Neuropathy target esterase - Wikipedia
Neuropathy target esterase also known as patatin-like phospholipase domain-containing protein 6 (PNPLA6) is a neuropathy target esterase enzyme that in humans is encoded by the PNPLA6 gene. Neuropathy target esterase is a phospholipase that deacetylates intracellular phosphatidylcholine to produce glycerophosphocholine. It is thought to function in neurite outgrowth and process elongation during neuronal differentiation. The protein is anchored to the cytoplasmic face of the endoplasmic reticulum in both neurons and non-neuronal cells. Neuropathy target esterase is an enzyme with phospholipase B activity: It sequentially hydrolyses both fatty acids from the major membrane lipid phosphatidylcholine, which generates water-soluble glycerophosphocholine. In cells of eukaryotes from yeast to humans, NTE is anchored to the cytoplasmic face of the endoplasmic reticulum membrane and is particularly abundant in neurons, the placenta, and the kidney. Loss of NTE activity results in abnormally elevated ...
Pig Arylacetamide deacetylase like... - E07A1118-48 B-Gene - Antibo...
Product Pig Arylacetamide deacetylase like 4(AADACL4) ELISA kit From B-Gene - A competitive ELISA for quantitative measurement of Porcine Arylacetamide deacetylase like 4(AADACL4) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUTION*1 vial
12. WASH SOLUTION (100 x)*1 vial
13. BALANCE SOLUTION*1 vial
14. INSTRUCTION*1
Acyloxyacyl hydrolase - Wikipedia
In enzymology, an acyloxyacyl hydrolase (EC 3.1.1.77) is an enzyme that catalyzes the chemical reaction 3-(acyloxy)acyl group of bacterial lipopolysaccharide (lipid A moiety) ⇌ {\displaystyle \rightleftharpoons } 3-hydroxyacyl group of bacterial lipopolysaccharide + a fatty acid Hence, this enzyme has one substrate, the 3-(acyloxy)acyl groups of bacterial lipopolysaccharides, and two products, [partially deacylated lipopolysaccharide] and fatty acid. The enzyme removes from lipid A the secondary acyl chains that are needed for lipopolysaccharides to be recognized by the MD-2--TLR4 receptor on animal cells. This reaction inactivates the lipopolysaccharide (endotoxin). Acyloxyacyl hydrolase is produced by monocyte-macrophages, neutrophils, dendritic cells, and renal cortical epithelial cells. It is a protein of Mr = ~60,000 that has two disulfide-linked subunits. The smaller subunit, of Mr = ~14,000 (including glycosylation), is a member of the SAPLIP (saposin-like protein) family along with ...
Acetylcholinesterase and neuropathy target esterase inhibition...
Acetylcholinesterase and neuropathy target esterase inhibitions in neuroblastoma cells to distinguish organophosphorus compounds causing acute and delayed neuro
Retinoid - Wikipedia
The major source of retinoids from the diet are plant pigments such as carotenes and retinyl esters derived from animal sources. Retinyl esters are hydrolyzed in the intestinal lumen to yield free retinol and the corresponding fatty acid (i.e. palmitate or stearate). After hydrolysis, retinol is taken up by the enterocytes. Retinyl ester hydrolysis requires the presence of bile salts that serve to solubilize the retinyl esters in mixed micelles and to activate the hydrolyzing enzymes [3]. Several enzymes that are present in the intestinal lumen may be involved in the hydrolysis of dietary retinyl esters. Cholesterol esterase is secreted into the intestinal lumen from the pancreas and has been shown, in vitro, to display retinyl ester hydrolase activity. In addition, a retinyl ester hydrolase that is intrinsic to the brush-border membrane of the small intestine has been characterized in the rat as well as in the human. The different hydrolyzing enzymes are activated by different types of bile ...
Bacterial cocaine esterase: A protein-based therapy for cocaine overdose and addiction - Fingerprint
- Scholars @ UT...
Fingerprint Dive into the research topics of Bacterial cocaine esterase: A protein-based therapy for cocaine overdose and addiction. Together they form a unique fingerprint. ...
Hydrolysis of carbonates, thiocarbonates, carbamates, and carboxylic esters of alpha-naphthol, beta-naphthol, and p-nitrophenol...
Thirty carbonates, thiocarbonates, carbamates, and carboxylic esters of alpha-naphthol, beta-naphthol, and p-nitrophenol were synthesized and tested as substrates for liver carboxylesterases from the crude microsomal fractions of human and mouse, and purified isozymes, hydrolases A and B, from rat l …
How many words can made out of Pectinesterase | Anagram Solver
List of words make out of Pectinesterase. Anagrams and Words made out of Pectinesterase. Find Scrabble Point of Pectinesterase. Definition of Pectinesterase. Puzzle Solver.
Human and Rodent Carboxylesterases: Immunorelatedness, Overlapping Substrate Specificity, Differential Sensitivity to Serine...
Carboxylesterases hydrolyze numerous endogenous and foreign compounds with diverse structures. Humans and rodents express multiple forms of carboxylesterases, which share a high degree of sequence identity (∼70%). Alignment analyses locate in carboxylesterases several functional subsites such the catalytic triad as seen in acetylcholinesterase. The aim of this study was to determine among human and rodent carboxylesterases the immunorelatedness, overlapping substrate specificity, differential sensitivity to serine enzyme inhibitors, tissue distribution, and tumor-related expression. Six antibodies against whole carboxylesterases or synthetic peptides were tested for their reactivity toward 11 human or rodent recombinant carboxylesterases. The antibodies against whole proteins generally exhibited a broader cross-reactivity than the anti-peptide antibodies. All carboxylesterases hydrolyzed para-nitrophenylacetate and para-nitrophenylbutyrate. However, the relative activity varied markedly from ...
