Oxaloacetate decarboxylase is a carboxy-lyase involved in the conversion of oxaloacetate into pyruvate. It is categorized under EC 4.1.1.3. In some bacteria this enzyme is a trimer, composed of alpha, beta and gamma subunits. The beta and gamma subunits are integral membrane proteins. Pyruvate carboxylase Bott M, Pfister K, Burda P, Kalbermatter O, Woehlke G, Dimroth P (December 1997). "Methylmalonyl-CoA decarboxylase from Propionigenium modestum--cloning and sequencing of the structural genes and purification of the enzyme complex". Eur. J. Biochem. 250 (2): 590-9. doi:10.1111/j.1432-1033.1997.0590a.x. PMID 9428714. Laussermair E, Schwarz E, Oesterhelt D, Reinke H, Beyreuther K, Dimroth P (1989). "The sodium ion translocating oxaloacetate decarboxylase of Klebsiella pneumoniae. Sequence of the integral membrane-bound subunits beta and gamma". J Biol Chem. 264 (25): 14710-5. PMID 2549031. Schmid M, Wild MR, Dahinden P, Dimroth P (2002). "Subunit gamma of the oxaloacetate decarboxylase Na(+) ...
TY - JOUR. T1 - Malonyl CoA decarboxylase deficiency. T2 - C to T transition in intron 2 of the MCD gene. AU - Surendran, Sankar. AU - Sacksteder, Katherine A.. AU - Gould, Stephen J.. AU - Coldwell, James G.. AU - Rady, Peter L.. AU - Tyring, Stephan K.. AU - Matalon, Reuben. PY - 2001/9/15. Y1 - 2001/9/15. N2 - Malonyl CoA decarboxylase (MCD) is an enzyme involved in the metabolism of fatty acids synthesis. Based on reports of MCD deficiency, this enzyme is particular important in muscle and brain metabolism. Mutations in the MCD gene result in a deficiency of MCD activity, that lead to psychomotor retardation, cardiomyopathy and neonatal death. To date however, only a few patients have been reported with defects in MCD. We report here studies of a patient with MCD deficiency, who presented with hypotonia, cardiomyopathy and psychomotor retardation. DNA sequencing of MCD revealed a homozygous intronic mutation, specifically a -5 C to T transition near the acceptor site for exon 3. RT-PCR ...
... Academic Article ...
Shop Arginine decarboxylase ELISA Kit, Recombinant Protein and Arginine decarboxylase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Type II pyridoxal 5′-phosphate (PLP)-dependent decarboxylases are a group of enzymes with important roles in amino acid metabolism. This group of enzymes has undergone functional evolution from a shared ancient evolutionary origin to generate a selection of subfamilies with stringent substrate selectivitys [14]. Plant type II PLP decarboxylases include aromatic amino acid decarboxylases (AAADs), serine decarboxylases (SDCs) and glutamate decarboxylases (GDCs). Plant SDSs catalyze the decarboxylation of serine to ethanolamine [1], GDCs catalyze the decarboxylation of glutamate to γ-aminobutyric acid (GABA) [19] and AAADs catalyze the decarboxylation of aromatic amino acids to generate aromatic arylalkylamines [10]-[12]. Based on their respective substrate specificities each group is responsible for the biosynthesis of unique products [1],[10],[19]. Although all plant type II PLP decarboxylases have evolved from a common evolutionary ancestor, significant evolutionary divergence has occurred ...
for determination of lysine decarboxylase activity of lactose nonfermenting members of Enterobacteriaceae especially Salmonellae.
Translation initiation factor 5A (IF5A) is essential and highly conserved in Eukarya (eIF5A) and Archaea (aIF5A). YK 4-279 metabolism and aIF5A modification inHfx. volcanii Hfx. volcaniiby LC-MS/MS revealed it was exclusively deoxyhypusinylated. Genetic studies confirmed the role of the predicted arginine decarboxylase gene(HVO_1958)in agmatine synthesis. The agmatinase-like gene(HVO_2299)was found to be essential consistent with a … Continue reading Translation initiation factor 5A (IF5A) is essential and highly conserved in. ...
