Compare WW domain binding protein 1 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
Rabbit polyclonal WW domain binding protein 4 antibody validated for WB and tested in Human. Immunogen corresponding to synthetic peptide
Complete information for MYBPC3 gene (Protein Coding), Myosin Binding Protein C3, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Mouse Monoclonal Anti-PGLYRP1/PGRP-S Antibody (188C424) [HRP]. Validated: WB, IHC, IHC-Fr. Tested Reactivity: Human, Mouse. 100% Guaranteed.
WBP11 antibody, N-term (WW domain binding protein 11) for IHC-P, IP, WB. Anti-WBP11 pAb (GTX46466) is tested in Human, Mouse samples. 100% Ab-Assurance.
Complete information for SH3BP5 gene (Protein Coding), SH3 Domain Binding Protein 5, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
SH3BP1 antibody, C-term (SH3-domain binding protein 1) for ICC/IF, IHC-P, WB. Anti-SH3BP1 pAb (GTX10103) is tested in Human samples. 100% Ab-Assurance.
购买HIPK2兔多克隆抗体(ab28507),HIPK2抗体经WB验证,可与人样本反应。5篇文献引用,2个独立用户反馈。产品出库一年都在质保范围内。中国现货速达。
购买Abcam重组人HOMER2蛋白(ab124559),经SDS-PAGE,MS验证。全长蛋白。提供28,000多种信号蛋白、细胞因子、趋化因子、生长因子等产品。
Secretory Carrier Membrane Proteins (SCAMPs) are a group of tetraspanning integral membrane proteins evolutionarily conserved from insects to mammals and plants. Mammalian genomes contain five SCAMP genes SCAMP1-SCAMP5 that regulate membrane dynamics, most prominently membrane-depolarization and Ca2+-induced regulated secretion, a key mechanism for neuronal and neuroendocrine signaling. However, the biological role of SCAMPs has remained poorly understood primarily owing to the lack of appropriate model organisms and behavior assays. Here we generate Drosophila Scamp null mutants and show that they exhibit reduced lifespan and behavioral abnormalities including impaired climbing, deficiency in odor associated long-term memory, and a susceptibility to heat-induced seizures. Neuron-specific restoration of Drosophila Scamp rescues all Scamp behavioral phenotypes, indicating that the phenotypes are due to loss of neuronal Scamp. Remarkably, neuronal expression of human SCAMP genes rescues selected
Microsomal triglyceride transfer protein (MTP) is required for the assembly and cellular secretion of apolipoprotein B (apoB) -containing lipoproteins from the liver and intestine. The secretion pattern of apoB-containing lipoproteins is likely to influence the VLDL and LDL levels in plasma. By initial opportunistic screening for polymorphic sites in the regulatory region of the MTP gene by gene sequencing in 20 healthy male subjects, a common functional G/T polymorphism was detected 493 bp upstream from the transcriptional start point. There was differential binding of unique nuclear proteins at this site, as shown by electrophoretic mobility shift assay. The G variant seemed to bind two or three nuclear proteins that do not bind to the T variant. Expression studies with minimal promoter constructs linked to the chloramphenicol acetyltransferase reporter and transfected into HepG2 cells revealed marked enhancement of transcriptional activity with the T variant. The prevalence of the MTP promoter
Heritable cardiomyopathy (HCM) is the leading cause of sudden cardiac arrest (SCA) in young people, affecting 1 in 500 individuals. HCM is chiefly caused by mutations in myofibrillar proteins of the cardiac sarcomere, and cardiac myosin binding protein-C (cMyBP-C, encoded by MYBPC3) is one of the most commonly affected. cMyBP-C, an accessory protein that binds tightly to myosin, has an important role in thick filament regulation. Mice with genetic ablation of MYBPC3 exhibit cardiac hypertrophy, reduced ejection fraction, and increased relaxation times in vivo. Experiments with explanted hearts from these mice exhibit greater susceptibility to arrhythmias compared to WT, suggesting derangement of Ca2+ handling. The molecular mechanisms underlying the progression of HCM are poorly understood, and are difficult to tease apart in constitutive knock out models due to potential compensatory changes that can mask important aspects of the disease phenotype. We used a tamoxifen-induced conditional MYBPC3 ...
Rationale: A stable 40 kD fragment is produced from cardiac myosin binding protein-C (cMyBP-C) when the heart is stressed, using a stimulus such as ischemia reperfusion injury. Elevated levels of the fragment can be detected in both the diseased mouse and human heart but its ability to interfere with normal cardiac function in the intact animal is unexplored. Objective: To understand the potential pathogenicity of the 40 kD fragment in vivo and to investigate the molecular pathways that could be targeted for potential therapeutic intervention. Methods and Results: We generated cardiac myocyte-specific transgenic mice (TG) using a Tet-Off inducible system to permit controlled expression of the 40 kD fragment in cardiomyocytes. When 40 kD protein expression is induced by crossing the responder animals with tetracycline transactivator (tTA) mice under conditions where substantial quantities approximating those observed in disease hearts are reached, the double TG (DTG) mice subsequently develop ...
The present invention relates to the use of fibroblast growth factor-binding protein (FGF-BP) polypeptides, and functional variants of these polypeptides, respectively, or of nucleic acids encoding th
TY - JOUR. T1 - Phosphoregulation of Cardiac Inotropy via Myosin Binding Protein-C during Increased Pacing Frequency or β1-Adrenergic Stimulation. AU - Tong, Carl W.. AU - Wu, Xin. AU - Liu, Yang. AU - Rosas, Paola C.. AU - Sadayappan, Sakthivel. AU - Hudmon, Andy. AU - Muthuchamy, Mariappan. AU - Powers, Patricia A.. AU - Valdivia, Héctor H.. AU - Moss, Richard L.. PY - 2015/5/4. Y1 - 2015/5/4. N2 - Background-Mammalian hearts exhibit positive inotropic responses to β-adrenergic stimulation as a consequence of protein kinase A-mediated phosphorylation or as a result of increased beat frequency (the Bowditch effect). Several membrane and myofibrillar proteins are phosphorylated under these conditions, but the relative contributions of these to increased contractility are not known. Phosphorylation of cardiac myosin-binding protein-C (cMyBP-C) by protein kinase A accelerates the kinetics of force development in permeabilized heart muscle, but its role in vivo is unknown. Such understanding is ...
