous plants, in legumes, iron uptake from soil follows what is known as Strategy I, i.e. Fe3+ solubility is increased by acidification of the surrounding soil and then Fe3+ is reduced by a ferroreductase to Fe2+, which is imported into plants via specific transporters in the root epidermis (Andaluz et al., 2009). Once inside the plant, iron is used in legumes as in other plants, with one exception; in addition to the shoot, there is an extra iron sink during vegetative stages of growth, namely the root nodule (Tang et al., 1990).. Nodulation requires relatively large amounts of iron to synthesize the key enzymes involved in SNF (Brear et al., 2013; González-Guerrero ...
Nramp (for natural resistance-associated macrophage protein) represents a family of evolutionarily conserved membrane proteins that facilitate the transport of heavy metal ions (5, 6, 15, 17, 31). Members of the Nramp family have been found in mammals, birds, insects, plants, fungi, and bacteria (3, 5, 9, 15, 16, 22, 40). Among the best studied are the Nramp1 and Nramp2 transporters of rodents. Although these proteins share 61% homology at the amino acid level, they exhibit distinct functions. Mouse Nramp1 plays an important role in the control of infection against intracellular parasites and is exclusively expressed in monocytes/macrophages and polymorphonuclear leukocytes (2, 15). Nramp2 (also known as DCT1 or DMT1) is more ubiquitously expressed in most tissues (17) and acts as a divalent metal transporter capable of transporting iron, manganese, copper, zinc, cadmium, and lead (17). Mutations inNramp2 have been associated with defects in duodenal iron uptake and cellular iron utilization in ...
Read "Comparative study of the genomic organization of DNA repeats within the 5′-flanking region of the natural resistance-associated macrophage protein gene (NRAMP1) between humans and great apes, Mammalian Genome" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
CP000386.PE586 Location/Qualifiers FT CDS complement(625625..626515) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Rxyl_0596" FT /product="cation diffusion facilitator family transporter" FT /note="TIGRFAM: cation diffusion facilitator family FT transporter; PFAM: cation efflux protein; KEGG: mbo:Mb2050c FT possible conserved membrane protein" FT /db_xref="EnsemblGenomes-Gn:Rxyl_0596" FT /db_xref="EnsemblGenomes-Tr:ABG03567" FT /db_xref="GOA:Q1AYG1" FT /db_xref="InterPro:IPR002524" FT /db_xref="InterPro:IPR027469" FT /db_xref="InterPro:IPR036837" FT /db_xref="UniProtKB/TrEMBL:Q1AYG1" FT /protein_id="ABG03567.1" FT /translation="MRDRDALEASEQGIRAVKLSFAVLALTAVLQLAVALVSGSAALLA FT DTAHNFGDALTALPLWLAFALSRRPPSRTHTYGYGRAEDLAGAAIVGIILLSALVCGYE FT SATKLLEGSGVRGAGWVALAAAAGFAGNELAARLRISVGRRIGSAALVADGQHARTDGL FT TSLAVLAGAAGAWLGYPVVDPLVGLGITAAILHIVRDSARPVWRRLMDAVEPGTVEALE FT EAASGMPEVLRVEEVRARWTGHSLQAEVRVRVEPDLPAGRLGDLSGRLAAAARKRLPRL FT ERVLLEPVPDRPGDV" MRDRDALEAS EQGIRAVKLS FAVLALTAVL QLAVALVSGS ...
High-affinity K+ uptake in plants plays a crucial role in K+ nutrition and different systems have been postulated to contribute to the high-affinity K+ uptake. The results presented here with pepper (Capsicum annum) demonstrate that a HAK1-type transporter greatly contributes to the high-affinity K+ uptake observed in roots. Pepper plants starved of K+ for 3 d showed high-affinity K+ uptake (K m of 6 mgrM K+) that was very sensitive to NH and their roots expressed a high-affinity K+ transporter, CaHAK1, which clusters in group I of the KT/HAK/KUP family of transporters. When expressed in yeast (Saccharomyces cerevisiae), CaHAK1 mediated high-affinity K+ and Rb+ uptake with K m values of 3.3 and 1.9 mgr M, respectively. Rb+ uptake was competitively inhibited by micromolar concentrations of NH and Cs+, and by millimolar concentrations of Na+ ...
View mouse Slc11a2 Chr15:100387898-100424214 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
The KOMP Repository is located at the University of California Davis and Childrens Hospital Oakland Research Institute. Question? Comments? For Mice, Cells, and germplasm please contact us at [email protected], US 1-888-KOMP-MICE or International +1-530-752-KOMP, or for vectors [email protected] or +1-510-450-7917 ...