The API profiles for all the pathogenic strains showed that they differed in three respects: production of lysine decarboxylase (LDC) and L-ornithine decarboxylase (ODC) and utilisation of saccharose. Variation in these three properties has been observed before in E. coli isolated from untreated surface waters and soil.29,30 It has furthermore been reported that E. coli can induce production of amino acid decarboxylases (such as LDC and ODC) in response to reduced pH conditions.31 This report illustrates the highly adaptable nature of E. coli which helps it survive in more acidic environments.32. Because the PCR-based detection method of Clermont20 was used to identify E. coli phylogenetic groups (genogroups), the four main groups (A, B1, B2 and D) can further be subdivided into seven subgroups to increase discrimination: A0, A1, B1, B22, B23, D1 and D2.33 It has been reported that ExPEC strains usually belong to genogroups B2 and D, while InPEC strains that cause severe diarrhoea-related ...
Quality boat parts from Moeller Manufacturing Co including electronics, electrical, seating, pumps, sanitation, fuel systems, service and shop and gauges and compasses, battery accessories, switches, bolster seats, drain plugs and tubes, tanks water-waste, fuel tanks, fuel filters senders and caps, fuel fittings fills and vents, fuel hose and primer bulbs, tools, motor flushers and more at MarineEngine.com
AP Moeller - Maersk, graphique historique - logiciel danalyse technique de bourse en ligne, paramétrable avec sauvegarde de votre travail - affichage de 1 jour à 25 ans
Ho, M.C., Menetret, J.F., Tsuruta, H. and Allen, K.N. (2009). „The origin of the electrostatic perturbation in acetoacetate decarboxylase". Nature. 459: 393-397. PMID 19458715 ...
199119921993199419951996199719981999200020012002200320042005200620072008200920102011201220132014201520162017201820192020112824102019127171212131311863442596311414817219219225826026132232 ...
Cégünk működését több évtizedes múltra visszatekintő követeléskezelésben és ingatlan értékbecslésben szerzett tapasztalatunk alapozza meg, amelynek bázisa az 1990-es évek eleje óta együtt dolgozó összeszokott, sikeres csapat. Társaságunk tulajdonosai, illetve munkatársai széles körű szakmai tapasztalattal és megfelelő referenciákkal rendelkeznek az általuk ellátott tevékenységek végzéséhez. Végzettségüket tekintve van közüttünk pénzügyi szakközgazdász, okleveles gépészmérnök, felszámolói és vagyonfelügyelői szakképesítéssel rendelkező munkatárs és természetesen ingatlankezeléshez ...
TY - JOUR. T1 - Effects of growth hormone and glucagon on ornithine decarboxylase activity and adenosine 3,5-Monophosphate levels in isolated rat hepatocytes. AU - Klingensmith, Mark R.. AU - Freifeld, Alison G.. AU - Pegg, Anthony E.. AU - Jefferson, Leonard S.. PY - 1980/1. Y1 - 1980/1. N2 - l-Ornithine decarboxylase (l-ornithine carboxylase; E.C. 4.1.1.17) activity was studied in isolated rat hepatocytes maintained as suspensions of free cells. Activity in freshly prepared hepatocytes was reduced to approximately 10% of the amount found in the intact liver. Activity increased to the same level as that found in the intact liver when the cells were incubated for 4 h in medium containing a mixture of 20 amino acids at concentrations 10 times those found in normal rat plasma. The increase in activity between 2 and 4 h of incubation was substantially augmented when the medium also contained 25 μg/ml of a crude preparation of bovine GH (bGH; NIH-GHB18). The increase in activity and the hormone ...