Growth hormone-binding protein (GHBP) is a soluble carrier protein for growth hormone (GH). The function of GHBP is still unknown. Current research suggests that the protein is associated with regulation of the GH supply in the circulatory system as well as GH receptor function. In humans, GHBP is formed by post-translational modification after the complete transcription and translation of the growth hormone receptor (GHR) gene into the cell-surface receptor protein. The gene that codes for GHR (and inherently GHBP) is on Chromosome 5. A precursor messenger RNA (mRNA) from the complete gene first is transcribed and then spliced to encode the full receptor protein. This mature mRNA is composed of exons. Exons are peptide encoding regions of DNA genes that remain in the transcript after splicing and during the maturation of mRNA. The mRNA transcript encodes for a receptor protein that is made up of three distinct parts: an intracellular domain, a transmembrane domain, and an extracellular domain. ...
Myomegalin has been characterized as a protein with the properties of a scaffold or structural protein that is expressed at high levels in skeletal and cardiac tissue, suggesting an important function in muscle, and which interacts with a cAMP-specific phosphodiesterase [13]. However, the precise function and interactions of this protein, and its five isoforms, have been largely unknown. We here describe how the smallest MMGL isoform, isoform 4, binds to known and predicted PKA targets in the cardiac myocyte, including some sarcomeric proteins, viz. cMyBPC, cTNI, ENO1, ENO3, CARP and COMMD4 (Tables 1 and 2). Moreover, we show that MMGL isoform 4 interacts with two regulatory subunits of PKA (Figure 3). Together these results describe MMGL isoform 4 as a novel sarcomeric AKAP, which, like mAKAP [14], is involved in assembling a PKA/PDE cAMP signalling module.. In addition to interacting with both types of regulatory subunits, viz. RI and RII, which qualifies MMGL isoform 4 as a dual-specific AKAP ...
Browsing Doctoral Degrees (Molecular Biology and Human Genetics) by Title "An investigation of myosin binding protein C mutations in South Africa and a search for ligands binding to myosin binding protein C ...
Mutations in the cardiac myosin binding protein C gene (MYBPC3) are common causes of hypertrophic cardiomyopathy (HCM) in humans. Even though the MYBPC3 E258K missense mutation is among the most prevalent HCM-causing mutations, the mechanism through which it causes disease remains unclear. We developed a novel neonatal murine 3D engineered cardiac tissue (ECT) model and previously presented data showing that Mybpc3 ablation (Mybpc3−/−) accelerates the kinetics of contraction and relaxation in the absence of hypertrophic remodeling in ECT. Furthermore, we showed that expression of wild type human MYBPC3 in Mybpc3−/− ECT (MYBPC3WT) restores contractile function. We hypothesized that adenoviral mediated expression of human E258K MYBPC3 in Mybpc3−/− ECT (MYBPC3E258K) would accelerate contractile kinetics and blunt the effect of dobutamine by abolishing phosphorylation-regulated inhibitory interactions between the C2-M-domain region of cMyBPC and myosin S2. The contractile characteristics ...
Copines make up a multigene family of calcium-dependent, phospholipid-binding proteins. Copine proteins consists of two C2 domains at the N terminus followed by an "A domain" similar to the von Willebrand-Integrin A domain. Mutant studies of copines suggest that copines may be involved in signaling pathways and may play a significant role in cell differentiation, programmed cell death, and cell development. Copines need to be studied further to have a clear understanding of the function they play in organismal life processes. We are studying copine protein function in the model organism protozoan Dictyostelium discoideum. Previous research showed that the copine A (cpnA-) knockout strain of Dictyostelium exhibited normal growth rates, a slight cytokinesis defect, a developmental defect, and a defect in contractile vacuole function. Furthermore, real-time reverse transcription-PCR data suggested that all of the copine genes except cpnF may be important regulators of Dictyostelium development. To ...
We have reported studies characterizing small-molecule inhibitors that selectively inhibit PLTP activity and concomitantly reduce apoB secretion. In the present study, we identified small molecules that inhibit both PLTP and MTP activities, which are known to regulate apoB secretion. This is the first report to identify dual inhibitors for PLTP and MTP activities. The discovery was not expected based on the lack of homology of PLTP and MTP at protein sequence levels. Although CETP and PLTP have 40% homology and belong to the family of lipid transfer/lipopolysaccharide-binding proteins (Tollefson et al., 1988; Day et al., 1994), none of these compounds inhibit CETP activity (Luo et al., 2010). MTP and apoB belong to the vitellogenin family of lipid transfer proteins. Read et al. (2000) predicted the three-dimensional structure of the C-terminal lipid binding cavity of MTP based on the crystal structure of lipoviellin. The lipid cavity in MTP bears a resemblance to the lipid binding domain of ...
Heparin-binding protein which binds to FGF2, prevents binding of FGF2 to heparin and probably inhibits immobilization of FGF2 on extracellular matrix glycosaminoglycans, allowing its release and subsequent activation of FGFR signaling which leads to increased vascular permeability ...
Thioredoxin-interacting protein (TXNIP) is an endogenous inhibitor of the antioxidant thioredoxin, and a critical agent in the in vivo regulation of glucose. The well-described induction of TXNIP by high glucose may represent an important pathogenic trigger of complications arising in the diabetic environment, with sustained overexpression of TXNIP triggering the increased production of reactive oxygen species and collagen, both major contributors to the development of diabetic nephropathy (DN). To examine a possible therapeutic role for targeted TXNIP inhibition in DN, transgenic (mRen-2)27 rats were rendered diabetic with streptozotocin and then treated with 20 μ,smlcap,M,/smlcap, TXNIP deoxyribozyme (DNAzyme) delivered continuously over 12 weeks by an implanted osmotic mini-pump. Renal injury was measured using biochemical parameters of kidney function along with histological markers of damage. Catalytic activity of TXNIP DNAzyme was determined by TXNIP gene and peptide expression in the rat ...