Rv1984c - Probable cutinase Rv1984c precursor - Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) - Rv1984c gene & protein
cell wall, extracellular region, acylglycerol lipase activity, carboxylic ester hydrolase activity, short-chain carboxylesterase activity, medium-chain fatty acid catabolic process, monoacylglycerol catabolic process, short-chain fatty acid catabolic process
Search of multiple hot spots on the surface of peptidyl-tRNA hydrolase: structural, binding and antibacterial studies |...
Peptidyl-tRNA hydrolase (Pth) catalyzes the breakdown of peptidyl-tRNA into peptide and tRNA components. Pth from Acinetobacter baumannii (AbPth) was cloned, expressed, purified and crystallized in a native unbound (AbPth-N) state and in a bound state with the phosphate ion and cytosine arabinoside (cytarabine) (AbPth-C). Structures of AbPth-N and AbPth-C were determined at 1.36 and 1.10 Å resolutions, respectively. The structure of AbPth-N showed that the active site is filled with water molecules. In the structure of AbPth-C, a phosphate ion is present in the active site, while cytarabine is bound in a cleft which is located away from the catalytic site. The cytarabine-binding site is formed with residues: Gln19, Trp27, Glu30, Gln31, Lys152, Gln158 and Asp162. In the structure of AbPth-N, the side chains of two active-site residues, Asn70 and Asn116, were observed in two conformations. Upon binding of the phosphate ion in the active site, the side chains of both residues were ordered to ...
Peptidyl-tRNA Hydrolase 2 - CAGS
The Peptidyl-tRNA Hydrolase 2 (PTRH2) gene codes for a highly conserved mitochondrial protein. This protein prevents the accumulation of dissociated peptidyl-tRNA, and plays an important role in regulating cell survival and death. It promotes cell survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix (ECM), through interaction with focal adhesion kinase (FAK) and subsequent activation of the PI3K-AKT-NFkB pathway. It also induces Bcl-2 transcription that blocks the intrinsic mitochondrial apoptotic pathway. PTRH2 functions as a phosphoprotein that regulates NFkB and ERK signaling. In cells that have lost their attachment to the ECM through anoikos, PTRH2 promotes apoptosis. Upon loss of integrin-mediated cell attachment to the ECM, PTRH2 protein is phosphorylated, is released from the mitochondria into the cytosol, and promotes apoptosis through interactions with transcriptional regulator amino-terminal enhancer of split (AES). Defects in this protein ...
Feruloyl esterase elisa and antibody
Shop Feruloyl esterase ELISA Kit, Recombinant Protein and Feruloyl esterase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Plasmodium falciparum glucose-6-phosphate dehydrogenase 6-phosphogluconolactonase is a potential drug target - The University...
Plasmodium falciparum glucose-6-phosphate dehydrogenase 6-phosphogluconolactonase is a potential drug target Journal Articles Refereed ...
Plus it
Carboxylesterases play an important role in the metabolism of endogenous compounds and exogenous substances such as drugs (including prodrugs), pesticides, and herbicides. Carboxylesterases are widely distributed in the microsomes of the several tissues such as liver, kidney, brain, and lung, where they are loosely bound to the luminal surface of the ER. The highest concentration of carboxylesterases is found in the liver microsomes (Morgan et al., 1994). Furthermore, it has been reported that secretory form such as serum carboxylesterase is highly expressed in rodent (Yan et al., 1995b). Therefore, the in vivo hydrolysis of drug containing ester moiety depends on hydrolase activity in the tissues as well as the blood.. Taking into account the drug disposition after administration, hydrophilic drugs are mainly distributed to the systemic blood circulation, whereas hydrophobic drugs distribute in several tissues. The hydrophobicity and basicity of butyryl-PL strongly suggest that butyryl-PL is ...
Western CEDAR - Scholars Week: Pectin methyl esterase activity on ethylene exposed pistils
Copying of this document in whole or in part is allowable only for scholarly purposes. It is understood, however, that any copying or publication of this documentation for commercial purposes, or for financial gain, shall not be allowed without the authors written permission.. ...
CES5A - Carboxylic ester hydrolase - Homo sapiens (Human) - CES5A gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
EMBL: CP001825.PE410
CP001825.PE410 Location/Qualifiers FT CDS_pept complement(441864..442601) FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Tter_0412 FT /product=6-phosphogluconolactonase FT /note=TIGRFAM: 6-phosphogluconolactonase; PFAM: FT glucosamine/galactosamine-6-phosphate isomerase; KEGG: FT dvu:DVU2313 6-phosphogluconolactonase FT /db_xref=EnsemblGenomes-Gn:Tter_0412 FT /db_xref=EnsemblGenomes-Tr:ACZ41334 FT /db_xref=GOA:D1CEH8 FT /db_xref=InterPro:IPR005900 FT /db_xref=InterPro:IPR006148 FT /db_xref=InterPro:IPR037171 FT /db_xref=InterPro:IPR039104 FT /db_xref=UniProtKB/TrEMBL:D1CEH8 FT /inference=protein motif:TFAM:TIGR01198 FT /protein_id=ACZ41334.1 FT /translation=MAGKLSIVENSSEVARAGAEQFISRAKESIDDHGSFFVALSGGST FT PVAMYKLLASDEYRGKVDWDKVLFFWSDERCVPPDHPDSNYGSAHQHLLQPLGITEDRV FT FRMKGELPPEEAAREYEEIVKKAVPGDPPRFDLIFLGLGDDAHTASLFPETDALHVTDR FT LVVHNYVPKLNTYRITFTSTLINAAASVVFLVSGEGKAEALKSVLEGEQNPTKYPAQMV FT NPTSGALLWVVDRAAASLLSGTQ atggcaggaa agttatcgat tgtagaaaat tcctccgagg ...
Connection | Profiles RNS
Binding Sites; Carboxylic Ester Hydrolases; Cell Adhesion; DNA; Esterases; Extracellular Matrix; Fusarium; Ligands; Models, Molecular; Peptides; Protein Binding; Protein Conformation; Protein Structure, Tertiary; Proteins; Recombinant Fusion Proteins; Surface Plasmon Resonance ...