Diphosphomevalonate decarboxylase (EC 4.1.1.33), most commonly referred to in scientific literature as mevalonate diphosphate decarboxylase, is an enzyme that catalyzes the chemical reaction ATP + (R)-5-diphosphomevalonate ⇌ {\displaystyle \rightleftharpoons } ADP + phosphate + isopentenyl diphosphate + CO2 This enzyme converts mevalonate 5-diphosphate (MVAPP) to isopentenyl diphosphate (IPP) through ATP dependent decarboxylation. The two substrates of this enzyme are ATP and mevalonate 5-diphosphate, whereas its 4 products are ADP, phosphate, isopentenyl diphosphate, and CO2. Mevalonate diphosphate decarboxylase catalyzes the final step in the mevalonate pathway. The mevalonate pathway is responsible for the biosynthesis of isoprenoids from acetate. This pathway plays a key role in multiple cellular processes by synthesizing sterol isoprenoids, such as cholesterol, and non-sterol isoprenoids, such as dolichol, heme A, tRNA isopentenyltransferase, and ubiquinone. This enzyme belongs to the ...
TY - JOUR. T1 - Overexpression of human arginine decarboxylase rescues human mesenchymal stem cells against H2O2 toxicity through cell survival protein activation. AU - Seo, Su Kyoung. AU - Yang, Wonsuk. AU - Park, Yu Mi. AU - Lee, Won Taek. AU - Park, Kyung Ah. AU - Lee, Jong Eun. PY - 2013/3/1. Y1 - 2013/3/1. N2 - In this study, we explored the potentiality of human arginine decarboxylase (ADC) to enhance the survival of mesenchymal stem cells (MSCs) against unfavorable milieu of host tissues as the low survival of MSCs is the issue in cell transplantation therapy. To address this, human MSCs overexpressing human ADC were treated with H2O2 and the resultant intracellular events were examined. First, we examined whether human ADC is overexpressed in human MSCs. Then, we investigated cell survival or death related events. We found that the overexpression of human ADC increases formazan production and reduces caspase 3 activation and the numbers of FITC, hoechst, or propidium iodide positive ...
TY - JOUR. T1 - Inhibition of osteoblastic cell proliferation and ornithine decarboxylase activity by ethanol. AU - Klein, Robert F.. AU - Carlos, Amy S.. PY - 1995/8. Y1 - 1995/8. N2 - Low bone mass and an increased prevalence of skeletal fractures are evident in the alcoholic population. Histomorphometric analysis of skeletal tissue from alcoholic patients reveals reduced osteoblast number and suppressed bone formation activity, with relative sparing of resorptive indexes. The decreased number of osteoblasts observed in alcoholic subjects results from either impaired proliferation or accelerated senescence. Polyamines and ornithine decarboxylase (ODC), the rate-limiting enzyme for polyamine synthesis, are essential for cell proliferation in a variety of cell types. To determine whether the consequences of ethanol on osteoblast number involve the modulation of polyamine biosynthesis, we examined the effect of ethanol on parameters of cell growth and ODC activity in a rat osteoblast-like ...