Compare peptidoglycan recognition protein 1 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
lipid transfer protein: accelerates glycolipid exchange; catalyzes net transfer of glycosphingolipids from brush border membrane vesicles; also facilitates transfer of glucosyl-, galactosyl- & lactosylceramide from liposomal vesicles to red ghost cells; see also record for phospholipid exchange protein
Figure 3. Identification of cardiac myosin binding protein-C (cMyBP-C) as a cardiac myocyte-specific PKGIα anti-remodeling substrate through molecular screen for PKGIa-LZ binding proteins. From Thoonen et al, 2015. (A) Outline of screening strategy. GST-fusion proteins were generated containing the PKGIa LZ domain (PKG1-59), the PKGIα mutated LZ domain (PKGLZM), or GST alone. The separate bait proteins were incubated with left ventricular protein lysates, followed by SDS PAGE and Coomassie staining. Protein bands selectively precipitating with PKG1-59 were removed and identified by mass spectroscopy. (B) Representative Coomassie stain from left ventricular protein lysates incubated with GST-fusion proteins. The 150 kDa band visible only in PKG1-59 precipitate (denoted by arrow) was excised and subjected to mass spectroscopy, revealing cMyBP-C as the predominant species. The thick bands between 25 and 30 kDa represent GST fusion proteins. Representative of 3 independent experiments. (C) Model ...
Blotting techniques allow the transfer of proteins and nucleic acids (DNA, RNA) from polyacrylamide or agarose gels onto carrier membranes. Additional these techniques allow immobilization of those components from solutions onto carrier membranes. On the membrane the proteins and nucleic acids offer open access (compared to in-gel techniques) for detection methods for specific molecules (e. g. antibodies). ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
19. 1.Carrier Concept - According to this hypothesis the carrier protein picks up an ion from one side of the membrane and discharges it on the other side. The picking up and discharge of the ion requires energy. Energy is obtained by hydrolysis of ATP. - ATP changes into ADP and energy released is used to change the conformation of the carrier which may be ATPase itself, so that the ion is picked up on one side of the membrane and released on the other. - After discharge of an ion, carrier protein is reprimed to pick up an other ion. The carrier protein may carry one ion inwards and may exchange it with another ion at the inner surface of membrane, so that the other ion is carried by the same carrier outwards. ...
19. 1.Carrier Concept - According to this hypothesis the carrier protein picks up an ion from one side of the membrane and discharges it on the other side. The picking up and discharge of the ion requires energy. Energy is obtained by hydrolysis of ATP. - ATP changes into ADP and energy released is used to change the conformation of the carrier which may be ATPase itself, so that the ion is picked up on one side of the membrane and released on the other. - After discharge of an ion, carrier protein is reprimed to pick up an other ion. The carrier protein may carry one ion inwards and may exchange it with another ion at the inner surface of membrane, so that the other ion is carried by the same carrier outwards. ...
Muscle Mousse have unleashed this super tasty Moose Juice in Berry flavour!! Packed with Vitamins, BCAAs and most importantly ENERGY, great for pre-workout and in Berry flavour expect nothing less than incredible! Available in the Mix now!!
Buy our Recombinant Human TRIM35 protein. Ab161529 is a protein fragment produced in Wheat germ and has been validated in WB, ELISA. Abcam provides free…
Lola Collignon tait une gamine de 11 ans avec plein de lucioles dans la t te et des r ves de petite fille en devenir. Elle marchait avec trois de ses copines sur le macadam dun passage prot g de Thionville, le c ur gai et l ger lapproche des f tes de No l. Lola Collignon na pas crois le p re No l mais une voiture de pompiers d glingu e qui zigzaguait dangereusement, la fauchant mortellement et blessant gri vement ses amies...
02/20/2008 0tbrewer None 1041:45 0:25 0:00 0:25 -- *CG 5stox1 u 0.04 55.61 d 1.15 106.13 u 0.45 47.12 d 0.03 50.35 u 0.68 23.58 *CG 5stox2 u 0.33 18.39 u 0.06 26.50 d 0.72 40.02 u 0.26 21.55 d 0.10 6.75 *CG 5stox3 u 0.60 49.48 u 0.06 25.91 u 0.33 13.04 u 1.54 74.47 u 0.09 20.99 *CG 5stox4 d 0.02 71.12 u 0.10 22.47 u 1.54 74.47 d 0.11 1.61 u 0.04 12.61 S BREAK-3 -- ...
CG amstox D 120.96 13110.05 D 25.81 2618.51 D 241.69 15154.61 *CG 6stox1 d 0.56 35.27 u 0.05 72.27 d 0.02 46.24 d 1.65 44.08 d 0.01 10.09 *CG 6stox2 d 1.19 34.26 d 1.34 37.71 u 0.13 90.68 d 0.70 38.31 d 0.41 26.84 *CG 6stox3 d 0.41 63.84 d 0.32 27.69 u 0.14 50.11 u 0.08 4.20 d 1.03 48.75 *CG 6stox4 d >> 2.20 68.70 d 0.48 43.04 d 2.07 40.28 d 0.31 46.20 d 0.44 81.16 ...
MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEV 1 - 70 EFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVI 71 - 140 LYEEEMGNHNENTGEKLHLAQEQLALAGDKIASLERSLNLYRDKYQSSLSNIELLECQVKMLQGELGGIM 141 - 210 GQEPENKGDHSKVRIYTSPCMIQEHQETQKRLSEVWQKVSQQDDLIQELRNKLACSNALVLEREKALIKL 211 - 280 QADFASCTATHRYPPSSSEECEDIKKILKHLQEQKDSQCLHVEEYQNLVKDLRVELEAVSEQKRNIMKDM 281 - 350 MKLELDLHGLREETSAHIERKDKDITILQCRLQELQLEFTETQKLTLKKDKFLQEKDEMLQELEKKLTQV 351 - 420 QNSLLKKEKELEKQQCMATELEMTVKEAKQDKSKEAECKALQAEVQKLKNSLEEAKQQERLAGEAPAAQQ 421 - 490 AAQCKEEAALAGCHLEDTQRKLQKGLLLDKQKADTIQELQRELQMLQKESSMAEKEQTSNRKRVEELSLE 491 - 560 LSEALRKLENSDKEKRQLQKTVAEQDMKMNDMLDRIKHQHREQGSIKCKLEEDLQEATKLLEDKREQLKK 561 - 630 SKEHEKLMEGELEALRQEFKKKDKTLKENSRKLEEENENLRAELQCCSTQLESSLNKYNTSQQVIQDLNK 631 - 700 EIALQKESLMSLQAQLDKALQKEKHYLQTTITKEAYDALSRKSAACQDDLTQALEKLNHVTSETKSLQQS 701 - 770 LTQTQEKKAQLEEEIIAYEERMKKLNTELRKLRGFHQESELEVHAFDKKLEEMSCQVLQWQKQHQNDLKM 771 - 840 ...
Cardiac myosin binding protein C phosphorylation affects cross-bridge cycles elementary steps in a site-specific manner.: Based on our recent finding that card
Microsomal triglyceride transfer protein large subunit is a protein that in humans is encoded by the MTTP gene. MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triaglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. Apolipoprotein B48 on chylomicra and Apolipoprotein B100 on LDL, IDL, and VLDL are important for MTP binding. Click on genes, proteins and metabolites below to link to respective articles. [[File: [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] [[ ]] ,px,alt=Statin Pathway edit]] The interactive pathway map can be edited at ...
Microsomal triglyceride transfer protein large subunit is a protein that in humans is encoded by the MTTP gene.[1][2] MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triaglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.[2] Apolipoprotein B48 on chylomicra and Apolipoprotein B100 on LDL, IDL, and VLDL are important for MTP binding. ...
Oxaliplatin transport mediated by organic cation/carnitine transporters OCTN1 and OCTN2 in overexpressing human embryonic kidney 293 cells and rat dorsal root ganglion neurons
臺大位居世界頂尖大學之列,為永久珍藏及向國際展現本校豐碩的研究成果及學術能量,圖書館整合機構典藏(NTUR)與學術庫(AH)不同功能平台,成為臺大學術典藏NTU scholars。期能整合研究能量、促進交流合作、保存學術產出、推廣研究成果。. To permanently archive and promote researcher profiles and scholarly works, Library integrates the services of "NTU Repository" with "Academic Hub" to form NTU Scholars.. ...
Although mutations in cMyBP‐C are one of the most frequent causes of hypertrophic cardiomyopathy on a per gene basis with ,150 individual mutations being documented, the majority of these mutations (≈60%) result not in a full‐length, mutated protein, but in a truncated peptide and these mutated alleles exhibit autosomal dominance.29, 30 We have shown that a truncated form of cMyBP‐C is produced from endogenous, normal cMyBP‐C as a result of ischemia-reperfusion injury and/or general cardiovascular stress and is generated from Ca2+ activated μ‐calpain activity.2 This fragment is stable, can be expressed inducibly in cardiomyocytes and causes cardiac disease, fibrosis, and eventually heart failure and death.4 This model displays pathology that is often seen in human cardiac fibrosis and myocardial disease: the hearts develop hypertrophy and show extensive interstitial fibrosis and perivascular fibrosis while maintaining systolic function. Thus, in terms of a fibrotic response, the ...
UCL Discovery is UCLs open access repository, showcasing and providing access to UCL research outputs from all UCL disciplines.
Lipid-transfer proteins (LTP) are type of proteins, 9-kDa proteins present in high quantity as much as 4 percent of the total soluble protein in higher plants. Lipid-transfer proteins (LTP) are responsible for transfer (in vitro), of phospholipids between membranes as well as binds to acyl chains. Some important roles played by LTP are embryogenesis, participation in cutin formation, symbiosis, and the adaptation of plants to various environmental conditions and defense reactions against phytopathogens, though the validity of some these roles is needs to be determined. Recent studies show several important functions in the cell. Biosynthesis of many membrane lipids occurs at the (ER) endoplasmic reticulum, then they are dispensed by vesicular transport and lipid transfer proteins. Lysosomal lipid transfer proteins are types of proteins are multifunctional in nature. Though the mechanism and functions of most LTPs are yet to be determined, lipid transfer proteins in plants are involved in surface ...
SummaryThe main objective was to evaluate the association between SNPs and haplotypes of the FABP1-4 genes and type 2 diabetes, as well as its interaction with fat intake, in one general Spanish population. The association was replicated in a second population in which HOMA index was also evaluated.Methods1217 unrelated individuals were selected from a population-based study [Hortega study: 605 women; mean age 54 y; 7.8% with type 2 diabetes]. The replication population included 805 subjects from Segovia, a neighboring region of Spain (446 females; mean age 52 y; 10.3% with type 2 diabetes). DM2 mellitus was defined in a similar way in both studies. Fifteen SNPs previously associated with metabolic traits or with potential influence in the gene expression within the FABP1-4 genes were genotyped with SNPlex and tested. Age, sex and BMI were used as covariates in the logistic regression model.ResultsOne polymorphism (rs2197076) and two haplotypes of the FABP-1 showed a strong association with the ...
casSAR Dugability of A0AT31 | NLTP5 | Non-specific lipid-transfer protein 5 - Also known as NLTP5_LENCU, NLTP5. Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. MYBPC gene is linked to CMH4 and demonstrated a splice donor mutationin 1 family with familial hypertrophic cardiomyopathy and a duplication mutation in a second. Both mutations were predicted to disrupt the high-affinity, C-terminal myosin-binding domain of cardiac MyBP-C. Again, findings demonstrated that as in the case of the 3 forms that had been defined in molecular terms previously, familial hypertrophic cardiomyopathy is a disease of the sarcomere.