Combining Substrate Specificity Analysis with Support Vector Classifiers Reveals Feruloyl Esterase as a Phylogenetically...
Background: Our understanding of how fungi evolved to develop a variety of ecological niches, is limited but of fundamental biological importance. Specifically, the evolution of enzymes affects how well species can adapt to new environmental conditions. Feruloyl esterases (FAEs) are enzymes able to hydrolyze the ester bonds linking ferulic acid to plant cell wall polysaccharides. The diversity of substrate specificities found in the FAE family shows that this family is old enough to have experienced the emergence and loss of many activities. Methodology/Principal Findings: In this study we evaluate the relative activity of FAEs against a variety of model substrates as a novel predictive tool for Ascomycota taxonomic classification. Our approach consists of two analytical steps; (1) an initial unsupervised analysis to cluster the FAEs substrate specificity data which were generated by cultivation of 34 Ascomycota strains and then an analysis of the produced enzyme cocktail against 10 substituted
Descriptor-based computational analysis reveals a novel classification scheme for feruloyl esterase enzyme families
Background One of the most intriguing groups of enzymes, the feruloyl esterases (FAEs), is ubiquitous in both simple and complex organisms. FAEs have gained importance in biofuel, medicine and food industries due to their capability of acting on a large range of substrates for cleaving ester bonds and synthesizing high-added value molecules through esterification and transesterification reactions. During the past two decades extensive studies have been carried out on the production and partial characterization of FAEs from fungi, while much less is known about FAEs of bacterial or plant origin. Initial classification studies on FAEs were restricted on sequence similarity and substrate specificity on just four model substrates and considered only a handful of FAEs belonging to the fungal kingdom. Results Our study centers on the descriptor-based classification and structural analysis of experimentally verified and putative FAEs. 365 FAE-related sequences of fungal, bacterial and plantae origin were
Abhd11 Polyclonal Antibody, HRP Conjugated | EpiGentek
Background mitochondrion, carboxylic ester hydrolase activity Description Abhd11 Polyclonal Antibody, HRP Conjugated. HRP. Raised in Rabbit. Formulation Liquid. 0.03% Proclin 300. 50% Glycerol, 0.01M PBS, PH 7.4. Specificity...
Plus end-specific depolymerase activity of Kip3, a kinesin-8 protein, explains its role in positioning the yeast mitotic...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Arylacetamide deacetylase-like 4
Build: Wed Jun 21 18:33:50 EDT 2017 (commit: 4a3b2dc). National Center for Advancing Translational Sciences (NCATS), 6701 Democracy Boulevard, Bethesda MD 20892-4874 • 301-435-0888. ...
6-phosphogluconolactonase
Build: Wed Jun 21 18:33:50 EDT 2017 (commit: 4a3b2dc). National Center for Advancing Translational Sciences (NCATS), 6701 Democracy Boulevard, Bethesda MD 20892-4874 • 301-435-0888. ...
Methylesterase elisa and antibody
Shop Methylesterase ELISA Kit, Recombinant Protein and Methylesterase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
B14. Advances in plant biochemistry. Lectures L27.1 L27.2. Mechanisms of chlorophyllase regulation - PDF
B14. Advances in plant biochemistry Lectures L27.1 Polyisoprenoids secondary metabolites or physiologically important superlipids? Liliana Surmacz, Ewa Swiezewska Institute of Biochemistry and Biophysics,
Feruloyl Esterase Protocols - OpenWetWare
Donaghy et al. (1998) added the ethyl ferulate solution directly to the media immediately before pouring the plates, and used a final concentration of 2mg/mL while Hassan and Pattat (2011) added it to the top agar at a stated concentration of 0.05mg/ml. Weve found that the hassan and pattat concentration is way too low to make the agar cloudy but 1mg/ml can work well in a pinch. -- ...
Difference between revisions of Feruloyl Esterase Protocols - OpenWetWare
Donaghy et al. (1998) added the ethyl ferulate solution directly to the media plates at a final concentration of 2mg/mL while Hassan and Pattat (2011) added it to the top agar at a stated concentration of 0.05mg/ml. Weve found that the hassan and pattat concentration is way too low to make the agar cloudy but 1mg/ml can work well in a pinch. -- ...
Search Results
From Prosite: Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH) is a bacterial enzyme that cleaves peptidyl-tRNA or N-acyl-aminoacyl-tRNA to yield free peptides or N-acyl-amino acids and tRNA. The natural substrate for this enzyme may be peptidyl-tRNA which drop off the ribosome during protein synthesis ...
RCSB PDB
- 1FDK: CARBOXYLIC ESTER HYDROLASE (PLA2-MJ33 INHIBITOR COMPLEX) Literature Report Page
1FDK: Crystal structure of the complex of bovine pancreatic phospholipase A2 with the inhibitor 1-hexadecyl-3-(trifluoroethyl)-sn-glycero-2-phosphomethanol,.
Plus it
In this study, we provided insights into how PMEI modulates the activity of PME through the formation of the PME-PMEI complex. We chose GhPMEI3 as a possible pathogen resistance-associated PMEI, and GhPME2 and GhPME31 as representatives of two different types of PMEs. The alignment of the GhPMEI3 sequence with sequences of functionally characterized PMEIs showed that GhPMEI3 has two INH sequences (Fig. 1). The structure of an INH from tobacco (Nt-CIF) has been previously elucidated (Hothorn et al., 2004a). KwPMEI and Nt-CIF are strikingly similar from a structural point of view, but recognize different target enzymes, as key amino acids that are involved in the formation of intermolecular H-bonds with PMEs are only conserved in PMEIs. Therefore, the structural view of the PMEI-PME complex provided insights into the specific binding between GhPMEI3 and GhPME2/ GhPME31. Since the highly conserved INHs lack the PKF motif in the α3 helix, GhPMEI3 may be unable to participate in interactions with ...
