Secretory Carrier Membrane Proteins (SCAMPs) are a group of tetraspanning integral membrane proteins evolutionarily conserved from insects to mammals and plants. Mammalian genomes contain five SCAMP genes SCAMP1-SCAMP5 that regulate membrane dynamics, most prominently membrane-depolarization and Ca2+-induced regulated secretion, a key mechanism for neuronal and neuroendocrine signaling. However, the biological role of SCAMPs has remained poorly understood primarily owing to the lack of appropriate model organisms and behavior assays. Here we generate Drosophila Scamp null mutants and show that they exhibit reduced lifespan and behavioral abnormalities including impaired climbing, deficiency in odor associated long-term memory, and a susceptibility to heat-induced seizures. Neuron-specific restoration of Drosophila Scamp rescues all Scamp behavioral phenotypes, indicating that the phenotypes are due to loss of neuronal Scamp. Remarkably, neuronal expression of human SCAMP genes rescues selected

Microsomal triglyceride transfer protein (MTP) is required for the assembly and cellular secretion of apolipoprotein B (apoB) -containing lipoproteins from the liver and intestine. The secretion pattern of apoB-containing lipoproteins is likely to influence the VLDL and LDL levels in plasma. By initial opportunistic screening for polymorphic sites in the regulatory region of the MTP gene by gene sequencing in 20 healthy male subjects, a common functional G/T polymorphism was detected 493 bp upstream from the transcriptional start point. There was differential binding of unique nuclear proteins at this site, as shown by electrophoretic mobility shift assay. The G variant seemed to bind two or three nuclear proteins that do not bind to the T variant. Expression studies with minimal promoter constructs linked to the chloramphenicol acetyltransferase reporter and transfected into HepG2 cells revealed marked enhancement of transcriptional activity with the T variant. The prevalence of the MTP promoter

Cardiac contractility is regulated by dynamic phosphorylation of sarcomeric proteins by kinases such as cAMP-activated protein kinase A (PKA). Efficient phosphorylation requires that PKA be anchored close to its targets by A-kinase anchoring proteins (AKAPs). Cardiac Myosin Binding Protein-C (cMyBPC) and cardiac troponin I (cTNI) are hypertrophic cardiomyopathy (HCM)-causing sarcomeric proteins which regulate contractility in response to PKA phosphorylation. During a yeast 2-hybrid (Y2H) library screen using a trisphosphorylation mimic of the C1-C2 region of cMyBPC, we identified isoform 4 of myomegalin (MMGL) as an interactor of this N-terminal cMyBPC region. As MMGL has previously been shown to interact with phosphodiesterase 4D, we speculated that it may be a PKA-anchoring protein (AKAP). To investigate this possibility, we assessed the ability of MMGL isoform 4 to interact with PKA regulatory subunits R1A and R2A using Y2H-based direct protein-protein interaction assays. Additionally, to further

Heritable cardiomyopathy (HCM) is the leading cause of sudden cardiac arrest (SCA) in young people, affecting 1 in 500 individuals. HCM is chiefly caused by mutations in myofibrillar proteins of the cardiac sarcomere, and cardiac myosin binding protein-C (cMyBP-C, encoded by MYBPC3) is one of the most commonly affected. cMyBP-C, an accessory protein that binds tightly to myosin, has an important role in thick filament regulation. Mice with genetic ablation of MYBPC3 exhibit cardiac hypertrophy, reduced ejection fraction, and increased relaxation times in vivo. Experiments with explanted hearts from these mice exhibit greater susceptibility to arrhythmias compared to WT, suggesting derangement of Ca2+ handling. The molecular mechanisms underlying the progression of HCM are poorly understood, and are difficult to tease apart in constitutive knock out models due to potential compensatory changes that can mask important aspects of the disease phenotype. We used a tamoxifen-induced conditional MYBPC3 ...

Rationale: A stable 40 kD fragment is produced from cardiac myosin binding protein-C (cMyBP-C) when the heart is stressed, using a stimulus such as ischemia reperfusion injury. Elevated levels of the fragment can be detected in both the diseased mouse and human heart but its ability to interfere with normal cardiac function in the intact animal is unexplored. Objective: To understand the potential pathogenicity of the 40 kD fragment in vivo and to investigate the molecular pathways that could be targeted for potential therapeutic intervention. Methods and Results: We generated cardiac myocyte-specific transgenic mice (TG) using a Tet-Off inducible system to permit controlled expression of the 40 kD fragment in cardiomyocytes. When 40 kD protein expression is induced by crossing the responder animals with tetracycline transactivator (tTA) mice under conditions where substantial quantities approximating those observed in disease hearts are reached, the double TG (DTG) mice subsequently develop ...