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein; FUNCTIONS IN: lipid binding; INVOLVED IN: lipid transport; LOCATED IN: endomembrane system; CONTAINS InterPro DOMAIN/s: Bifunctional inhibitor/plant lipid transfer protein/seed storage (InterPro:IPR016140), Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (InterPro:IPR003612), Plant lipid transfer protein and hydrophobic protein, helical (InterPro:IPR013770); BEST Arabidopsis thaliana protein match is: protease inhibitor/seed storage/lipid transfer protein (LTP) family protein (TAIR:AT4G12510.1); Has 534 Blast hits to 530 proteins in 51 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 534; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink ...
TY - JOUR. T1 - Acyl-CoA binding protein is an essential protein in mammalian cell lines. AU - Knudsen, Jens. AU - Færgeman, Nils J.. PY - 2002/12/15. Y1 - 2002/12/15. N2 - In the present work, small interference RNA was used to knock-down acyl-CoA binding protein (ACBP) in HeLa, HepG2 and Chang cells. Transfection with ACBP-specific siRNA stopped growth, detached cells from the growth surface and blocked thymidine and acetate incorporation. The results show that depletion of ACBP in mammalian cells results in lethality, suggesting that ACBP is an essential protein.. AB - In the present work, small interference RNA was used to knock-down acyl-CoA binding protein (ACBP) in HeLa, HepG2 and Chang cells. Transfection with ACBP-specific siRNA stopped growth, detached cells from the growth surface and blocked thymidine and acetate incorporation. The results show that depletion of ACBP in mammalian cells results in lethality, suggesting that ACBP is an essential protein.. KW - Acetates. KW - ...
Lipid droplet (LD) utilization is an important cellular activity that regulates energy balance and release of lipid second messengers. Because fatty acids exhibit both beneficial and toxic properties, their release from LDs must be controlled. Here we demonstrate that yeast Sfh3, an unusual Sec14-like phosphatidylinositol transfer protein, is an LD-associated protein that inhibits lipid mobilization from these particles. We further document a complex biochemical diversification of LDs during sporulation in which Sfh3 and select other LD proteins redistribute into discrete LD subpopulations. The data show that Sfh3 modulates the efficiency with which a neutral lipid hydrolase-rich LD subclass is consumed during biogenesis of specialized membrane envelopes that package replicated haploid meiotic genomes. These results present novel insights into the interface between phosphoinositide signaling and developmental regulation of LD metabolism and unveil meiosis-specific aspects of Sfh3 (and ...
We have purified a 38 kDa protein from bovine brain which is cross-reactive with an affinity purified antibody against the 35 kDa phosphatidylino-sitol transfer protein from the same source. Controlled trypsinization of the 38 kDa protein yielded an immunoreactive protein of 35 kDa which displayed a 6-fold increase in phosphatidylinositol transfer activity and a IO-fold higher affinity for this phospholipid. The possibility that the 38 kDa protein is a precursor of the phosphatidylinositol transfer protein is discussed.(C) 1990 Elsevier Science B.V. All rights reserved ...
Read "Comparative study of the genomic organization of DNA repeats within the 5′-flanking region of the natural resistance-associated macrophage protein gene (NRAMP1) between humans and great apes, Mammalian Genome" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
El Archivo Digital UPM alberga en formato digital la documentacion academica y cientifica (tesis, pfc, articulos, etc..) generada en la Universidad Politecnica de Madrid.Los documentos del Archivo Digital UPM son recuperables desde buscadores: Google, Google Academics, Yahoo, Scirus, etc y desde recolectores OAI: E-ciencia, DRRD, Recolecta (REBIUN-FECYT), Driver, Oaister, etc.
1FK0: Structural basis of non-specific lipid binding in maize lipid-transfer protein complexes revealed by high-resolution X-ray crystallography.
1FK7: Structural basis of non-specific lipid binding in maize lipid-transfer protein complexes revealed by high-resolution X-ray crystallography.
What is Ligand Binding Protein Gene? Definition of Ligand Binding Protein Gene. Ligand Binding Protein Gene FAQ. Learn more about Ligand Binding Protein Gene. Ligand Binding Protein Gene facts.
Shop Glucokinase regulatory protein ELISA Kit, Recombinant Protein and Glucokinase regulatory protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
MAYWOOD, Ill. - A new blood test can detect heart attacks hours faster than the current gold-standard blood test, according to a study led by Loyola University Chicago Stritch School of Medicine researchers.. The new test measures a protein that is released to the bloodstream by dying heart muscle. The protein is called cardiac myosin binding protein-C (cMyBP-C). The study found that cMyBP-C is released to the blood within just 15 minutes of cardiac damage, and rises to significant levels in three hours.. "This is a potential ultra-early biomarker that could confirm whether a patient has had a heart attack, leading to faster and more effective treatment," said Sakthivel Sadayappan, PhD, senior author of the study, published Dec. 13, 2013 in the American Journal of Physiology - Heart and Circulatory Physiology.. Between 60 and 70 percent of all patients who complain of chest pain do not have heart attacks. Many of these patients are admitted to the hospital, at considerable time and expense, ...
In the present work, small interference RNA was used to knock-down acyl-CoA binding protein (ACBP) in HeLa, HepG2 and Chang cells. Transfection with ACBP-specific siRNA stopped growth, detached cells from the growth surface and blocked thymidine and acetate incorporation. The results show that depletion of ACBP in mammalian cells results in lethality, suggesting that ACBP is an essential protein.. ...
LBP [LPS (lipopolysaccharide)-binding protein] was discovered approximately 25 years ago. Since then, substantial progress has been made towards our understanding of its function in health and disease. Furthermore, the discovery of a large protein family sharing functional and structural attributes has helped in our knowledge. Still, key questions are unresolved, and here an overview on the old and new findings on LBP is given. LBP is an acute-phase protein of the liver, but is also synthesized in other cells of the organism. While LBP is named after the ability to bind to LPS of Gram-negative bacteria, it also can recognize other bacterial compounds, such as lipopeptides. It has been shown that LBP is needed to combat infections; however, the main mechanism of action is still not clear. New findings on natural genetic variations of LBP leading to functional consequences may help in further elucidating the mechanism of LBP and its role in innate immunity and disease. ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Integral membrane proteins (SCAMPs), tetraspan vesicle membrane proteins) that act as carriers, recycling proteins to the cell surface. At least three members of the family have been identified in humans: SCAMP1 (338 aa), SCAMP2 (329 aa), and SCAMP3 (347 aa). ...