Sevilla (España-Spain) | Esta serie de fotos de Sevilla está… | Flickr
Esta serie de fotos de Sevilla está dedicada a todos mis hermanos (Leo,Rubén y Manu) y a mis amigos: Andrea Niederfriniger,Conchi y Adrián González Da Sousa.Con ellos, he disfrutado,conocido,amado a esta gran ciudad que SIEMPRE estará en mí.
Un saludo
PD:Todas las fotos agrupadas en esta serie, están hechas en los puentes y vacaciones que me he pasado en Sevilla, algunas ya están en la galería
CS4385-CQZ | CS4385-CQZ, Audio Converter DAC Octal 24 bit-, 216ksps Serial, 48-Pin LQFP | RS Components
...
Buy CS4385-CQZ, Audio Converter DAC Octal 24 bit-, 216ksps Serial, 48-Pin LQFP CS4385-CQZ. Browse our latest Audio DACs offers. Free Next Day Delivery available.
How Long Does it Take For ESTA to Be Approved? | Our Experience
Yesterday we were travelling but forgot to apply for our ESTA, so we had to submit a last minute application. How long does it take for an ESTA to be approved?
On your marks, get set, ESTA! | The one minute dash to the US
The United States living up to its reputation as an open, welcoming country, has several Visa Waiver Programs (VWP), the most popular of which is the ESTA.
BIT-1129] RADIUS Protocol Analyzer - Bro Tracker
For the attribute list - its a vector because technically you could have multiple entries of the same attribute type. The only place this seems to happen in the real world is for the vendor-specific type. I have some code that would deal with those types, but it requires some further work (and that wont be a base script). Im not sure what to do in the case that other attribute types (e.g. username, calling station id, etc.) are present multiple times. Its not a violation of the RFC, so perhaps just a weird? ...
PME Services SA (Pty) Ltd - Airless Spraying
PME Services (Pty) Ltd, 083 707 7487, To exceed our customers expectations in quality, delivery, and cost through continual improvement and customer interaction.
CV: Esta Nahkur
Eesti Teadusinfosüsteem koondab informatsiooni teadus- ja arendusasutuste, teadlaste, teadusprojektide ning erinevate teadustegevuste tulemuste kohta.
Noticias
Somos la primer asociación de esta especialidad en México. Avalamos diversos cursos y programas de entrenamiento en Ozonoterapia para médicos.
FLUIDOTERAPIA EN BOVINOS PDF
FLUIDOTERAPIA EN BOVINOS PDF - FLUIDOTERAPIA. Inicio FLUIDOTERAPIA. Banner Left Column. En estos momentos no hay productos en esta categoría. ¡No te pierdas nuestras ofertas!. ◦Bovinos
Direcciones IP Clase B
Direcciones IP Clase B Esta clase de redessonutilizadasenmedianasempresascomouniversidadese instituciones gubernamentales.Surangovadesde 128.0.0.0 hasta 191.0.…
Wont get fooled again
Fueron dos días memorables, con música, esta vez si, de todos los estilos. Del punk a la electrónica, del rock clásico al urbano ...
Browsing by Author Pacheco, M.
Bohorova, N.E.; Zhang, W.; Julstrom, P.; McLean, S.D.; Luna, B.; Brito, R.M.; Díaz, L.; Ramos, M.E.; Estañol, P.; Pacheco, M.; Salgado, M.; Hoisington, D.A. (1999) ...
Hsin-Chieh Yeh.
Shows the %age of participants who met specific weight-transformation thresholds 6 and 24 months after randomization. At two years, the %age of participants in
Role of geraniol against lead acetate-mediated hepatic damage and their interaction with liver carboxylesterase activity in...
In this study, the effect of geraniol (50 mg/kg for 30 d), a natural antioxidant and repellent/antifeedant monoterpene, in a rat model of lead acetate-induced (500 ppm for 30 d) liver damage was evaluated. Hepatic malondialdehyde increased in the lead acetate group. Reduced glutathione unchanged, but glutathione S-transferase, glutathione reductase, as well as carboxylesterase activities decreased in geraniol, lead acetate and geraniol+lead acetate groups. 8-OhDG immunoreactivity, mononuclear cell infiltrations and hepatic lead concentration were lower in the geraniol+lead acetate group than the lead acetate group. Serum aspartate aminotransferase and alanine aminotransferase activities increased in the Pb acetate group. In conclusion, lead acetate causes oxidative and toxic damage in the liver and this effect can reduce with geraniol treatment. However, we first observed that lead acetate, as well as geraniol, can affect liver carboxylesterase activity. ...
Hydrolysis of capecitabine to 5′-deoxy-5-fluorocytidine by human carboxylesterases and inhibition by loperamide<...
TY - JOUR. T1 - Hydrolysis of capecitabine to 5′-deoxy-5-fluorocytidine by human carboxylesterases and inhibition by loperamide. AU - Quinney, S. K.. AU - Sanghani, S. P.. AU - Davis, W. I.. AU - Hurley, T. D.. AU - Sun, Z.. AU - Murry, D. J.. AU - Bosron, William F.. PY - 2005/6/1. Y1 - 2005/6/1. N2 - Capecitabine is an oral prodrug of 5-fluorouracil that is indicated for the treatment of breast and colorectal cancers. A three-step in vivo-targeted activation process requiring carboxylesterases, cytidine deaminase, and thymidine phosphorylase converts capecitabine to 5-fluorouracil. Carboxylesterases hydrolyze capecitabines carbamate side chain to form 5′-deoxy-5-fluorocytidine (5′-DFCR). This study examines the steady-state kinetics of recombinant human carboxylesterase isozymes carboxylesterase (CES) 1A1, CES2, and CES3 for hydrolysis of capecitabine with a liquid chromatography/mass spectroscopy assay. Additionally, a spectrophotometric screening assay was utilized to identify drugs ...