The present invention relates to the use of fibroblast growth factor-binding protein (FGF-BP) polypeptides, and functional variants of these polypeptides, respectively, or of nucleic acids encoding th

TY - JOUR. T1 - Phosphoregulation of Cardiac Inotropy via Myosin Binding Protein-C during Increased Pacing Frequency or β1-Adrenergic Stimulation. AU - Tong, Carl W.. AU - Wu, Xin. AU - Liu, Yang. AU - Rosas, Paola C.. AU - Sadayappan, Sakthivel. AU - Hudmon, Andy. AU - Muthuchamy, Mariappan. AU - Powers, Patricia A.. AU - Valdivia, Héctor H.. AU - Moss, Richard L.. PY - 2015/5/4. Y1 - 2015/5/4. N2 - Background-Mammalian hearts exhibit positive inotropic responses to β-adrenergic stimulation as a consequence of protein kinase A-mediated phosphorylation or as a result of increased beat frequency (the Bowditch effect). Several membrane and myofibrillar proteins are phosphorylated under these conditions, but the relative contributions of these to increased contractility are not known. Phosphorylation of cardiac myosin-binding protein-C (cMyBP-C) by protein kinase A accelerates the kinetics of force development in permeabilized heart muscle, but its role in vivo is unknown. Such understanding is ...

Growth hormone-binding protein (GHBP) is a soluble carrier protein for growth hormone (GH). The function of GHBP is still unknown. Current research suggests that the protein is associated with regulation of the GH supply in the circulatory system as well as GH receptor function. In humans, GHBP is formed by post-translational modification after the complete transcription and translation of the growth hormone receptor (GHR) gene into the cell-surface receptor protein. The gene that codes for GHR (and inherently GHBP) is on Chromosome 5. A precursor messenger RNA (mRNA) from the complete gene first is transcribed and then spliced to encode the full receptor protein. This mature mRNA is composed of exons. Exons are peptide encoding regions of DNA genes that remain in the transcript after splicing and during the maturation of mRNA. The mRNA transcript encodes for a receptor protein that is made up of three distinct parts: an intracellular domain, a transmembrane domain, and an extracellular domain. ...

Myomegalin has been characterized as a protein with the properties of a scaffold or structural protein that is expressed at high levels in skeletal and cardiac tissue, suggesting an important function in muscle, and which interacts with a cAMP-specific phosphodiesterase [13]. However, the precise function and interactions of this protein, and its five isoforms, have been largely unknown. We here describe how the smallest MMGL isoform, isoform 4, binds to known and predicted PKA targets in the cardiac myocyte, including some sarcomeric proteins, viz. cMyBPC, cTNI, ENO1, ENO3, CARP and COMMD4 (Tables 1 and 2). Moreover, we show that MMGL isoform 4 interacts with two regulatory subunits of PKA (Figure 3). Together these results describe MMGL isoform 4 as a novel sarcomeric AKAP, which, like mAKAP [14], is involved in assembling a PKA/PDE cAMP signalling module.. In addition to interacting with both types of regulatory subunits, viz. RI and RII, which qualifies MMGL isoform 4 as a dual-specific AKAP ...

Browsing Doctoral Degrees (Molecular Biology and Human Genetics) by Title An investigation of myosin binding protein C mutations in South Africa and a search for ligands binding to myosin binding protein C ...

Cardiac myosin binding protein-C (cMyBPC) is a modular protein consisting of 11 domains whose precise function and sarcomeric arrangement are incompletely understood. Identification of hypertrophic cardiomyopathy (HCM)--causing missense mutations in cMyBPC has highlighted the significance of certain domains. Of particular interest is domain C5, an immunoglobulin-like domain with a cardiac-specific insert, which is of unknown function yet is the site of two HCM-causing missense mutations. To identify interactors with this region, a human cardiac cDNA library was screened in a yeast two-hybrid (Y2H) assay using the C5 sequence as bait. Screening |7x10(6) clones surprisingly revealed that domain C5 preferentially bound to clones encoding C-terminal fragments of cMyBPC; the interacting region was narrowed to domain C8 by deletion mapping. A surface plasmon resonance assay using purified recombinant cMyBPC domains was used to measure the affinity of C5 and C8 in vitro (K(a)=1x10(5) mol/L(-1)). This affinity

Mutations in the cardiac myosin binding protein C gene (MYBPC3) are common causes of hypertrophic cardiomyopathy (HCM) in humans. Even though the MYBPC3 E258K missense mutation is among the most prevalent HCM-causing mutations, the mechanism through which it causes disease remains unclear. We developed a novel neonatal murine 3D engineered cardiac tissue (ECT) model and previously presented data showing that Mybpc3 ablation (Mybpc3−/−) accelerates the kinetics of contraction and relaxation in the absence of hypertrophic remodeling in ECT. Furthermore, we showed that expression of wild type human MYBPC3 in Mybpc3−/− ECT (MYBPC3WT) restores contractile function. We hypothesized that adenoviral mediated expression of human E258K MYBPC3 in Mybpc3−/− ECT (MYBPC3E258K) would accelerate contractile kinetics and blunt the effect of dobutamine by abolishing phosphorylation-regulated inhibitory interactions between the C2-M-domain region of cMyBPC and myosin S2. The contractile characteristics ...

Copines make up a multigene family of calcium-dependent, phospholipid-binding proteins. Copine proteins consists of two C2 domains at the N terminus followed by an A domain similar to the von Willebrand-Integrin A domain. Mutant studies of copines suggest that copines may be involved in signaling pathways and may play a significant role in cell differentiation, programmed cell death, and cell development. Copines need to be studied further to have a clear understanding of the function they play in organismal life processes. We are studying copine protein function in the model organism protozoan Dictyostelium discoideum. Previous research showed that the copine A (cpnA-) knockout strain of Dictyostelium exhibited normal growth rates, a slight cytokinesis defect, a developmental defect, and a defect in contractile vacuole function. Furthermore, real-time reverse transcription-PCR data suggested that all of the copine genes except cpnF may be important regulators of Dictyostelium development. To ...