Polyamines stimulate DNA transcription and mRNA translation for protein synthesis in trophectoderm cells, as well as proliferation and migration of cells; therefore, they are essential for development and survival of conceptuses (embryo/fetus and placenta). The ovine conceptus produces polyamines via classical and non-classical pathways. In the classical pathway, arginine (Arg) is transformed into ornithine, which is then decarboxylated by ornithine decarboxylase (ODC1) to produce putrescine which is the substrate for the production of spermidine and spermine. In the non-classical pathway, Arg is converted to agmatine (Agm) by arginine decarboxylase (ADC), and Agm is converted to putrescine by agmatinase (AGMAT). Morpholino antisense oligonucleotides (MAOs) were designed and synthesized to inhibit translational initiation of the mRNAs for ODC1 and ADC, in ovine conceptuses. The morphologies of MAO control, MAO-ODC1, and MAO-ADC conceptuses were normal. Double knockdown of ODC1 and ADC (MAO-ODC1:ADC)
SWISS-MODEL Repository entry for A0KIP8 (SPEA_AERHH), Biosynthetic arginine decarboxylase. Aeromonas hydrophila subsp hydrophila (strain ATCC 7966 / DSM 30187 / JCM1027 / KCTC 2358 / NCIMB 9240)
08-24-2020 (Akron, Ohio). Akron Childrens Hospital Pediatrics welcomes Kelsie Moeller, M.D., to its Green office. The practice - which is located at 1622 E. Turkeyfoot Road - provides pediatric primary care for infants, babies and teens.. Dr. Moeller most recently completed her postgraduate training at Akron Childrens Hospital. She earned her medical degree from The University of Toledo College of Medicine and Life Sciences in Toledo. She also earned a bachelor of science degree in bioengineering from The University of Toledo.. In addition to Dr. Moeller, the Akron Childrens Hospital Pediatrics care team in Green includes Drs. Erin Armao, Valeri Hood, Jason Levine, Sharon McKee, Shannon Thompson, Abigail Vallandingham and Leigh Wells, and nurse practitioners Donald Croston, Elizabeth Forcina, Lynne Hamrick, Sharon Juszli, Colette Libertin and Tara Morissette.. With same-day, evening and Saturday appointments available, Akron Childrens Hospital Pediatrics offers:. ...
The decarboxylation of dopachrome to 5,6-dihydroxyindole (DHI) appears to be a major control point in the biosynthesis of melanin, in particular the conversion of dopachrome to 5,6-dihydroxyindole-2-carboxylic acid (DHICA). The recent discovery of a factor, DHICA stablin, that stabilizes DHICA and inhibits its conversion to DHI has added insight into the regulation of this intermediary compound. This study has shown that DHICA stablin activity is present in the melanosomal fraction of Cloudman murine melanoma cells and that this activity was observed by a new method using two complementary decarboxylase assays. When three known decarboxylase stabilizing cofactors (biotin, pyridoxal phosphate, and pyruvate) were added to melanosomal extracts, DHICA decarboxylase activity was enhanced but these factors did not decrease the lability of the decarboxylase enzyme. Protein kinases have been shown to mediate an adenylate cyclase system that is involved in the regulation of morphology and proliferation of
In the present communication, an experimental approach is utilized that facilitates the study of biochemical processes induced in B cells after their interaction with Th cells. In this approach, Th cell clones are stimulated for 18 h upon anti-CD3-coated plates, fixed with paraformaldehyde, and added at a 2 to 3:1 ratio to small, resting B cells (isolated from Percoll gradients). Th cells not stimulated on anti-CD3-coated plates, but fixed with paraformaldehyde, serve as controls for these experiments. The activated, fixed Th cells induce a transient, sixfold increase in B cell levels of cAMP, as well as an increase in B cell expression of ornithine decarboxylase (ODC) activity. This enzyme initiates the synthesis of polyamines and has been shown to be increased as cells enter the growth phase. In addition, previous studies have shown that the cellular levels of ODC activity are controlled by a multi-tiered regulatory cascade. To examine this aspect, polyclonally stimulated B cells were studied. ...
Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation.
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
1MT1: Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
Buy BEL12-E 237837 EATON MOELLER Fastening element insulated, pre-mounted, white, 200pcs. loose parts in the box the best price, fast worldwide shipping, up ..
Baltimore Ravens offensive line coach Andy Moeller has pleaded guilty to a charge of driving while intoxicated, but he will not have to serve time in jail.
Dr. Matthew Moeller, MD, rated 4.6/5 by patients. 18 reviews, Phone number & practice locations, Gastroenterologist in Grand Rapids, MI.
Title:Glyoxylate carboligase of Pseudomonas oxalaticus. A possible structural role for flavine-adenine dinucleotide.,Author:Chung S T,Tan R T,Suzuki I,Journal:Biochemistry,1971/3/30;10(7):1205-9.,Publ...