DIGITAL.CSIC: Pectin methyl esterases and pectins in normal and hyperhydric shoots of carnation cultured in vitro.
Control and hyperhydric micropropagated plantlets from three carnation cultivars have been used to study their pectin composition and the activity of pectin methyl esterases (PMEs; EC 3.1.1.11). Pectins are a highly heterogeneous group of polymers that contribute to cell adhesion, cell wall architecture, and cell wall mechanical strength. Pectins control cell wall porosity and cell wall ionic status and are implicated in intercellular space development. The degree of esterification of pectins is controlled by the activity of cell wall PMEs; their different actions can affect the properties of the cell wall, which have been considered important with respect to controlling the development of hyperhydricity. The total pectins of hyperhydric leaves of the three varieties were significantly reduced in comparison with controls. The pectate fraction was significantly increased in hyperhydric leaves of all varieties while soluble pectins and protopectins were significantly lower. The PME activity of ...
PECTIN METHYLESTERASE INHIBITOR6 Promotes Arabidopsis Mucilage Release by Limiting Methylesterification of Homogalacturonan in...
During seed coat formation, the developing seeds of myxospermous species, such as Arabidopsis thaliana, accumulate polysaccharides in the apoplast of epidermal cells. When mature seeds are imbibed, the rehydrated polysaccharides expand and rupture the outer cell wall, and the released polysaccharides then encapsulate the seed as viscous mucilage. The functional role of this mucilage remains unclear, as Arabidopsis seeds without mucilage are viable and germinate under laboratory conditions. Certain reduced mucilage mutants have, however, been found to have delayed germination or increased sensitivity to low water potential compared with wild-type seeds (Penfield et al., 2001; Arsovski et al., 2009a). Diverse physiological roles have been proposed; for example, the adhesive properties of mucilage could glue seeds to animals for dispersion, or to soil particles, thereby impeding predation by ants or retaining seeds in a favorable environment (Young and Evans, 1973; García-Fayos et al., 2010; ...
Mutations that affect control of the methylesterase activity of CheB, a component of the chemotaxis adaptation system in...
Sensory adaptation by the chemotaxis system of Escherichia coli requires adjustments of the extent of methyl esterification of the chemotaxis receptor proteins. One mechanism utilized by E. coli to make such adjustments is to control the activity of CheB, the enzyme responsible for removing receptor methyl ester groups. Previous work has established the existence of a multicomponent signal transduction pathway that enables the chemotaxis receptor proteins to control the methylesterase activity in response to chemotactic stimuli. We isolated and characterized CheB mutants that do not respond normally to this control mechanism. In intact cells these CheB variants could not be activated in response to negative chemotaxis stimuli. Further characterization indicated that these CheB variants could not be phosphorylated by the chemotaxis protein kinase CheA. Disruption of the mechanism responsible for regulating methylesterase activity was also observed in cells carrying chromosomal deletions of either cheA or
Subject: recombinant DNA / Journal: New biotechnology / Publication Year: 2011 / Subject: carboxylic ester hydrolases and...
The yeast Yarrowia lipolytica degrades efficiently low-cost hydrophobic substrates for the production of various added-value products such as lipases. To obtain yeast strains producing high levels of extracellular lipase, Y. lipolytica DSM3286 was subjected to mutation using ethyl methanesulfonate (EMS) and ultraviolet (UV) light. Twenty mutants were selected out of 1600 mutants of Y. lipolytica t ...
Carboxyl Ester Lipase/CEL Antibodies: Novus Biologicals
Carboxyl Ester Lipase/CEL Antibodies available through Novus Biologicals. Browse our Carboxyl Ester Lipase/CEL Antibody catalog backed by our Guarantee+.
EC 3.1
Contents. EC 3.1.1 Carboxylic Ester Hydrolases. EC 3.1.2 Thioester Hydrolases. EC 3.1.3 Phosphoric Monoester Hydrolases. EC 3.1.4 Phosphoric Diester Hydrolases. EC 3.1.5 Triphosphoric Monoester Hydrolases. EC 3.1.6 Sulfuric Ester Hydrolases. EC 3.1.7 Diphosphoric Monoester Hydrolases. EC 3.1.8 Phosphoric Triester Hydrolases. EC 3.1.11 Exodeoxyribonucleases Producing 5-Phosphomonoesters. EC 3.1.12 Exodeoxyribonucleases Producing 3-Phosphomonoesters. EC 3.1.13 Exoribonucleases Producing 5-Phosphomonoesters. EC 3.1.14 Exoribonucleases Producing 3-Phosphomonoesters. EC 3.1.15 Exonucleases Active with either Ribo- or Deoxyribonucleic Acids and Producing 5-Phosphomonoesters. EC 3.1.16 Exonucleases Active with either Ribo- or Deoxyribonucleic Acids and Producing 3-Phosphomonoesters. EC 3.1.21 Endodeoxyribonucleases Producing 5-Phosphomonoesters. EC 3.1.22 Endodeoxyribonucleases Producing 3-Phosphomonoesters. EC 3.1.23 Site Specific Endodeoxyribonucleases: Cleavage is Sequence Specific ...
Identification and comparison of cutinases for synthetic polyester degradation<...
TY - JOUR. T1 - Identification and comparison of cutinases for synthetic polyester degradation. AU - Baker, Peter James. AU - Poultney, Christopher. AU - Liu, Zhiqiang. AU - Gross, Richard. AU - Montclare, Jin. PY - 2012/1. Y1 - 2012/1. N2 - Cutinases have been exploited for a broad range of reactions, from hydrolysis of soluble and insoluble esters to polymer synthesis. To further expand the biotechnological applications of cutinases for synthetic polyester degradation, we perform a comparative activity and stability analysis of five cutinases from Alternaria brassicicola (AbC), Aspergillus fumigatus (AfC), Aspergillus oryzae (AoC), Humicola insolens (HiC), and the well-characterized Fusarium solani (FsC). Of the cutinases, HiC demonstrated enhanced poly(ε-caprolactone) hydrolysis at high temperatures and under all pH values, followed by AoC and AfC. Both AbC and FsC are least stable and function poorly at high temperatures as well as at acidic pH conditions. Surface charge calculations and ...