We have reported studies characterizing small-molecule inhibitors that selectively inhibit PLTP activity and concomitantly reduce apoB secretion. In the present study, we identified small molecules that inhibit both PLTP and MTP activities, which are known to regulate apoB secretion. This is the first report to identify dual inhibitors for PLTP and MTP activities. The discovery was not expected based on the lack of homology of PLTP and MTP at protein sequence levels. Although CETP and PLTP have 40% homology and belong to the family of lipid transfer/lipopolysaccharide-binding proteins (Tollefson et al., 1988; Day et al., 1994), none of these compounds inhibit CETP activity (Luo et al., 2010). MTP and apoB belong to the vitellogenin family of lipid transfer proteins. Read et al. (2000) predicted the three-dimensional structure of the C-terminal lipid binding cavity of MTP based on the crystal structure of lipoviellin. The lipid cavity in MTP bears a resemblance to the lipid binding domain of ...

Heparin-binding protein which binds to FGF2, prevents binding of FGF2 to heparin and probably inhibits immobilization of FGF2 on extracellular matrix glycosaminoglycans, allowing its release and subsequent activation of FGFR signaling which leads to increased vascular permeability ...

Thioredoxin-interacting protein (TXNIP) is an endogenous inhibitor of the antioxidant thioredoxin, and a critical agent in the in vivo regulation of glucose. The well-described induction of TXNIP by high glucose may represent an important pathogenic trigger of complications arising in the diabetic environment, with sustained overexpression of TXNIP triggering the increased production of reactive oxygen species and collagen, both major contributors to the development of diabetic nephropathy (DN). To examine a possible therapeutic role for targeted TXNIP inhibition in DN, transgenic (mRen-2)27 rats were rendered diabetic with streptozotocin and then treated with 20 μ,smlcap,M,/smlcap, TXNIP deoxyribozyme (DNAzyme) delivered continuously over 12 weeks by an implanted osmotic mini-pump. Renal injury was measured using biochemical parameters of kidney function along with histological markers of damage. Catalytic activity of TXNIP DNAzyme was determined by TXNIP gene and peptide expression in the rat ...

Compare peptidoglycan recognition protein 1 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.

lipid transfer protein: accelerates glycolipid exchange; catalyzes net transfer of glycosphingolipids from brush border membrane vesicles; also facilitates transfer of glucosyl-, galactosyl- & lactosylceramide from liposomal vesicles to red ghost cells; see also record for phospholipid exchange protein

Figure 3. Identification of cardiac myosin binding protein-C (cMyBP-C) as a cardiac myocyte-specific PKGIα anti-remodeling substrate through molecular screen for PKGIa-LZ binding proteins. From Thoonen et al, 2015. (A) Outline of screening strategy. GST-fusion proteins were generated containing the PKGIa LZ domain (PKG1-59), the PKGIα mutated LZ domain (PKGLZM), or GST alone. The separate bait proteins were incubated with left ventricular protein lysates, followed by SDS PAGE and Coomassie staining. Protein bands selectively precipitating with PKG1-59 were removed and identified by mass spectroscopy. (B) Representative Coomassie stain from left ventricular protein lysates incubated with GST-fusion proteins. The 150 kDa band visible only in PKG1-59 precipitate (denoted by arrow) was excised and subjected to mass spectroscopy, revealing cMyBP-C as the predominant species. The thick bands between 25 and 30 kDa represent GST fusion proteins. Representative of 3 independent experiments. (C) Model ...

Recombinant human HIPK1 (156-555) was expressed in Sf9 cells using an N-terminal GST tag. HIPK1 or homeodomain-interacting protein kinase 1 is a ser/thr protein kinase and a member of the HIPK family.

|strong|Goat anti Human TRIM5 alpha antibody|/strong| recognizes an epitope within the N-terminal (NT) region of human TRIM5alpha, otherwise known as RNF88 (RING finger protein 88), a cytoplasmic pro…

Jones Day represented Balderton Capital, as co-investor along with Ventech, in connection with their purchase of €7.5 million (US$10 million) of Series B Convertible B Preferred Stock in a private placement by Vestiaire de Copines, an online luxury resale store for second-hand fashion products.

Blotting techniques allow the transfer of proteins and nucleic acids (DNA, RNA) from polyacrylamide or agarose gels onto carrier membranes. Additional these techniques allow immobilization of those components from solutions onto carrier membranes. On the membrane the proteins and nucleic acids offer open access (compared to in-gel techniques) for detection methods for specific molecules (e. g. antibodies). ...

InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.

19. 1.Carrier Concept - According to this hypothesis the carrier protein picks up an ion from one side of the membrane and discharges it on the other side. The picking up and discharge of the ion requires energy. Energy is obtained by hydrolysis of ATP. - ATP changes into ADP and energy released is used to change the conformation of the carrier which may be ATPase itself, so that the ion is picked up on one side of the membrane and released on the other. - After discharge of an ion, carrier protein is reprimed to pick up an other ion. The carrier protein may carry one ion inwards and may exchange it with another ion at the inner surface of membrane, so that the other ion is carried by the same carrier outwards. ...