Ability of the Ca2+ ionophores A23187 and ionomycin to mimic some of the effects of the tumor promoter 12-O-tetradecanoylphorbol-13-acetate on hydroperoxide production, ornithine decarboxylase activity, and DNA synthesis in mouse epidermis in vivo. Cancer Res. 1990 Sep 15;50(18):5806-12. To Reference ...
Its uncomplicated and un-fussy. Our RAVA convertible car seat is filled with little extras like laid back legroom, fuss-free adjustments and a unique installation that makes setup a snap.RAVA has always included fabrics that are flame retardant additive free where the child sits and we strive to continuously improve o
SWISS-MODEL Repository entry for P94063 (HAL3B_ARATH), Probable phosphopantothenoylcysteine decarboxylase. Arabidopsis thaliana (Mouse-ear cress)
tr:H6RQV8_BLASD] ppc; Phosphoenolpyruvate carboxylase, Carbon dioxide fixing enzyme; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] ...
pae:PA3687 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] , (RefSeq) ppc; phosphoenolpyruvate carboxylase (A) MPEIDARLREDVHQLGELLGDTIREQYGPRFLDKIELIRKGAKAARRGSAEGAQQLTATL DGLEEDELLPVARAFNQFLNLANIAEQYHRIRRRRPNEPEPFENLVLEELLGRLKDAGHA PGQLARQLAGLEIELVLTAHPTEVARRTLIQKYDAITAQLAAKDHADLLPEERSRIQQRL QRLVAEAWHTDEIRKVRPTPVDEAKWGFAVIEHSLWQALPNVLRHVDEVLLRSTGERLPL TAAPLRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLYLRDIDRLAAELSMQQASPQ LLARVGDSAEPYRALLKQLRERLRVTRNWTHQALAGEVPAAEGVLEHNRDLVEPLQLCHE SLHACGMGVIADGALLDCLRRAATFGLFLVRLDVRQDSARHAAALSEITEYLELGSYDEW DEKTRLEFLLEELNSRRPLLPAHYQPSADTAEVLATCRAIAAAPPASLGSYVISMAGQPS DVLAVQLLLKESGVDWPMRVVPLFETLDDLDNAGPCMERLLTLPGYRSRLSGVQEVMIGY SDSAKDAGTLTAAWAQYRAQEKLVEICRQHEVELLLFHGRGGTVGRGGGPAHAAILSQPP GSVAGRFRVTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLMPPPAPEPAWRAQMDRLA KDALLAYRRVVRDDPQFVEYFRLATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT QTRLMLPAWLGWETALLNAIERGEGALLGQMREQWPFFTTRIDMLEMVLAKADADIARLY DERLVPLELRPLGRRLRDLLSQAVRVVLGLTGQSLLLAHASETRESISVRNSYLDPLHLL QAELLARSRRCRGDACGGLEQALLVTVAGVAAGLRNTG ...
elr:ECO55CA74_22865 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] , (GenBank) phosphoenolpyruvate carboxylase (A) MNEQYSALRSNVCMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE YYDQRLVDKTLWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN ...
K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] , (GenBank) ppc; probable phosphoenolpyruvate carboxylase (pepcase) (pepc) ...
Package: wnpp Severity: wishlist Owner: Steffen Moeller ,[email protected], * Package name : genometools * URL : http://www.genometools.org/ * License : BSD-like (ICS) Programming Lang: C Description : versatile genome analysis toolkit Contains collection of useful tools for * sequence and annotation handling * index structure generation and -access * efficient matching * annotation visualisation ...
What are the "tools" that allow us to construct molecules, and are these "tools" capable of building what we need in a timely and efficient manner? These two questions provide the motivation for our groups exploration of electrochemistry, an exploration that has led us to pursue two broad areas of research: synthetic electrochemistry and microelectrode array.. ...