Purification and biochemical characterization of feruloyl esterases from Aspergillus terreus MTCC 11096
Aspergillus terreus MTCC 11096 isolated from the soils of agricultural fields cultivating sweet sorghum was previously identified to produce feruloyl esterases (FAEs). The enzymes responsible for feruloyl esterase activity were purified to homogeneity and named as AtFAE-1, AtFAE-2, and AtFAE-3. The …
Bn PME is progressively induced after microspore reprogramming to embryogenesis, correlating with pectin de-esterification and...
Pectins are one of the main components of plant cell walls. They are secreted to the wall as highly methylesterified forms that can be de-esterified by pectin methylesterases (PMEs). The degree of methylesterification of pectins changes during development, PMEs are involved in the cell wall remodeling that occurs during diverse plant developmental processes. Nevertheless, the functional meaning of pectin-related wall remodeling in different cell types and processes remains unclear. In vivo, the microspore follows the gametophytic pathway and differentiates to form the pollen grain. In vitro, the microspore can be reprogrammed by stress treatments becoming a totipotent cell that starts to proliferate and follows the embryogenic pathway, a process known as microspore embryogenesis. To investigate if the change of developmental programme of the microspore towards embryogenesis involves changes in pectin esterification levels, which would cause the cell wall remodeling during the process, in the present
Plant pectin acetylesterase structure and function: new insights from bioinformatic analysis | BMC Genomics | Full Text
The primary structure of AtPAEs revealed that they are unlikely to be membrane proteins and that most isoforms have a basic pI, as suggested in the early literature [17]. However, the predicted GPI anchor for AtPAE10 and AtPAE12, both from clade 2, could indicate a putative role in plant signaling and some interaction with the plasma membrane. The presence of such a predicted GPI anchor has been observed in other pectin-related genes, including PMEI [55]. The absence of a predicted signaling sequence for three AtPAEs, AtPAE2, AtPAE4 and AtPAE5, indicates that some Arabidopsis PAEs without a signal peptide could have a functional activity. Similar results have been observed with several PMEs from distinct plant species and particularly for AtPME31, which has no signaling sequence but is active and cannot be inhibited by the kiwi pectin methylesterase inhibitor, a strong PME inhibitor [56]. 3D homology modeling of AtPME31 revealed an external loop. The function and the mechanism by which AtPME31 ...
Plus it
Flutamide, an antiandrogen drug, is widely used for the treatment of prostate cancer. The major metabolic pathways of flutamide are hydroxylation and hydrolysis. The hydrolyzed metabolite, 5-amino-2-nitrobenzotrifluoride (FLU-1), is further metabolized to N-hydroxy FLU-1, an assumed hepatotoxicant. Our previous study demonstrated that arylacetamide deacetylase (AADAC), one of the major serine esterases expressed in the human liver and gastrointestinal tract, catalyzes the flutamide hydrolysis. However, the enzyme kinetics in human tissue microsomes were not consistent with the kinetics by recombinant human AADAC. Thus, it seemed that AADAC is not the sole enzyme responsible for flutamide hydrolysis in human. In the present study, we found that recombinant carboxylesterase (CES) 2 could hydrolyze flutamide at low concentrations of flutamide. In the inhibition assay, the flutamide hydrolase activities at a flutamide concentration of 5 μM in human liver and jejunum microsomes were strongly ...
PlantPromoterDB promoter information of AT4G33220
enzyme inhibitor/ pectinesterase; FUNCTIONS IN: enzyme inhibitor activity, pectinesterase activity; INVOLVED IN: cell wall modification; LOCATED IN: endomembrane system, cell wall, plant-type cell wall; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Pectinesterase, active site (InterPro:IPR018040), Pectin lyase fold/virulence factor (InterPro:IPR011050), Pectinesterase inhibitor (InterPro:IPR006501), Pectinesterase, catalytic (InterPro:IPR000070), Pectin lyase fold (InterPro:IPR012334); BEST Arabidopsis thaliana protein match is: pectinesterase family protein (TAIR:AT3G43270.1); Has 1247 Blast hits to 1216 proteins in 178 species: Archae - 0; Bacteria - 249; Metazoa - 1; Fungi - 131; Plants - 866; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink ...
Repositorio da Producao Cientifica e Intelectual da Unicamp: Thermal inactivation of pectinesterase in papaya pulp (pH 3.8)
In order to establish the thermal process required by acified papaya pulp (pH 3.8) var formosa, a study was carried out on the kinetics of thermal inactivation of the heat resistant enzymes present in the pulp. Since no peroxidase activity was detected, the study was focused on pectinesterase. The heat inactivation curves at 75, 77 and 80C showed a change in slope indicating the presence of two different portions of the enzyme, one heat labile and the other hear resistant. The decimal reduction limes (D value) of pectinesterase were 0.8, 0.3 and 0.2 min for the heat labile portion and for the heat resistant portion 16.7, 7.2 and 3.7 min, respectively. The temperature-dependency factor for the heat labile portion was 9.2C and 7.8C for the thermostable portion, while the activation energies were 258.3 and 304.4 Kj/mol. These values were within the range of 167.5-418.7 Kj/mol reported in the literature for the thermal inactivation of enzymes. Thermal destruction studies with Clostridium ...
Immobilization of lipase from Fusarium solani FS1
Lipase de Fusarium solani FS1 foi imobilizada por ligação covalente usando esferas de poliacrilamida e Dacron magnetizado, retendo 12%, e 97% de atividade, respectivamente. A lipase foi também enclausurada em esferas de poliacrilamida e reteve 53% de sua atividade específica. Investigações sobre...