DBI - DBI (untagged)-Human diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) (DBI), transcript variant 1 available for purchase from OriGene - Your Gene Company.
Recombinant GRB2-Related Adaptor Protein (GRAP) Protein (Myc-DYKDDDDK Tag). Species: Human. Source: HEK-293 Cells. Order product ABIN2722222.
View all contributions by Dr. Filip Casselman from AalstBelgium in the field of interventional cardiology and cardiovascular disease on PCRonline.
... , Authors: Kate E Lines, Tatjana Crnogorac-Jurcevic. Published in: Atlas Genet Cytogenet Oncol Haematol.
Looks like i did it guys! I finally made a build on my own that did a GR 70! (Note i have never done a GR 70 before but specifically wanted to design my own build to do it) I know it might share some similarities to other builds but ultimately the only thing other builds influenced is choosing Mirinae over Bane of the powerful. I needed the healing to keep me alive. I manged to do a GR70 with just over 5 minutes remaining and only 3 deaths. I dont really know how to do a build guide but i just focoused on CHC and CHD as well as max essence. Beyond that the skills and items speak for themselves.. ...
Nauticus PT951040 SX ProTroller Series Trim TabsPT951040PT951040 Smart Tabs SX Series Trim TabsSmart Tabs SX Series for boats 14 17 ft with 40 80 hp motors.Smart Tabs SX Series from Nauticus, Inc.Trolling Brakes and Trim Tabs All in OneThe Pr...
Investitia medie in deschiderea unui nou magazin este de 600 de euro/metru patrat, magazinele avand, in medie, intre 120-200 metri patrati. Cifra de afaceri a Otter Distribution pentru anul 2015 a...
Disciplines:Laboratoriumgeneeskunde, Palliatieve zorg en zorg rond het levenseinde, Regeneratieve geneeskunde, Andere basiswetenschappen, Andere gezondheidswetenschappen, Verpleegkunde, Andere paramedische wetenschappen, Andere translationele wetenschappen, Andere medische en gezondheidswetenschappen ...
IP3-mediated Ca2+ release from WT and Homer 2−/− cells. Cells from (A) WT and (B) Homer 2−/− mice were permeabilized with SLO and allowed to reduce [Ca2
Gentaur molecular products has all kinds of products like :search , FabGennix \ Methyl CGP binding protein 2, WB control \ PC-Mecp2 for more molecular products just contact us
Plasmid pDONR223-HIPK3 from Dr. William Hahns lab contains the insert HIPK3 and is published in Nature. 2010 Nov 24. ():. This plasmid is available through Addgene.
多种适用的TRIM7ELISA试剂盒,如等。在antibodies-online.cn对比TRIM7ELISA试剂盒,以便找到您需要的产品。
Durica, Snežana; Korićanac, Goran; Isenović, Esma R.; Radlović, Olivera; Ribarac-Stepić, Nevena B. (Jugoslovenska Medicinska Biokemija, 1995) ...
TY - JOUR. T1 - An intrinsic gut leptin-melanocortin pathway modulates intestinal microsomal triglyceride transfer protein and lipid absorption. AU - Iqbal, Jahangir. AU - Li, Xiaosong. AU - Chang, Benny Hung Junn. AU - Chan, Lawrence. AU - Schwartz, Gary J.. AU - Chua, Streamson C.. AU - Hussain, M. Mahmood. PY - 2010/7/1. Y1 - 2010/7/1. N2 - Fat is delivered to tissues by apoB-containing lipoproteins synthesized in the liver and intestine with the help of an intracellular chaperone, microsomal triglyceride transfer protein (MTP). Leptin, a hormone secreted by adipose tissue, acts in the brain and on peripheral tissues to regulate fat storage and metabolism. Our aim was to identify the role of leptin signaling in MTP regulation and lipid absorption using several mouse models deficient in leptin receptor (LEPR) signaling and downstream effectors. Mice with spontaneous LEPR B mutations or targeted ablation of LEPR B in proopiomelanocortin (POMC) or agouti gene related peptide (AGRP) expressing ...
Rat kallikrein-binding protein is a novel serine-proteinase inhibitor that forms a covalent complex with tissue kallikrein. We have purified rat kallikrein-binding protein and cloned the cDNA and the gene encoding rat kallikrein-binding protein [Chao, Chai, Chen, Xiong, Chao, Woodley-Miller, Wang, Lu and Chao (1990) J. Biol. Chem. 265, 16394-16401; Chai, Ma, Murray, Chao and Chao (1991) J. Biol. Chem. 266, 16029-16036]. In the present study, we have expressed rat kallikrein-binding protein in Escherichia coli with a T7-polymerase/promoter expression system. A high level of expression was detected by an e.l.i.s.a. with an average of 24.2 mg of recombinant rat kallikrein-binding protein per 1 of culture. The recombinant protein appeared as a major protein in a crude extract of Escherichia coli on SDS/PAGE. It showed a molecular mass of 43 kDa and was recognized by polyclonal antibody to the native rat kallikrein-binding protein in Western-blot analysis. The recombinant rat kallikrein-binding ...
Bacterial binding protein-dependent transport systems are the best characterized members of a superfamily of transporters which are structurally, functionally, and evolutionary related to each other.
TY - CHAP. T1 - Peptidoglycan Recognition Proteins and Lysozyme. AU - Dziarski, Roman. AU - Royet, Julien. AU - Gupta, Dipika. PY - 2016/4/27. Y1 - 2016/4/27. N2 - Peptidoglycan recognition proteins (PGRPs or PGLYRPs) are evolutionarily conserved innate immunity molecules homologous to bacteriophage type 2 amidases. Mammalian PGRPs are soluble secreted proteins and bind muramyl peptide fragments of bacterial peptidoglycan. Mammalian PGLYRP1, PGLYRP3, and PGLYRP4 are directly bactericidal and kill bacteria by inducing an exaggerated envelope stress response, which causes oxidative, thiol, and metal stress, membrane depolarization, inhibition of biosynthetic reactions, and bacterial death. Mammalian PGLYRP2 is an enzyme, peptidoglycan amidohydrolase. In vivo, mammalian PGRPs maintain a healthy gut microbiome, which protects animals from experimental colitis. Mammalian PGRPs also modulate sensitivity to skin and joint inflammation and allergic asthma. Human PGRP variants are associated with ...