19. 1.Carrier Concept - According to this hypothesis the carrier protein picks up an ion from one side of the membrane and discharges it on the other side. The picking up and discharge of the ion requires energy. Energy is obtained by hydrolysis of ATP. - ATP changes into ADP and energy released is used to change the conformation of the carrier which may be ATPase itself, so that the ion is picked up on one side of the membrane and released on the other. - After discharge of an ion, carrier protein is reprimed to pick up an other ion. The carrier protein may carry one ion inwards and may exchange it with another ion at the inner surface of membrane, so that the other ion is carried by the same carrier outwards. ...

Muscle Mousse have unleashed this super tasty Moose Juice in Berry flavour!! Packed with Vitamins, BCAAs and most importantly ENERGY, great for pre-workout and in Berry flavour expect nothing less than incredible! Available in the Mix now!!

Buy our Recombinant Human TRIM35 protein. Ab161529 is a protein fragment produced in Wheat germ and has been validated in WB, ELISA. Abcam provides free…

Lola Collignon tait une gamine de 11 ans avec plein de lucioles dans la t te et des r ves de petite fille en devenir. Elle marchait avec trois de ses copines sur le macadam dun passage prot g de Thionville, le c ur gai et l ger lapproche des f tes de No l. Lola Collignon na pas crois le p re No l mais une voiture de pompiers d glingu e qui zigzaguait dangereusement, la fauchant mortellement et blessant gri vement ses amies...

02/20/2008 0tbrewer None 1041:45 0:25 0:00 0:25 -- *CG 5stox1 u 0.04 55.61 d 1.15 106.13 u 0.45 47.12 d 0.03 50.35 u 0.68 23.58 *CG 5stox2 u 0.33 18.39 u 0.06 26.50 d 0.72 40.02 u 0.26 21.55 d 0.10 6.75 *CG 5stox3 u 0.60 49.48 u 0.06 25.91 u 0.33 13.04 u 1.54 74.47 u 0.09 20.99 *CG 5stox4 d 0.02 71.12 u 0.10 22.47 u 1.54 74.47 d 0.11 1.61 u 0.04 12.61 S BREAK-3 -- ...

CG amstox D 120.96 13110.05 D 25.81 2618.51 D 241.69 15154.61 *CG 6stox1 d 0.56 35.27 u 0.05 72.27 d 0.02 46.24 d 1.65 44.08 d 0.01 10.09 *CG 6stox2 d 1.19 34.26 d 1.34 37.71 u 0.13 90.68 d 0.70 38.31 d 0.41 26.84 *CG 6stox3 d 0.41 63.84 d 0.32 27.69 u 0.14 50.11 u 0.08 4.20 d 1.03 48.75 *CG 6stox4 d >> 2.20 68.70 d 0.48 43.04 d 2.07 40.28 d 0.31 46.20 d 0.44 81.16 ...

Does anyone use Trimus picks? Im curious to see peoples assessments. Also, does anyone use really round-edged picks (like mando-style picks)?

Does Modere Trim help you lose weight? Read our Modere Trim review for ingredients, pros, cons, how it works, faq, price, and more!

购买TRIM50兔多克隆抗体(ab90906)，TRIM50抗体经WB验证，可与人样本反应。产品出库一年都在质保范围内。中国现货速达。

PICK1兔多克隆抗体(ab3420)可与小鼠, 大鼠, 人, 非人类灵长类动物样本反应并经WB, IP, IHC, ICC, ICC/IF实验严格验证，被4篇文献引用并得到6个独立的用户反馈。

MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEV 1 - 70 EFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVI 71 - 140 LYEEEMGNHNENTGEKLHLAQEQLALAGDKIASLERSLNLYRDKYQSSLSNIELLECQVKMLQGELGGIM 141 - 210 GQEPENKGDHSKVRIYTSPCMIQEHQETQKRLSEVWQKVSQQDDLIQELRNKLACSNALVLEREKALIKL 211 - 280 QADFASCTATHRYPPSSSEECEDIKKILKHLQEQKDSQCLHVEEYQNLVKDLRVELEAVSEQKRNIMKDM 281 - 350 MKLELDLHGLREETSAHIERKDKDITILQCRLQELQLEFTETQKLTLKKDKFLQEKDEMLQELEKKLTQV 351 - 420 QNSLLKKEKELEKQQCMATELEMTVKEAKQDKSKEAECKALQAEVQKLKNSLEEAKQQERLAGEAPAAQQ 421 - 490 AAQCKEEAALAGCHLEDTQRKLQKGLLLDKQKADTIQELQRELQMLQKESSMAEKEQTSNRKRVEELSLE 491 - 560 LSEALRKLENSDKEKRQLQKTVAEQDMKMNDMLDRIKHQHREQGSIKCKLEEDLQEATKLLEDKREQLKK 561 - 630 SKEHEKLMEGELEALRQEFKKKDKTLKENSRKLEEENENLRAELQCCSTQLESSLNKYNTSQQVIQDLNK 631 - 700 EIALQKESLMSLQAQLDKALQKEKHYLQTTITKEAYDALSRKSAACQDDLTQALEKLNHVTSETKSLQQS 701 - 770 LTQTQEKKAQLEEEIIAYEERMKKLNTELRKLRGFHQESELEVHAFDKKLEEMSCQVLQWQKQHQNDLKM 771 - 840 ...