Ferroportin1 is a newly discovered transmembrane iron export protein. It plays a key role in Fe2+transport across the basal membrane of enterocytes in the gut. It has been suggested that this protein might have the same role in Fe2+transport across the abluminal membrane of the blood-brain barrier as it works in enterocytes. However, the presence of ferroportin1 in the brain has not been well determined. In the present study, we investigated expression of ferroportin1 protein in different brain regions, including cortex, hippocampus, striatum and substantia nigra, in developing male Sprague-Dawley rats. The results provided direct evidence for the existence of ferroportin1 protein in the rat brain. All brain areas examined have the ability to synthesize ferroportin1 protein. The findings also showed that age has a significant effect on the expression of ferroportin1 protein in the cortex, hippocampus, striatum and substantia nigra of the rat brain ...
Earlier studies have indicated that sensitivity to the Pt drugs can be regulated by the Cu influx transporter CTR1 (3 , 4) and the Cu exporter ATP7B (5 , 10) . The results reported here indicate that another Cu transporter, ATP7A, is also capable of modulating sensitivity to this class of drugs and that this effect is observable in ovarian cancer cells. Furthermore, the results document that even a quite modest change in ATP7A level is pharmacodynamically significant. These findings provide additional support for the concept that the Cu transporters are important to the pharmacodynamics of the Pt-containing drugs and specifically identify small changes in ATP7A expression as being of relevance in ovarian cancer.. Western blot analysis of ovarian carcinoma cell lines selected in vitro for acquired resistance to DDP (10) and immunohistochemical analysis of ovarian carcinoma samples from patients failing DDP and/or CBDCA-containing primary chemotherapy (20) have demonstrated only modest changes in ...
Absorption of dietary iron in the doudenum determines overall body iron levels as no active excretory systems exist. As such, this process must be tightly contr...
Produk ini dilindungi oleh hak paten dan permohonan hak paten yang masih dalam proses serta semua hak nasional lain yang terkait: FI 20155573, US 7,324,002, US 7,271,774, US 13/794,468, US 13/833,755, US 13/827,418, US 14/195,670, US 14/331,268, US 14/839,928, US 14/882,487.. Permohonan hak paten tambahan telah diajukan.. Sensor optik detak jantung Valencell yang digunakan di dalam produk ini dilindungi oleh hak paten dan permohonan hak paten yang sedang dalam proses serta hukum nasional lain terkait. Untuk informasi lebih jauh, harap kunjungi valencell.com/patents/.. ...
Chlosta, Sabine et al "The Iron Efflux Protein Ferroportin Regulates the Intracellular Growth of Salmonella enterica." Infection and Immunity 74.5 (2006): 3065-3067. Web. 12 Nov. 2019. ...
A - Tilt: 8° - Segments: 1( 11- 35), 2( 44- 65), 3( 78- 98), 4( 110- 135), 5( 155- 176), 6( 188- 206), 7( 244- 255), 8( 281- 301), 9( 310- 331), 10( 336- 359), 11( 375- 396), 12( 401- 421 ...
The results can, in a large part, be transferred to the Rhesus proteins from mammals," says Andrade as Amt proteins bear a close resemblance to the Rhesus proteins found in humans. They are produced in the blood, in the kidney, and in the liver, where they regulate the intake of ammonium and thus the bodys pH.. The researchers tested three Amt proteins that are present in the bacteria and also determined the speed with which they allow ammonium to pass through the membrane. "In the future, we want to modify individual components of the transporter to improve our understanding of the exact molecular details involved" explains Andrade.. The scientific debate on Amt/Rh proteins stems from the difficulty of distinguishing between ammonia and ammonium in measurements, as the two molecules are transformed into each other in a continuous state of balance with protons. "Our in vitro method gives us a level of precision that finally allows us to draw valid conclusions concerning the transport process," ...
Heavy metal (Fe2+, Zn2+, Mn2+, Cu2+, Cd2+, Co2+, Ni2+ and Pb2+) ion:H+ symporter, Nramp2 or divalent metal transporter, DMT1 (Garrick et al. 2003). A 12 TMS topology with intracellular N- and C- termini is established. Two-fold structural symmetry in the arrangement of membrane helices for TM1-5 and TM6-10 (conserved Slc11 hydrophobic core) is suggested (Czachorowski et al., 2009). A conserved motif in a central flexible region of TMS1 (DPGN) binds the metal ion (Wang et al. 2011). Upregulated by iron deficiency and downregulated by iron loading (Nam et al. 2013). NRAMP2 also serves as the Sindbis alpha virus receptor (Rose et al. 2011). DMT1 interacts with the iron chaparone protein, PCBP2 (Q15366), in an iron-dependent fashion, and may be essential for iron uptake (Lane and Richardson 2014). Mutations cause a syndrome of congenital microcytic hypochromic anemia, poorly responsive to oral iron treatment, with liver iron overload associated paradoxically with normal to moderately elevated serum ...
Ferroportin/SLC40A1 Antibodies available through Novus Biologicals. Browse our Ferroportin/SLC40A1 Antibody catalog backed by our Guarantee+.
Ferroportin/SLC40A1 Antibodies available through Novus Biologicals. Browse our Ferroportin/SLC40A1 Antibodies all backed by our Guarantee+.
Zn2+ homeostasis in bacteria is achieved by export systems and uptake systems which are separately regulated by their own regulators. Three types of Zn2+ export systems that protect cells from high toxic concentrations of Zn2+ have been identified: RND multi-drug efflux transporters, P-type ATPases, …
Kit Component:- KN202646G1, SLC30A2 gRNA vector 1 in pCas-Guide vector- KN202646G2, SLC30A2 gRNA vector 2 in pCas-Guide vector- KN202646D, donor…
Kit Component:- KN202646G1, SLC30A2 gRNA vector 1 in pCas-Guide vector- KN202646G2, SLC30A2 gRNA vector 2 in pCas-Guide vector- KN202646D, donor…
Gentaur molecular products has all kinds of products like :search , SBI \ miRZip_371_3p anti_miR_371_3p microRNA construct \ MZIP371-3p-PA-1 for more molecular products just contact us
Gentaur molecular products has all kinds of products like :search , SBI \ miRZip_605 anti_miR_605 microRNA construct \ MZIP605-PA-1 for more molecular products just contact us
dobry den, rok som uzivala antikoncepciu Chloe a lekar mi ju potom vymenil za Zenadeu a pocas jej uzivania som nedostala ani raz menzes ( su tomu...
How do I place an EMERGENCY order for a REXNORD ZNT6511512 Take Up Unit Bearings that I want to pick 120x260x55 up at a our store?
Hak cipta Indah Fitriani desainwebsite. net Aplikasi Northern Blotting Northern Blotting telah telah sering digunakan bersamaan juga PCR dan
CVID is an immunodeficiency disorder characterized by a low level of antibodies, making it difficult for the childs body to fight diseases. The child then becomes sick with recurrent infections. The disease may become evident during infancy, during childhood or puberty, or even later into adulthood. The symptoms of the disease are very different for each child affected, which is why it is called a variable group of disorders.. ...
Brucella abortus is a Gram-negative bacterium that causes abortion and infertility in food animals and a chronic debilitating febrile disease in humans known as brucellosis. As with all pathogenic bacteria, the Brucella spp. require sufficient metal nutrition during the course of an infection. Host-mediated metal withdrawal defenses actively restrict the bioavailability of metals which requires invading bacteria to employ high affinity metal acquisition systems to overcome these metal-limiting conditions. While obtaining sufficient metals during host infection is critical to the survival of these bacteria, avoiding metal toxicity is equally important. Excess accumulation of one metal relative to others can lead to protein mis-metallation when surplus metal ions outcompete other metal species for their native binding sites. To prevent metal toxicity, bacteria respond to high intracellular metal concentrations by means of metal-responsive transcriptional regulators that downregulate metal import ...
TY - JOUR. T1 - Regulation of the high-affinity copper transporter (hCtr1) expression by cisplatin and heavy metals. AU - Liang, Zheng Dong. AU - Long, Yan. AU - Chen, Helen H W. AU - Savaraj, Niramol. AU - Kuo, Macus Tien. PY - 2014/1/14. Y1 - 2014/1/14. N2 - Platinum-based antitumor agents have been the mainstay in cancer chemotherapy for many human malignancies. Drug resistance is an important obstacle to achieving the maximal therapeutic efficacy of these drugs. Understanding how platinum drugs enter cells is of great importance in improving therapeutic efficacy. It has been demonstrated that human high-affinity copper transporter 1 (hCtr1) is involved in transporting cisplatin into cells to elicit cytotoxic effects, although other mechanisms may exist. In this communication, we demonstrate that cisplatin transcriptionally induces the expression of hCtr1 in time- and concentration-dependent manners. Cisplatin functions as a competitor for hCtr1-mediated copper transport, resulting in reduced ...