Cocaine esterase - AdisInsight
Indivior (formerly Reckitt Benckiser Pharmaceuticals) is developing RBP 8000 as an intravenous antidote for cocaine toxicity. RBP 8000 is a cocaine esterase
The Synthetic Potential of Fungal Feruloyl Esterases : A Correlation with Current Classification Systems and Predicted...
Twenty-eight fungal feruloyl esterases (FAEs) were evaluated for their synthetic abilities in a ternary system of n-hexane: t-butanol: 100 mM MOPS-NaOH pH 6.0 forming detergentless microemulsions. Five main derivatives were synthesized, namely prenyl ferulate, prenyl caffeate, butyl ferulate, glyceryl ferulate, and l-arabinose ferulate, offering, in general, higher yields when more hydrophilic alcohol substitutions were used. Acetyl xylan esterase-related FAEs belonging to phylogenetic subfamilies (SF) 5 and 6 showed increased synthetic yields among tested enzymes. In particular, it was shown that FAEs belonging to SF6 generally transesterified aliphatic alcohols more efficiently while SF5 members preferred bulkier l-arabinose. Predicted surface properties and structural characteristics were correlated with the synthetic potential of selected tannase-related, acetyl-xylan-related, and lipase-related FAEs (SF1-2, -6, -7 members) based on homology modeling and small molecular docking simulations ...
Chlorophyllase Is a Rate-Limiting Enzyme in Chlorophyll Catabolism and Is Posttranslationally Regulated | Plant Cell
In this study, we exploited two different expression systems in two distant plant species to address pivotal questions concerning the role and regulation of Chlase in chlorophyll catabolism. Although the EST database suggests that most plants contain more than one Chlase homolog, we chose to conduct this study using the Chlase1 gene from citrus (Jacob-Wilk et al., 1999) because (1) it is the only Chlase gene encoding an enzyme experimentally shown to be localized to the chloroplast (Trebitsh et al., 1993; Jacob-Wilk et al., 1999) and (2) it is one of only two Chlases for which the processing site of the mature protein was experimentally determined (Jacob-Wilk et al., 1999; Tsuchiya et al., 1999). The citrus Chlase1 gene was overexpressed in two systems: (1) a ZYMV-based viral vector expression system that efficiently expressed citrus Chlase versions in squash plants for at least 21 d, which was more than sufficient time to study the physiological effects of Chlase expression in plants; and (2) a ...
COMPOUNDS, A PROCESS FOR THEIR PREPARATION AND THEIR USE AS DYES AND PIGMENTS - CIBA SC HOLDING AG
Compounds of formula (1) wherein R|sub|1|/sub| is hydrogen, hydroxy, halogen, nitro, cyano, amino, carboxy, carboxylic ester, sulfo, sulfonic ester, carboxylic amide, sulfonic amide, alkoxy, aryloxy, alkylthio or arylthio, X is -0-, -S-, -NH- or -N(alkyl)-, Y is hydrogen or carboxylic ester, Z is =C- or =N-, T is =C- or =N-, R|sub|2|/sub| is hydrogen, alkyl or CN, n is 0 or 1, when Z is =N- then n is 0, m is 0 or 1, when T is =N- then m is 0, A is a heterocyclic or linear or polycondensed aromatic group which is unsubstituted or substituted by hydroxy alkyl, halogen, nitro, cyano, amino, acylarnino, carboxylic ester, sulfonic ester, carboxylic amide, sulfonic amide, alkoxy, aryloxy, alkylthio, arylthio or phenyl, or A together with T and R|sub|2|/sub| can form an allycyclic or heterocyclic ring, their preparation and their use in the production of coloured plastics or polymeric colour particles.
PlantPromoterDB promoter information of AT5G47500
pectinesterase family protein; FUNCTIONS IN: pectinesterase activity; INVOLVED IN: cell wall modification; LOCATED IN: endomembrane system, cell wall, plant-type cell wall; EXPRESSED IN: 18 plant structures; EXPRESSED DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s: Pectinesterase, active site (InterPro:IPR018040), Pectin lyase fold/virulence factor (InterPro:IPR011050), Pectinesterase, catalytic (InterPro:IPR000070), Pectin lyase fold (InterPro:IPR012334); BEST Arabidopsis thaliana protein match is: pectinesterase family protein (TAIR:AT5G19730.1); Has 1217 Blast hits to 1190 proteins in 176 species: Archae - 0; Bacteria - 260; Metazoa - 1; Fungi - 128; Plants - 828; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink ...
YRC Public Data Repository - Gene Ontology - phosphoric ester hydrolase activity
The YRC PDR provides for the searching of millions of protein descriptions from many databases to find proteins and public experimental data describing those proteins produced by the YRC. The experimental data is in the form of mass spectrometry, yeast two-hybrid, protein structure prediction, light microscopy and protein complex predictions.
Liver carboxylesterase 1 | DrugBank Online
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, ...
Center for Theoretical & Mathematical Sciences » People
Abdomen • Abscisic Acid • Acetaminophen • Acetylcholinesterase • Actins • Action Potentials • Adaptation, Biological • Adaptation, Physiological • Adaptor Proteins, Signal Transducing • Adenosine • Adolescent • Adult • Aedes • Aging • Algorithms • Alleles • Allosteric Regulation • Allosteric Site • Amaranth Dye • Analysis of Variance • Animal Nutritional Physiological Phenomena • Animals • Anopheles • Anti-Inflammatory Agents, Non-Steroidal • Antidepressive Agents • Antioxidants • Ants • Arsenic • Autistic Disorder • Autoreceptors • Bangladesh • Bees • Beetles • Behavior, Animal • Betaine • Biochemistry • Biological Evolution • Biological Markers • Biological Transport • Biomass • Biometry • Body Constitution • Body Patterning • Body Size • Body Weight • Body Weights and Measures • Brain • Butterflies • Caenorhabditis elegans Proteins • Carbohydrates • Carbon • Carboxylic Ester Hydrolases • ...
Baboon carboxylesterases 1 and 2: Sequences, structures and phylogenetic relationships with human and other primate...
TY - JOUR. T1 - Baboon carboxylesterases 1 and 2. T2 - Sequences, structures and phylogenetic relationships with human and other primate carboxylesterases. AU - Holmes, Roger S.. AU - Glenn, Jeremy P.. AU - Vandeberg, John L.. AU - Cox, Laura A.. PY - 2009. Y1 - 2009. N2 - Background: Carboxylesterase (CES) is predominantly responsible for the detoxification of a wide range of drugs and narcotics, and catalyze several reactions in cholesterol and fatty acid metabolism. Studies of the genetic and biochemical properties of primate CES may contribute to an improved understanding of human disease, including atherosclerosis, obesity and drug addiction, for which non-human primates serve as useful animal models. Methods: We cloned and sequenced baboon CES1 and CES2 and used in vitro and in silico methods to predict protein secondary and tertiary structures, and examined evolutionary relationships for these enzymes with other primate and mouse CES orthologs. Results and Conclusions: We found that ...
Acyl transferase/acyl hydrolase/lysophospholipase (IPR016035) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Ferulic Acid Release and 4-Vinylguaiacol Formation during Brewing and Fermentation: Indications for Feruloyl Esterase Activity...
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
THP-1 | Creative Bioarray
This cell line was derived from the peripheral blood of a 1 year old male with acute monocytic leukaemia. THP-1 cells show alpha-naphtyl butyrate esterase activity, phagocytose latex particles as well as sensitized sheep erythrocytes and have the ability to restore T-lymphocyte response to Con A. When incubating with TPA or DMSO the cells can be differentiated into macrophage-like cells ...
Cutinases are α/β hydrolases, which possess a conventional catalytic triad with a serine residue located within the conserved...
Cutinases are α/β hydrolases, which possess a conventional catalytic triad with a serine residue located within the conserved pentapeptide G-X-S-X-G m
Latest HCE-5920 Cram Materials | Latest HCE-5920 Test Preparation & Top HCE-5920 Exam Dumps - Selfadjustingtechnique
Updated HCE-5920 Latest Cram Materials - Pass HCE-5920 First Attempt, Through the practice of our HCE-5920 exam questions, you can grasp the intention of the examination organization accurately, Hitachi HCE-5920 Latest Cram Materials This kind of standard is popular and widespread ranging from national strength beyond the other countries to achievements of individuals, We are not satisfied with that we have helped more candidates pass HCE-5920 exam, because we know that the IT industry competition is intense, we must constantly improve our dumps so that we cannot be eliminated, With the help of our HCE-5920 exam vce practice, nearly all those who have purchased our HCE-5920 pass-guaranteed files have successfully passed the difficult HCE-5920 exam, which gives us great confidence to recommend our reliable products to you.
guanidinobenzoatase
Would anyone know structural charactersitics of enzymes catalyzing the hydrolysis of 4-methylumbelliferyl-p-guanidinobenzoate to its product, 4-methylumbelliferone? I am presently working with the identification of a sperm protein possessing this enzymatic capability. zu04516 at uabdpo.dpo.uab.edu ...
Citation tools | Journal of Pharmacology and Experimental Therapeutics
Landowski, Christopher P. et al Nucleoside Ester Prodrug Substrate Specificity of Liver Carboxylesterase. Journal of Pharmacology and Experimental Therapeutics 316.2 (2006): 572-580. Web. 29 Mar. 2020. ...
Native Pseudomonas sp. Cholesterol Esterase(EC 3.1.1.13) - Creative Enzymes
Sterol esterase belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of this enzyme class is steryl-ester acylhyd
Olympics Roundup: CdM's Anae aims for gold - The Morning Call
Corona del Mar High graduate Tumua Anae will attempt to become the third local athlete to win a gold medal at the London Olympics on Thursday. Anae, a backup goalie on the U.S. women's water polo team, will help the Americans battle Spain in the gold-medal game. The two teams, both 4-0-1 in the...
Sequence Similarity
- 1LE7: CARBOXYLIC ESTER HYDROLASE, C 2 2 21 space group Sequence Similarity Report Page
1LE7: Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.
Active Mouse (Murine) Carboxylesterase 5A (CES5A) Protein (His tag), Recombinant | ABIN2008060
Recombinant Carboxylesterase 5A (CES5A) Protein (His tag). Species: Mouse (Murine). Source: Human Cells. Order product ABIN2008060.
Measurement of Carboxylesterase (CES) Activities - Current Protocols
Measurement of Carboxylesterase (CES) Activities (Masakiyo Hosokawa, Chiba University, Chiba, Japan and Tetsuo Satoh, Biomedical
Research Institute, Chiba, Japan)
Publications | ROSTLAB.ORG
Powers R, Mirkovic N, Goldsmith-Fischman S, Acton TB, Chiang Y, Huang YJ, Ma L, Rajan PK, Cort JR, Kennedy MA, et al. Solution structure of Archaeglobus fulgidis peptidyl-tRNA hydrolase (Pth2) provides evidence for an extensive conserved family of Pth2 enzymes in archea, bacteria, and eukaryotes. Protein Sci. 2005 ;14(11):2849-61. ...
Publications | ROSTLAB.ORG
Powers R, Mirkovic N, Goldsmith-Fischman S, Acton TB, Chiang Y, Huang YJ, Ma L, Rajan PK, Cort JR, Kennedy MA, et al. Solution structure of Archaeglobus fulgidis peptidyl-tRNA hydrolase (Pth2) provides evidence for an extensive conserved family of Pth2 enzymes in archea, bacteria, and eukaryotes. Protein Sci. 2005 ;14(11):2849-61. ...