TY - JOUR. T1 - Cross-species mechanical fingerprinting of cardiac myosin binding protein-C. AU - Karsai, Árpád. AU - Kellermayer, Miklós S Z. AU - Harris, Samantha P.. PY - 2013/6/4. Y1 - 2013/6/4. N2 - Cardiac myosin binding protein-C (cMyBP-C) is a member of the immunoglobulin (Ig) superfamily of proteins and consists of 8 Ig- and 3 fibronectin III (FNIII)-like domains along with a unique regulatory sequence referred to as the MyBP-C motif or M-domain. We previously used atomic force microscopy to investigate the mechanical properties of murine cMyBP-C expressed using a baculovirus/insect cell expression system. Here, we investigate whether the mechanical properties of cMyBP-C are conserved across species by using atomic force microscopy to manipulate recombinant human cMyBP-C and native cMyBP-C purified from bovine heart. Force versus extension data obtained in velocity-clamp experiments showed that the mechanical response of the human recombinant protein was remarkably similar to that of ...

Cardiac myosin binding protein C phosphorylation affects cross-bridge cycles elementary steps in a site-specific manner.: Based on our recent finding that card

Carnitine β-hydroxy-γ-(trimethylammonio)butyrate - a compound necessary in the peripheral tissues for a transfer of fatty acids for their oxidation within the cell, accumulates in the brain despite low β-oxidation in this organ. In order to enter the brain, carnitine has to cross the blood-brain barrier formed by capillary endothelial cells which are in close interaction with astrocytes. Previous studies, demonstrating expression of mRNA coding two carnitine transporters - organic cation/carnitine transporter 2 (OCTN2) and B|SUP|0,+|/SUP| in endothelial cells, did not give any information on carnitine transporters polarity in endothelium. Therefore more detailed experiments were performed on expression and localization of a high affinity carnitine transporter OCTN2 in an in vitro model of the blood-brain barrier by real-time PCR, western blot analysis, and immunocytochemistry. The amount of mRNA was comparable in endothelial cells and kidney, when referred to housekeeping genes, it was, however,

Microsomal triglyceride transfer protein large subunit is a protein that in humans is encoded by the MTTP gene. MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triaglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. Apolipoprotein B48 on chylomicra and Apolipoprotein B100 on LDL, IDL, and VLDL are important for MTP binding. Click on genes, proteins and metabolites below to link to respective articles. [[File: [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] ,px,alt=Statin Pathway edit]] The interactive pathway map can be edited at ...

Microsomal triglyceride transfer protein large subunit is a protein that in humans is encoded by the MTTP gene.[1][2] MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triaglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.[2] Apolipoprotein B48 on chylomicra and Apolipoprotein B100 on LDL, IDL, and VLDL are important for MTP binding. ...

It has been demonstrated previously that clinical phenotypes of HCM (hypertrophic cardiomyopathy) caused by mutations in the cardiac MyBP-C (myosin-binding protein C) gene show late onset, low penetrance and favourable clinical course. However, we have encountered severe phenotypes in several carriers of the MyBP-C gene mutations. The aim of the present study was to screen novel MyBP-C gene mutations in patients with HCM and to investigate the genetic differences in affected subjects with severe phenotypes. The MyBP-C gene was screened in 292 Japanese probands with HCM, and a novel c.2067+1G→A mutation was present in 15 subjects in five families. Clinical phenotypes of carriers of the c.2067+1G→A mutation were compared with those of a previously identified Arg820Gln (Arg820→Gln) mutation in the MyBP-C gene. The disease penetrance in subjects aged ≥30 years was 90% in carriers of the c.2067+1G→A mutation and 61% in carriers of the Arg820Gln mutation. Sudden death occurred in four ...

Oxaliplatin transport mediated by organic cation/carnitine transporters OCTN1 and OCTN2 in overexpressing human embryonic kidney 293 cells and rat dorsal root ganglion neurons

Abetalipoproteinemia (ABL) is an extremely rare autosomal recessive disorder, which is characterized by defective assembly and secretion of plasma apolipoprotein (apo) B-containing lipoproteins. ABL results from mutations in the gene encoding the microsomal triglyceride transfer protein (MTP). We se …

臺大位居世界頂尖大學之列，為永久珍藏及向國際展現本校豐碩的研究成果及學術能量，圖書館整合機構典藏（NTUR）與學術庫（AH）不同功能平台，成為臺大學術典藏NTU scholars。期能整合研究能量、促進交流合作、保存學術產出、推廣研究成果。. To permanently archive and promote researcher profiles and scholarly works, Library integrates the services of NTU Repository with Academic Hub to form NTU Scholars.. ...