PubMedID: 23039265 | Long-term sustained autoimmune response to beta cell specific zinc transporter (ZnT8, W, R, Q) in young adult patients with preserved beta cell function at diagnosis of diabetes. | Autoimmunity | 2/1/2013
Cation diffusion facilitator (CDF) proteins are a conserved family of transmembrane transporters that ensure cellular homeostasis of divalent transition metal cations. Metal cations bind to CDF proteins cytoplasmic C-terminal domain (CTD), leading to closure from its apo open V-shaped dimer to a tighter packed structure, followed by a conformational change of the transmembrane domain thus enabling transport of the metal cation. By implementing a comprehensive range of biochemical and biophysical methods, we studied the molecular mechanism of metal binding to the magnetotactic bacterial CDF protein MamM CTD. Our results reveal that the CTD is rather dynamic in its apo form, and that two dependent metal binding sites, a single central binding site and two symmetrical, peripheral sites, are available for metal binding. However, only cation binding to the peripheral sites leads to conformational changes that lock the protein in a compact state. Thus, this work reveals how metal binding is ...
Zinc Transporter ZIP14 Functions in Hepatic Zinc, Iron and Glucose Homeostasis during the Innate Immune Response Endotoxemia. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Copper transporter 1 (CTR1) is a transmembrane protein that imports copper(i) into yeast and mammalian cells. Surprisingly, the protein also mediates the uptake of platinum anticancer drugs, e.g. cisplatin and carboplatin. To study the effects of several metal-binding residues/motifs of hCTR1 on the transpor Metals and Genetics
DESCRIPTION (provided by applicant): The overall aim of this grant is to elucidate the novel linkage between copper transport protein Antioxidant1 (Atox1) and NADPH oxidase involved in inflammatory angiogenesis. Ischemic disease is a leading cause of morbidity and mortality in worldwide. Neovascularization is an important repair process in response to ischemia, which depends on angiogenesis, inflammation and reactive oxygen species (ROS). Copper (Cu), an essential micronutrient, is involved in physiological repair processes such as wound healing and angiogenesis as well as in various pathophysiologies including tumor growth, atherosclerosis and inflammatory diseases. Since excess Cu is toxic, bioavailability of intracellular Cu is tightly controlled by Cu transport proteins such as Cu chaperone Atox1. Our laboratories provided the first evidence that Atox1 functions as a Cu-dependent transcription factor to regulate Cu-induced cell growth. Furthermore, we are one of the first to demonstrate that ...
This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Oct 2008 ...
Our present findings suggest that the ferroportin Q248H mutant is resistant to physiological concentrations of hepcidin (0.01-0.03 μM),12-15 despite bioinformatic predictions suggesting that it is a neutral polymorphism. We observed this with both human myc-tagged ferroportin and ferroportin fused to EGFP that were expressed in 293T cells treated with hepcidin and detected by immunoblotting or EGFP fluorescence. These observations were further supported by analysis of intracellular ferritin that reflects the amount of iron stored within the cells. The hepcidin-mediated increase of ferritin was less pronounced in 293T cells that expressed ferroportin Q248H compared to cells that expressed WT ferroportin. Analysis of ferritin levels in primary macrophages differentiated from primary human monocytes after incubation with iron and a short exposure to hepcidin showed a dose-dependent association with ferroportin genotype. No increase in macrophage ferritin was observed with homozygous ferroportin ...
118 68. Tchernitchko D, Bourgeois M, Martin ME, Beaumont C. Expression of the two mRN A isoforms of the iron transporter Nramp2/DMTI in mice and function of the iron responsive element. Biochem J. 2002;363:449 55. 69. Canonne Hergaux F, Gruenheid S, Ponka P, Gros P. Cellular and subcellular localization of the Nramp2 iron transporter in the intestinal brush border and regulation by dietary iron. Blood. 1999;93:4406 17. 70. Canonne Hergaux F, Zhang AS, Ponka P, Gros P. Characterization of the iron transporter DMT1 (NRAMP2/DCT1) in red blood cells of normal and anemic mk/mk mice. Blood. 2001;9 8:3823 30. 71. Gruenheid S, Canonne Hergaux F, Gauthier S, Hackam DJ, Grinstein S, Gros P. The iron transport protein NRAMP2 is an integral membrane glycoprotein that colocalizes with transferrin in recycling endosomes. J Exp Med. 1999;189:831 41. 72. Su M A, Trenor CC, Fleming JC, Fleming MD, Andrews NC. The G185R mutation disrupts function of the iron transporter Nramp2. Blood. 1998;92:2157 63. 73. Trinder ...
allele distribution of the SLC31A1 was not different between group N and O, and out of the 11 SNPs of the SLC22A2 gene only the allele distribution of the nonsynonymous SNP was significantly different between patients who experienced ...
Background: We studied the association between iron intake and polymorphisms in the iron transporter gene, SLC40A1, and the risk of tuberculosis. Methods: We compared iron intake, the frequency of SLC40A1 mutations, and interactions between these variables among 98 TB patients and 125 controls in Kwazulu-Natal, South Africa. Results: Four SLC40A1 SNPs were associated with an increased risk of tuberculosis and one with reduced risk. We also found a gene-environment interaction for four non-exonic SNPs and iron intake. Conclusions: This pilot study demonstrated an association between polymorphisms in SLC40A1 and tuberculosis and provided evidence for an interaction between dietary iron and SLC40A1 ...
Ammonium transport (Amt) proteins are ubiquitous integral membrane proteins that transport NH4+ across cell membranes. Amt proteins involved in the uptake of NH4+ as direct N-source for biosynthesis are present in prokaryotes, archaea and plants [1]. In mammals, Rhesus proteins are the Amt homologs and their presence in erythrocyte, kidney and liver cell membranes can be directly related to NH3/NH4+ detoxification and pH homeostasis processes [2]. Long recognized for their immunogenic characteristics and involvement in hemolytic diseases of infants, a number of genetic diseases have been associated with the inability to correctly express Rh proteins [2,3]. Understanding the molecular details of transport and regulation of Amt proteins is therefore highly relevant to help treat and solve many human Rh-related diseases.. A significant amount of our research has focused on the archaea homologs, in particular on the Af-Amt1 protein from Archaeoglobus fulgidus. We have solved the crystal structures ...
The zinc transporter ZIP13, also known as SLC39A13, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. The zinc transporter family is divided into four subfamilies (I, II, LIV-1 and gufA). ZIP13 is a multipass membrane protein that belongs to the ZIP transporter subfamily LIV-1. Mutations in ZIP13 have recently been shown to cause a spondylocheiro dysplastic form of Ehlers-Danlos syndrome (SCD-EDS), a generalized skeletal dysplasia involving mainly the spine with clinical abnormalities of the hands in addition to EDS-like features. Other experiments have shown that ZIP13 is required for proper connective tissue development and is involved in BMP/TGF- signaling pathways ...
The cop operon of Enterococcus hirae controls cytoplasmic copper levels. It encodes two copper ATPases, a repressor, and the CopZ metallo-chaperone. Transcription of these genes is induced by copper. However, at higher copper concentrations, CopZ is degraded by a copper-activated proteolytic activity. This specific proteolysis of CopZ can also be demonstrated in vitro with E. hirae extracts. Growth of the cells in copper increases the copper-inducible proteolytic activity in extracts. Zymography reveals the presence of a copper-dependent protease in crude cell lysates. Copper-stimulated proteolysis of CopZ appears to play an important role in copper homoeostasis by E. hirae. ...
Species, Publications, Genomes and Genes, Research Topics, Scientific Experts about Ferroportin and iron export from the macrophage
Wilson Disease Clinic is one of the best clinic in Mumbai at Kokilaben Hospital. Team of Expert doctors at Wilson Disease Clinic provides world-class treatments, care and services with best outcome and affordable charges.
Genetic and biochemical studies lend strong support to the idea that the CTR-family of membrane proteins mediate cellular copper uptake. Similarly, the roles of...
Learn more about Wilson Disease at Grand Strand Medical Center DefinitionCausesRisk FactorsSymptomsDiagnosisTreatmentPreventionrevision ...
A - Tilt: 7° - Segments: 1( 29- 49), 2( 61- 86), 3( 116- 138), 4( 144- 166), 5( 184- 201), 6( 223- 244), 7( 251- 275), 8( 283- 305), 9( 306- 324), 10( 336- 357), 11( 378- 406 ...
DI-fusion, le Dépôt institutionnel numérique de lULB, est loutil de référencementde la production scientifique de lULB.Linterface de recherche DI-fusion permet de consulter les publications des chercheurs de lULB et les thèses qui y ont été défendues.
Disclaimer: The information contained in this site is intended for general reference purposes only. It is not a substitute for professional medical advice or a medical exam. Always seek the advice of your physician or other qualified health professional before starting any new treatment ...
Cytokine and laboratory values will be compared to baseline to test the hypothesis that TM will affect the level of TNF alpha, IL-1, C-protein, and TGF ...