An absence of cholesterol ester transfer protein (CETP, protein; CETP, gene) results in an increase of the apolipoprotein AI levels and a decrease in the low density lipoprotein (LDL) levels. Thus, the CETP polymorphism is important in the assessment of risk of atherosclerosis. This study was conducted to elucidate the genotype distributions of the CETP polymorphism and association with plasma lipid levels in Koreans. The genotypes of the TaqI A and B polymorphic loci were associated with plasma triglyceride levels in the control and coronary artery disease (CAD) groups. There was linkage disequilibrium between TaqI A and B loci in the control group (χ2 = 5.58, p | 0.05). Association studies of the CETP polymorphism have been carried out mainly with Caucasian populations; however, the results have not been consistent among different populations. A possible explanation for this diversity among populations may be differences in genetic backgrounds, which may be more important than environmental factors.
Thank you for your interest in spreading the word on Circulation.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address. ...
Peptidoglycan recognition proteins (PGRPs) are pattern recognition molecules of innate immunity. In this study, a long-form PGRP, designated as gcPGRP6, was identified from grass carp Ctenopharyngodon idella. The deduced amino acid sequence of gcPGRP6 is composed of 464 residues with a conserved PGRP domain at the C-terminus. The gcPGRP6 gene consists of four exons and three introns, spacing approximately 2.7 kb of genomic sequence. Phylogenetic analysis demonstrated that gcPGRP6 is clustered closely with zebrafish PGLYRP6, and formed a long-type PGRP subfamily together with PGLYRP2 members identified in teleosts and mammals. Real-time PCR and Western blotting analyses revealed that gcPGRP6 is constitutively expressed in organs/tissues examined, and its expression was significantly induced in liver and intestine of grass carp in response to PGN stimulation and in CIK cells treated with lipoteichoic acid (LTA), polyinosinic polycytidylic acid (Poly I:C) and peptidoglycan (PGN). Immunofluorescence ...
Hollenbach, B., Schreiber, L., Hartung, W., & Dietz, K. - J. (1997). Cadmium leads to stimulated expression of the lipid transfer protein genes in barley: Implications for the involvement of lipid transfer proteins in wax assembly. Planta, 203(1), 9-19. doi:10.1007/ ...
van den Thillart, Guido, Dufour, Sylvie and Rankin, J. Cliff, eds. (2008) Spawning Migration of the European Eel. Fish & Fisheries Series, 30 . Springer Netherlands, London, UK. ISBN 978-1-4020-9095-0 (Online) Ababou, Abdessamad, Gautel, Mathias and Pfuhl, Mark (2007) Disecting the N-terminal myosin binding site of human cardiac myosin binding protein C : Structure and myosin binding of domain C2. Journal of Biological Chemistry, 282 (12). pp. 9204-9215. ISSN 00219258 Ahmed, Naveed, Tsang, Wing Y. and Page, Michael I. (2004) Acyl vs Sulfonyl Transfer in N-Acyl β-Sultams and 3-Oxo-β sultams. Organic Letters, 6 (2). pp. 201-203. ISSN 15237060 Akbar, Sirwan, Rout, Simon and Humphreys, Paul (2015) Draft Genome Sequences of Pseudomonas aeruginosa Strain PS3 and Citrobacter freundii Strain SA79 Obtained from a Wound DressingAssociated Biofilm. Genome Announcements, 3 (3). ISSN 2169-8287 Al-Nuaimi, Yusur, Hardman, Jonathan A., Bíró, Tamás, Haslam, Iain S., Philpott, Michael P., Tóth, Balázs I., ...
Science & Technology, Life Sciences & Biomedicine, Biochemistry & Molecular Biology, BIOCHEMISTRY & MOLECULAR BIOLOGY, fatty acid-binding protein, FABP, liver, intestine, FLUORESCENT-PROBE ADIFAB, HEART, TRANSPORT, LIGAND, ADIPOCYTE, EXCHANGE, VESICLES ...
How is Fatty Acid Binding protein 2 abbreviated? FABP2 stands for Fatty Acid Binding protein 2. FABP2 is defined as Fatty Acid Binding protein 2 frequently.
The SCOP classification for the Glycolipid transfer protein, GLTP superfamily including the families contained in it. Additional information provided includes InterPro annotation (if available), Functional annotation, and SUPERFAMILY links to genome assignments, alignments, domain combinations, taxonomic visualisation and hidden Markov model information.
In patients with HoFH, lomitapide led to a significant reduction of LDL-c levels and to achievement of EAS targets in many patients, while CV event rates correlated with LDL-c levels.
Previous experiments indicated that secreted (s) and membrane (m) forms of folate binding protein (FBP) are present in the intrauterine environment of the pig. Our previous studies indicated that the two forms were produced sequentially; the secreted form was present in the intrauterine glands until Day 20 of gestation, whereas binding analysis indicated that folate binding increased dramatically in placental membranes until Day 50 of gestation. However, the cell types expressing mFBP have not been investigated. In this experiment, uterine wall sections from Day 20, 35, 50, 70, 90, and 105 of gestation were collected at slaughter and fixed, and subjected to in situ hybridization analysis for mFBP expression. The mFBP mRNAwas expressed by both columnar and cuboidal epithelia of the placental folds and expression appeared to be similar throughout gestation. Therefore, the placenta expressed mFBP from Day 35 of gestation onward, consistent with the concept that sFBP and mFBP occur sequentially during
TY - JOUR. T1 - Serum concentrations of myoglobin vs human heart-type cytoplasmic fatty acid-binding protein in early detection of acute myocardial infarction. AU - Ishii, J.. AU - Wang, J.. AU - Naruse, H.. AU - Taga, S.. AU - Kinoshita, M.. AU - Kurokawa, H.. AU - Iwase, M.. AU - Kondo, T.. AU - Nomura, M.. AU - Nagamura, Y.. AU - Watanabe, Y.. AU - Hishida, H.. AU - Tanaka, T.. AU - Kawamura, K.. PY - 1997/8/19. Y1 - 1997/8/19. N2 - We compared the diagnostic utility of serum concentrations of human heart-type cytoplasmic fatty acid-binding protein (H-FABPc), myoglobin, and their ratio for the early diagnosis of acute myocardial infarction (AMI) in 104 healthy volunteers and 165 patients at admission within 6 h of the onset of chest pain. The ROC curves of the H-FABPc [0.946, 95% confidence interval (CI) = 0.913-0.979] and myoglobin (0.895, 95% CI = 0.8460.944) between patients with AMI and healthy volunteers were significantly greater than the area under the ratio of myoglobin to H-FABPc ...