Although mutations in cMyBP‐C are one of the most frequent causes of hypertrophic cardiomyopathy on a per gene basis with ,150 individual mutations being documented, the majority of these mutations (≈60%) result not in a full‐length, mutated protein, but in a truncated peptide and these mutated alleles exhibit autosomal dominance.29, 30 We have shown that a truncated form of cMyBP‐C is produced from endogenous, normal cMyBP‐C as a result of ischemia-reperfusion injury and/or general cardiovascular stress and is generated from Ca2+ activated μ‐calpain activity.2 This fragment is stable, can be expressed inducibly in cardiomyocytes and causes cardiac disease, fibrosis, and eventually heart failure and death.4 This model displays pathology that is often seen in human cardiac fibrosis and myocardial disease: the hearts develop hypertrophy and show extensive interstitial fibrosis and perivascular fibrosis while maintaining systolic function. Thus, in terms of a fibrotic response, the ...

UCL Discovery is UCLs open access repository, showcasing and providing access to UCL research outputs from all UCL disciplines.

Lipid-transfer proteins (LTP) are type of proteins, 9-kDa proteins present in high quantity as much as 4 percent of the total soluble protein in higher plants. Lipid-transfer proteins (LTP) are responsible for transfer (in vitro), of phospholipids between membranes as well as binds to acyl chains. Some important roles played by LTP are embryogenesis, participation in cutin formation, symbiosis, and the adaptation of plants to various environmental conditions and defense reactions against phytopathogens, though the validity of some these roles is needs to be determined. Recent studies show several important functions in the cell. Biosynthesis of many membrane lipids occurs at the (ER) endoplasmic reticulum, then they are dispensed by vesicular transport and lipid transfer proteins. Lysosomal lipid transfer proteins are types of proteins are multifunctional in nature. Though the mechanism and functions of most LTPs are yet to be determined, lipid transfer proteins in plants are involved in surface ...

SummaryThe main objective was to evaluate the association between SNPs and haplotypes of the FABP1-4 genes and type 2 diabetes, as well as its interaction with fat intake, in one general Spanish population. The association was replicated in a second population in which HOMA index was also evaluated.Methods1217 unrelated individuals were selected from a population-based study [Hortega study: 605 women; mean age 54 y; 7.8% with type 2 diabetes]. The replication population included 805 subjects from Segovia, a neighboring region of Spain (446 females; mean age 52 y; 10.3% with type 2 diabetes). DM2 mellitus was defined in a similar way in both studies. Fifteen SNPs previously associated with metabolic traits or with potential influence in the gene expression within the FABP1-4 genes were genotyped with SNPlex and tested. Age, sex and BMI were used as covariates in the logistic regression model.ResultsOne polymorphism (rs2197076) and two haplotypes of the FABP-1 showed a strong association with the ...

casSAR Dugability of A0AT31 | NLTP5 | Non-specific lipid-transfer protein 5 - Also known as NLTP5_LENCU, NLTP5. Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. MYBPC gene is linked to CMH4 and demonstrated a splice donor mutationin 1 family with familial hypertrophic cardiomyopathy and a duplication mutation in a second. Both mutations were predicted to disrupt the high-affinity, C-terminal myosin-binding domain of cardiac MyBP-C. Again, findings demonstrated that as in the case of the 3 forms that had been defined in molecular terms previously, familial hypertrophic cardiomyopathy is a disease of the sarcomere.

protease inhibitor/seed storage/lipid transfer protein (LTP) family protein; FUNCTIONS IN: lipid binding; INVOLVED IN: lipid transport; LOCATED IN: endomembrane system; CONTAINS InterPro DOMAIN/s: Bifunctional inhibitor/plant lipid transfer protein/seed storage (InterPro:IPR016140), Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (InterPro:IPR003612), Plant lipid transfer protein and hydrophobic protein, helical (InterPro:IPR013770); BEST Arabidopsis thaliana protein match is: protease inhibitor/seed storage/lipid transfer protein (LTP) family protein (TAIR:AT4G12510.1); Has 534 Blast hits to 530 proteins in 51 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 534; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink ...

TY - JOUR. T1 - Acyl-CoA binding protein is an essential protein in mammalian cell lines. AU - Knudsen, Jens. AU - Færgeman, Nils J.. PY - 2002/12/15. Y1 - 2002/12/15. N2 - In the present work, small interference RNA was used to knock-down acyl-CoA binding protein (ACBP) in HeLa, HepG2 and Chang cells. Transfection with ACBP-specific siRNA stopped growth, detached cells from the growth surface and blocked thymidine and acetate incorporation. The results show that depletion of ACBP in mammalian cells results in lethality, suggesting that ACBP is an essential protein.. AB - In the present work, small interference RNA was used to knock-down acyl-CoA binding protein (ACBP) in HeLa, HepG2 and Chang cells. Transfection with ACBP-specific siRNA stopped growth, detached cells from the growth surface and blocked thymidine and acetate incorporation. The results show that depletion of ACBP in mammalian cells results in lethality, suggesting that ACBP is an essential protein.. KW - Acetates. KW - ...