Doktor juga mencadangkan anak anak mandi dengan air panas yang dicampurkan ke dalam air mandian mereka. Ini bertujuan untuk membunuh hama yang ada pada kulit. Doktor juga memberi ubat sapu dan ubat sirap tahan gatal untuk Aina dan Auni manakala Adhwa diberi ubat sapu dalam tiub. Ubat untuk Adhwa tak sama dengan Aina dan Auni. Semua ubat perlu disapu pada kulit selepas mereka mandi. Ubat sapu dan makan perlu diambil pada waktu malam sebelum tidur. Doktor beri tempoh tiga hari untuk merawat, sekiranya semakin teruk kena rujuk klinik semula ...
Pengendalian Hama Terpadu (PHT) pada Jagung. Disusun memenuhi tugas kelompok mata kuliah Pengendalian Hama pada Jurusan Biologi , Universitas Andalas , Padang 2012 . Kelompok 3. Robby Jannatan Melinda Purnamasari Dera Satria Fitri Rizky Andrian Jasmi Putriana Haragus. PHT?....
Sistem Organ pada Manusia, Sistem Ekskresi, Sistem Pencernaan, Sistem Pernapasan, Sistem Peredaran Darah, Sistem Rangka, Sistem Saraf, Sistem Endokrin, Sistem Imun, Sistem Reproduksi, Sistem Indera, Sistem Otot, Sistem Integumen
Tak hanya warna kulit kekuningan yang harus diperhatikan. Warna lidah juga bisa menjadi sebuah penanda ada atau tidak adanya penyakit berbahaya pada bayi.
PENGARUH TERAPI MUROTTAL AL-QURAN TERHADAP PENURUNAN SKALA NYERI PADA PASIEN CEDERA KEPALA DI RUANG BEDAH UMUM RSUD ULIN BANJARMASIN
KLIK DI SINI ARTIKEL PILIHAN ALERGI PADA DEWASA DI www.alergiku.com Tanda dan Gejala Alergi Makanan Pada Dewasa Alergi Hidung - Rinitis Alergika: Penyebab dan Penanganannya Tanda dan Gejala Alergi Makanan Bronkitis Pada Anak dan Dewasa 17 Gangguan Yang Menyertai Penderita Alergi Dewasa 8 Tanda dan Gejala Umum Alergi Dewasa Gangguan Perilaku Yang Menyertai Alergi Dewasa Tanda dan Gejala Alergi Makanan Pada Dewasa…
... - Download as Word Doc (.doc / .docx), PDF File (.pdf), Text File (.txt) or read online.
PENGARUH IMPLEMENTASI STRATEGI PEMASARAN HIJAU DAN KARAKTERISTIK KONSUMEN TERHADAP PILIHAN PRODUK (Studi Empiris Pada Konsumen AMDK Di Surakarta)
Pengaruh Frekuensi Konsumsi Kafein Terhadap Sindrom Premenstruasi Pada Mahasiswi Fakultas Kedokteran Angkatan 2013 - 2015 Universitas Muhammadiyah Purwokerto
ADM,AGTR1A,ALDH1L1,CASP7,CAV1,CDH5,COL3A1,CSAD,CXADR,CYP26A1,EDN1,FBN1,GJA1,HEXIM1,HOPX,ID2,IFITM1,ILK,KCNJ8,LOX,MMP13,MMP2,MMP9,NRG1,PKD2,PTN,RIT1,ROBO2,SLC25A4,SMAD2,SOX4,SPARC,SRI,TFPI2,TGFB1,TGFBR2, ...
Az ltalam alkalmazott m dszerek: fitoter pia, biorezonancia ter pia, magnetoter pia, llapotfelm r s, letm d tan csad s, gy gyn v nyek, gy gyt pl l kok, szem lyre szabott ter pi k, tarot szem lyis g- s sorselemz s.