The notion that CETP may be a potential target for reducing CVD originated from reports of a Japanese population of apparently healthy individuals that lacked a functional copy of the CETP gene (34,35). Compared with unaffected individuals, those who were CETP-deficient and who had no measurable CETP activity in plasma exhibited substantial increases in HDL-C (209%) and large decreases in LDL-C (44%). In individuals with heterozygous deficiency who possessed half the normal CETP activity, changes in HDL-C and LDL-C were less dramatic (+25% and −5%, respectively).. While CETP gene mutations are common in Japanese populations (49) and have clearly helped to establish the link between reduced CETP function and elevated HDL-C levels, the effect of decreased CETP activity on the development of atherosclerosis is less clear. For example, in a study of 201 patients with markedly elevated HDL-C levels (≥100 mg/dl), a subgroup of 12 patients (6%) was identified with atherosclerotic CVD. Of these, 10 ...
The endoplasmic reticulum (ER)-mitochondrial encounter structure (ERMES) physically links the membranes of the ER and mitochondria in yeast. Although the ER and mitochondria cooperate to synthesize glycerophospholipids, whether ERMES directly facilitates the lipid exchange between the two organelles remains controversial. Here, we compared the x-ray structures of an ERMES subunit Mdm12 from Kluyveromyces lactis with that of Mdm12 from Saccharomyces cerevisiae and found that both Mdm12 proteins possess a hydrophobic pocket for phospholipid binding. However in vitro lipid transfer assays showed that Mdm12 alone or an Mmm1 (another ERMES subunit) fusion protein exhibited only a weak lipid transfer activity between liposomes. In contrast, Mdm12 in a complex with Mmm1 mediated efficient lipid transfer between liposomes. Mutations in Mmm1 or Mdm12 impaired the lipid transfer activities of the Mdm12-Mmm1 complex and furthermore caused defective phosphatidylserine transport from the ER to mitochondrial ...
Order Fatty Acid Binding Protein ELISA Kits for many Reactivities. Chicken, Cow, Dog and more. Compare Fatty Acid Binding Protein ELISA Kits and find the right product on antibodies-online.com.
TXNIP is a member of the α-arrestin family that functions as an intracellular scaffold, which participates in cellular signaling by formation of signaling complexes and localization of signaling components in the cell.11,12 VEGF-VEGFR2 signaling in EC seems to be dependent on TXNIP as shown in the present study. We showed previously that TXNIP was required for VEGFR2 activation and EC survival in response to low concentrations of H2O2 and tumor necrosis factor-α.15 These data support our concept that TXNIP plays a critical role in regulating VEGFR2 signaling and angiogenesis in EC.. A novel finding of the present study is that TXNIP seems to be required for the earliest stage of VEGFR2 internalization. Receptor tyrosine kinases are regulated by endocytosis through the internalization of plasma membrane receptors.25-27 For example, the internalization of epidermal growth factor receptor is mediated by clathrin-mediated endocytosis and is essential for sustained epidermal growth factor receptor ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Herein are described two antibodies that can inhibit CETP-lipoproteins interaction and CETP activity. Presently described are an antibody or fragment thereof capable of specifically binding to an epitope of the N-terminal or C-terminal domains of CETP and methods of using these antibodies for separation, identification, diagnosis and therapy.
Outer membrane (OM) proteins 5, 6, 7, 20, 22, 37, 40, and 70 are subunits of the TOM system that transports proteins across the outer membrane. Proteins 9, 10, 12, 22 and 54 are subunits of the TIM system that mediates import of multispanning carrier proteins into the inner membrane (IM). A carrier precursor exiting the TOM channel is captured by the 70 kDa Tim9/10-complex in the intermembrane space and transferred to the 300 kDa inner membrane complex that contains Tim9p, Tim10p, Tim12p, Tim22p and Tim54p. Binding to the Tim22-complex triggers the membrane potential dependent insertion of mulitspanning carrier into the inner membrane. Inner membrane proteins 11, 17, 23 and 44 are members of, or closely adjacent to, the second TIM system (Tim17-complex)that mediates transport of precursors carrying a targeting presequence ...
Shop FERM and PDZ domain-containing protein ELISA Kit, Recombinant Protein and FERM and PDZ domain-containing protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Cell adhesion to extracellular matrix is an important physiological stimulus for organization of the actin-based cytoskeleton. Adhesion to the matrix glycoprotein Thrombospondin-1 triggers the sustained formation of F-Actin microspikes that contain the Actin-bundling protein Fascin. These structures are also implicated in cell migration, which may be an important function of Thrombospondin-1 in tissue remodeling and wound repair. Fascin bundles Actin microfilaments within dynamic cellular structures such as microspikes, stress fibers and membrane ruffles. It may serve as a prognostic factor for abnormal ovarian epithelial pathology and may be a novel target for the treatment of ovarian cancer. An Actin-bundling protein, Fascin identifies dendritic cells in the blood and in tissues.. Clone: ...
heparin-binding growth-associated molecule; osteoblastic cells; mechanical loading; mechanotransduction; signal transduction; PKC; PKA; MAPK; gene-expression; bone-cells; mc3t3-e1 osteoblasts; in-vivo; c-fos; strain; kinase; release; protein; ...