The aim of our study was to investigate the predictive value of the biomarkers interleukin 6 (IL-6), interleukin 10 (IL-10) and lipopolysaccharide-binding protein (LBP) compared with clinical CRB and CRB-65 severity scores in patients with community-acquired pneumonia (CAP). Samples and data were obtained from patients enrolled into the German CAPNETZ study group. Samples (blood, sputum and urine) were collected within 24 h of first presentation and inclusion in the CAPNETZ study, and CRB and CRB-65 scores were determined for all patients at the time of enrollment. The combined end point representative of a severe course of CAP was defined as mechanical ventilation, intensive care unit treatment and/or death within 30 days. Overall, a total of 1,000 patients were enrolled in the study. A severe course of CAP was observed in 105 (10.5%) patients. The highest IL-6, IL-10 and LBP concentrations were found in patients with CRB-65 scores of 3-4 or CRB scores of 2-3. IL-6 and LBP levels on enrollment in the

Lipid droplet (LD) utilization is an important cellular activity that regulates energy balance and release of lipid second messengers. Because fatty acids exhibit both beneficial and toxic properties, their release from LDs must be controlled. Here we demonstrate that yeast Sfh3, an unusual Sec14-like phosphatidylinositol transfer protein, is an LD-associated protein that inhibits lipid mobilization from these particles. We further document a complex biochemical diversification of LDs during sporulation in which Sfh3 and select other LD proteins redistribute into discrete LD subpopulations. The data show that Sfh3 modulates the efficiency with which a neutral lipid hydrolase-rich LD subclass is consumed during biogenesis of specialized membrane envelopes that package replicated haploid meiotic genomes. These results present novel insights into the interface between phosphoinositide signaling and developmental regulation of LD metabolism and unveil meiosis-specific aspects of Sfh3 (and ...

TY - JOUR. T1 - Mutations in Ribonucleic Acid Binding Protein Gene Cause Familial Dilated Cardiomyopathy. AU - Brauch, Katharine M.. AU - Karst, Margaret L.. AU - Herron, Kathleen J.. AU - de Andrade, Mariza. AU - Pellikka, Patricia A.. AU - Rodeheffer, Richard J.. AU - Michels, Virginia V.. AU - Olson, Timothy M.. PY - 2009/9/1. Y1 - 2009/9/1. N2 - Objectives: We sought to identify a novel gene for dilated cardiomyopathy (DCM). Background: DCM is a heritable, genetically heterogeneous disorder that remains idiopathic in the majority of patients. Familial cases provide an opportunity to discover unsuspected molecular bases of DCM, enabling pre-clinical risk detection. Methods: Two large families with autosomal-dominant DCM were studied. Genome-wide linkage analysis was used to identify a disease locus, followed by fine mapping and positional candidate gene sequencing. Mutation scanning was then performed in 278 unrelated subjects with idiopathic DCM, prospectively identified at the Mayo Clinic. ...

The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.

We have purified a 38 kDa protein from bovine brain which is cross-reactive with an affinity purified antibody against the 35 kDa phosphatidylino-sitol transfer protein from the same source. Controlled trypsinization of the 38 kDa protein yielded an immunoreactive protein of 35 kDa which displayed a 6-fold increase in phosphatidylinositol transfer activity and a IO-fold higher affinity for this phospholipid. The possibility that the 38 kDa protein is a precursor of the phosphatidylinositol transfer protein is discussed.(C) 1990 Elsevier Science B.V. All rights reserved ...

Read Comparative study of the genomic organization of DNA repeats within the 5′-flanking region of the natural resistance-associated macrophage protein gene (NRAMP1) between humans and great apes, Mammalian Genome on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.

Transcriptional activity of p53, a central regulatory switch in a network controlling cell proliferation and apoptosis, is modulated by protein stability and post-translational modifications including phosphorylation and acetylation. Here we demonstrate that the human serine/threonine kinase homeodo …

Lipid Transfer Proteins (LTPs) are found in plants and foods that contain plants. Lipid Transfer Protein Syndrome is an allergy affecting people who have become sensitised to LTPs.

El Archivo Digital UPM alberga en formato digital la documentacion academica y cientifica (tesis, pfc, articulos, etc..) generada en la Universidad Politecnica de Madrid.Los documentos del Archivo Digital UPM son recuperables desde buscadores: Google, Google Academics, Yahoo, Scirus, etc y desde recolectores OAI: E-ciencia, DRRD, Recolecta (REBIUN-FECYT), Driver, Oaister, etc.

1FK0: Structural basis of non-specific lipid binding in maize lipid-transfer protein complexes revealed by high-resolution X-ray crystallography.

1FK7: Structural basis of non-specific lipid binding in maize lipid-transfer protein complexes revealed by high-resolution X-ray crystallography.

What is Ligand Binding Protein Gene? Definition of Ligand Binding Protein Gene. Ligand Binding Protein Gene FAQ. Learn more about Ligand Binding Protein Gene. Ligand Binding Protein Gene facts.

Monte S. Willis, MD, PhD - $50,000 Familial hypertrophic cardiomyopathies (FHC) are the most common underlying cause of sudden death in children and young adults, which result from mutations primarily in proteins responsible for heart contraction. It has been identified that the cardiac specific protein MuRF1 (Muscle Ring Finger-1), mediates the degradation of one of these proteins, the cardiac Myosin Binding Protein-C (cMyBP-c). Since cMyBP-c is the most commonly mutated protein in patients with FHC, and cMyBP-c is degraded very rapidly by heart cells in these patients, this study proposes that MuRF1 may be a key regulator of this degradation as a mechanism to clear damaged proteins. Moreover, it has been identified that MURF1 regulates the turnover of proteins that transport energy (ATP) throughout the cell, and that MuRF1 inhibits increases in muscle size (cardiomyocyte hypertrophy). Therefore, the assumption is that MuRF1 is a unifying mechanism for the major underlying defects in FHC. The ...

Shop Glucokinase regulatory protein ELISA Kit, Recombinant Protein and Glucokinase regulatory protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.

MAYWOOD, Ill. - A new blood test can detect heart attacks hours faster than the current gold-standard blood test, according to a study led by Loyola University Chicago Stritch School of Medicine researchers.. The new test measures a protein that is released to the bloodstream by dying heart muscle. The protein is called cardiac myosin binding protein-C (cMyBP-C). The study found that cMyBP-C is released to the blood within just 15 minutes of cardiac damage, and rises to significant levels in three hours.. This is a potential ultra-early biomarker that could confirm whether a patient has had a heart attack, leading to faster and more effective treatment, said Sakthivel Sadayappan, PhD, senior author of the study, published Dec. 13, 2013 in the American Journal of Physiology - Heart and Circulatory Physiology.. Between 60 and 70 percent of all patients who complain of chest pain do not have heart attacks. Many of these patients are admitted to the hospital, at considerable time and expense, ...

In the present work, small interference RNA was used to knock-down acyl-CoA binding protein (ACBP) in HeLa, HepG2 and Chang cells. Transfection with ACBP-specific siRNA stopped growth, detached cells from the growth surface and blocked thymidine and acetate incorporation. The results show that depletion of ACBP in mammalian cells results in lethality, suggesting that ACBP is an essential protein.. ...

p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...

Signaling through the Hippo-Salvador-Warts (Wts) kinase cascade inhibits cell proliferation and promotes apoptosis by preventing nuclear accumulation of the transcriptional coactivator Yorkie (Yki in the fruit fly) or Yap (in vertebrates). Hippo-dependent phosphorylation of Yki by Wts prevents nuclear accumulation of Yki. In the nucleus, Yki cooperates with its partner Scalloped to promote expression of several target genes that inhibit apoptosis and promote mitosis. Two studies report that the serine-threonine kinase homeodomain-interacting protein kinase (Hipk) promotes Yki activity. Studies by Chen and Verheyen and by Poon et al. both demonstrate that, like overexpresison of yki or knockdown of wts, overexpresison of hipk in fly imaginal discs caused excessive cell proliferation, leading to tissue overgrowth, and stimulation of endogenous Yki transcriptional targets and reporter constructs. Reducing Hipk activity by mutation or RNA interference (RNAi) reduced both tissue size and expression ...

LBP [LPS (lipopolysaccharide)-binding protein] was discovered approximately 25 years ago. Since then, substantial progress has been made towards our understanding of its function in health and disease. Furthermore, the discovery of a large protein family sharing functional and structural attributes has helped in our knowledge. Still, key questions are unresolved, and here an overview on the old and new findings on LBP is given. LBP is an acute-phase protein of the liver, but is also synthesized in other cells of the organism. While LBP is named after the ability to bind to LPS of Gram-negative bacteria, it also can recognize other bacterial compounds, such as lipopeptides. It has been shown that LBP is needed to combat infections; however, the main mechanism of action is still not clear. New findings on natural genetic variations of LBP leading to functional consequences may help in further elucidating the mechanism of LBP and its role in innate immunity and disease. ...

p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...

Protein features are: Cellular retinaldehyde binding/alpha-tocopherol transport; Cellular retinaldehyde-binding/triple function, C-terminal; Phosphatidylinositol transfer protein-like, N-terminal ...

Solutions. Abraxas offers a suite of unique capabilities for informed, secure, and trusted decision-making, enabling a more confident and capable business environment. Bridging almost every facet of business operations, Abraxas offers clarity and insights through. Information Assurance (IA). Abraxas offers tailored assessments and training to manage information-related risks and ensure the security of customers systems.. Our Information Assurance (IA) experts, some of whom teach IA at top universities, are committed to maintaining the confidentiality, integrity, and adaptability of information systems. Abraxas engineers build upon classic IA models by including analysis of physical location and level of information vulnerability. Our analysis of information value, threats, and security, followed by the application of appropriate countermeasures, is the Abraxas advantage.. IA Services Offered. Abraxas offers a range of services designed to deliver confidence and rigor to our clients information ...

Integral membrane proteins (SCAMPs), tetraspan vesicle membrane proteins) that act as carriers, recycling proteins to the cell surface. At least three members of the family have been identified in humans: SCAMP1 (338 aa), SCAMP2 (329 aa), and SCAMP3 (347 aa). ...

DBI - DBI (untagged)-Human diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) (DBI), transcript variant 1 available for purchase from OriGene - Your Gene Company.

Recombinant GRB2-Related Adaptor Protein (GRAP) Protein (Myc-DYKDDDDK Tag). Species: Human. Source: HEK-293 Cells. Order product ABIN2722222.

PITPNB antibody, Internal (phosphatidylinositol transfer protein beta) for WB. Anti-PITPNB pAb (GTX45365) is tested in Human samples. 100% Ab-Assurance.

Complete information for AZIN2 gene (Protein Coding), Antizyme Inhibitor 2, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium

Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP ...