Biotin Carboxyl Carrier Protein - Rediff Pages
Biotin Carboxyl Carrier Protein is on Rediff pages, ,Follow Biotin Carboxyl Carrier Protein to get latest updates from Biotin Carboxyl Carrier Protein
Structural impact of human and Escherichia coli biotin carboxyl carrier proteins on biotin attachment. - The Kennedy Institute...
Holocarboxylase synthetase (HCS, human) and BirA (Escherichia coli) are biotin protein ligases that catalyze the ATP-dependent attachment of biotin to apocarboxylases. Biotin attachment occurs on a highly conserved lysine residue within a consensus sequence (Ala/Val-Met-Lys-Met) that is found in carboxylases in most organisms. Numerous studies have indicated that HCS and BirA, as well as biotin protein ligases from other organisms, can attach biotin to apocarboxylases from different organisms, indicating that the mechanism of biotin attachment is well conserved. In this study, we examined the cross-reactivity of biotin attachment between human and bacterial biotin ligases by comparing biotinylation of p-67 and BCCP87, the biotin-attachment domain fragments from human propionyl-CoA carboxylase and E. coli acetyl-CoA carboxylase, respectively. While BirA has similar biotinylation activity toward the two substrates, HCS has reduced activity toward bacterial BCCP87 relative to its native substrate, p-67.
Biotin protein ligase of is the 35. or that the presence | High-Throughput Screen for the Chemical Inhibitors
Biotin protein ligase of is the 35. or that the presence of the reaction intermediate impedes access of subtilisin to the cleavage site. The disordered loop containing residues 115C123 lies close to the biotin binding site, and residues 115C118 become ordered in the crystal structure when biotinyl-lysine occupies the active site. Because of the similarity to nucleotide-binding sequences in protein buy 118876-58-7 kinases, the sequence 115GRGRRG120 within this loop had been thought to function in ATP binding (Buoncristiani et al. 1986; Wilson et al. 1992). However, a recent mutational analysis shows that this sequence has a role in biotin binding (Kwon and Beckett 2000). No function has been identified previously for the C-terminal domain comprising residues 274C321, which shows structural similarity to the Src homology 3 domains (Noble et al. 1993). However, recent evidence of safety by biotinyl-5-AMP buy 118876-58-7 against hydroxyl radical cleavage from the BirA backbone at a number of sites ...
Selective inhibition of biotin protein ligase from Staphylococcus aureus<...
TY - JOUR. T1 - Selective inhibition of biotin protein ligase from Staphylococcus aureus. AU - Soares Da Costa, Tatiana P.. AU - Tieu, William. AU - Yap, Min Y.. AU - Pendini, Nicole R.. AU - Polyak, Steven W.. AU - Pedersen, Daniel Sejer. AU - Morona, Renato. AU - Turnidge, John D.. AU - Wallace, John C.. AU - Wilce, Matthew C J. AU - Booker, Grant W.. AU - Abell, Andrew D.. N1 - Copyright: Copyright 2013 Elsevier B.V., All rights reserved.. PY - 2012/5/18. Y1 - 2012/5/18. N2 - There is a well documented need to replenish the antibiotic pipeline with new agents to combat the rise of drug resistant bacteria. One strategy to combat resistance is to discover new chemical classes immune to current resistance mechanisms that inhibit essential metabolic enzymes. Many of the obvious drug targets that have no homologous isozyme in the human host have now been investigated. Bacterial drug targets that have a closely related human homologue represent a new frontier in antibiotic discovery. However, to ...
Biotin carboxylase | Article about biotin carboxylase by The Free Dictionary
Looking for biotin carboxylase? Find out information about biotin carboxylase. An enzyme which condenses bicarbonate with biotin to form carboxybiotin Explanation of biotin carboxylase
Inhibition of escherichia coil dethiobiotin synthetase by stable phosphorous analogs of the carbamate intermediate<...
TY - JOUR. T1 - Inhibition of escherichia coil dethiobiotin synthetase by stable phosphorous analogs of the carbamate intermediate. AU - Taylor, W.. AU - Rendina, A.. AU - Rayner, D.. AU - Lockett, B.. AU - Kraals, K.. AU - Marsilli, E.. AU - Chii, H.. AU - Wawrzak, Z.. AU - Calabrese, J.. AU - Huang, W.. AU - Jia, J.. AU - Schneider, G.. AU - Lindqvist, Y.. PY - 1997/12/1. Y1 - 1997/12/1. N2 - A series of phosphoric, phosphonic and phosphinic acid mimics of the N7DAPA-carbamate were prepared and analyzed as inhibitors and alternate substrates for DTBS. Extension of the phosphorous moiety by a methylene spacer resulted in weaker inhibition at high ATP levels suggesting that the phosphorous group was overlapping with the 7 -phosphate of ATP rather than the carbamate carboxyt site. This was confirmed by the crystal structure of 7-( 1-hydroxyethyl)-9-phosphonononanoic acid (KU843) complexed with the enzyme. In general, phosphorous-containing inhibitors that were dianionic showed weaker inhibition ...
GTOP nfar0:bioD
GT:ID BAD56666.1 GT:GENE bioD GT:PRODUCT putative dethiobiotin synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1987153..1987884 GB:FROM 1987153 GB:TO 1987884 GB:DIRECTION + GB:GENE bioD GB:PRODUCT putative dethiobiotin synthetase GB:PROTEIN_ID BAD56666.1 LENGTH 243 SQ:AASEQ MNTLLVTGTSTDVGKTVVTAALTALARAEALPVAVCKPAQTGVAPGEPGDLAEVRRLAGPVPTLELARYPEPLAPDTAARRCGAPLLTLDETATAVRGLDAELTVVEGAGGLLVRIGEFTLLDLARELDAPVLVVAAAGLGTLNHTELTIRALDAAGVRCAGVVIGAWPAEPDLASVCNREDLPRLTGVPIVGAVPAGVGAWDHDRFTAAVPGWFAPGWSPRLPFNSDSPPSTWGFDTSQSGT GT:EXON 1,1-243:0, SW:ID BIOD_NOCFA SW:DE RecName: Full=Dethiobiotin synthetase; EC=6.3.3.3;AltName: Full=Dethiobiotin synthase;AltName: Full=DTB synthetase; Short=DTBS; SW:GN Name=bioD; OrderedLocusNames=NFA_18200; SW:KW ATP-binding; Biotin biosynthesis; Complete proteome; Ligase;Magnesium; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1-,243,BIOD_NOCFA,e-114,100.0,243/243, GO:SWS:NREP 4 GO:SWS GO:0005524,GO:ATP ...
List of variants reported as uncertain significance for Holocarboxylase synthetase deficiency by Invitae - ClinVar...
The information on this website is not intended for direct diagnostic use or medical decision-making without review by a genetics professional. Individuals should not change their health behavior solely on the basis of information contained on this website. Neither the University of Utah nor the National Institutes of Health independently verfies the submitted information. If you have questions about the information contained on this website, please see a health care professional. ...
KEGG BRITE: KEGG Modules
K11263 bccA; acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14 ...
regulation of purine and pyrimidine biosynthesis
What are the characters Mendel selected for his experiments on pea plant? MTHFS is the first identified 10-formylTHF tight-binding protein. 2, the WT GBS strain, A909 is prototrophic for both purine and pyrimidine biosynthesis and reach an optical density at 600 nm (OD 600) of 0.8-0.9 (3-5 × 10 9 cfu ml −1) in dCDM, similar to growth in cCDM (Fig. Control by purines occurs through PurR-mediated repression ( 4 , 84 ), and nitrogen control involves the Ntr system acting through the nitrogen assimilation control protein NAC ( 4 , 119 ). Pyrimidine biosynthesis Unlike in purine biosynthesis, the pyrimidine ring is synthesized before it is conjugated to PRPP. Thus, the behavior of liver CTP synthetase activity is tightly linked with that of the CTP pool. the reaction catalysed by the enzyme aspartate transcarbamoylase. 2. iii. the reaction catalysed by the enzyme aspartate transcarbamoylase. CTP. Here we review progress in molecular aspects and recent studies on the regulation and manipulation of ...
RCSB PDB - 1DAM: DETHIOBIOTIN SYNTHETASE COMPLEXED WITH DETHIOBIOTIN, ADP, INORGANIC PHOSPHATE AND MAGNESIUM...
1DAM: Crystal structure of two quaternary complexes of dethiobiotin synthetase, enzyme-MgADP-AlF3-diaminopelargonic acid and enzyme-MgADP-dethiobiotin-phosphate; implications for catalysis.
Ack kinase regulates CTP synthase filaments during Drosophila oogenesis | EMBO Reports
During mid‐oogenesis, a massive supply of nucleotides is required for the synthesis of cellular DNA and RNA. Nurse cells in egg chambers of stages 2-10 undergo 10-12 cycles of endoreplication of nuclear DNA [21] producing an approximately 1,000‐fold increase in their DNA content. Endoreplication is essential to support increased transcription and protein production for deposition into developing oocytes [22]. Likewise, RNA production, particularly ribosomal RNA, is strikingly upregulated in nurse cells from these same stages in parallel with increases in ribosomal gene copy number [23]. The presence of CTPS filaments in Drosophila ovarian germ cells at stages with a high demand for CTP, together with the observation that reduced CTPS expression is associated with defects in oogenesis, suggests that CTPS filaments are assembled to promote CTP biosynthesis and support endoreplication. Consistent with this model, the diameters of DAck86 nurse cell nuclei were significantly smaller than ...
Polk 00240 : CDS information --- DoBISCUIT
putative acetyl-CoA carboxylase biotin carboxylase subunit [PokAC2] GTGTTCCGCACCGTCCTCGTCGCCAACCGGGGCGAGATCGCCCTGCGTGTCGCGCGCGCC TGCCGTGAACTGGGGATCAGGGTCGCCGTCGTGTACTCCACCGAGGACACCGACAGCGAG GTCGTGCGGTACGCCGACGAGGCGGTCCGCATCGGCCCGGGGTCGGCGCAGGCGAGCTAC CTCAGCATCCCCGCCGTCATCGAGGCCGCCCGGCGCGTCGGCGCGGACGCGATCCACCCC GGGTACGGATTCCTCTCCGAGAACGCCGACTTCGCCGAGGTGTGCGCGGCCGAGGGCATC ACCTTCATCGGCCCGCCCCCGGAGGTGATGGAGGCGCTGGGCGACAAGTCCACCTGCCGC GGCCTCATGGCCGACGCGGGGCTGCCCCTGCTGCCCGGCACGCTGGACCCCGTGTCGTCG CCGCGCGAGGCCGAGGCGTTCGCCGCCGAGATCGGCTACCCGGTGGTGGTGAAGGCGGTG GCCGGGGGCGGCGGCCGCGGGATCGGAGTGGCGCACTCGGCCGACGAGTTCCCCGCCGTC TACCGGGAGACGCGACGCCACGCCGCCGCCGTGTTCGGGGACGGCAGGGTCTATCTGGAG CGCTATCTGCAGTCCGCACGGCACGTGGAGATCCAGATACTCGCCGACCGCTTCGGCAAT GTGATCCATCTCGGCGAGCGCGACTGCTCGGTGCAGCGCCGCCATCAGAAGCTCATCGAG GAGACCCCGGCTCCCGGGCTGGACCGCGATGTGCTCGCCGCGATGGCGGAACACGCCGTG CAGGGAGCCAAGGCCGCCGGATACGTCGGCGCGGGGACCTTCGAGTTCCTGTACGACGAC AGCGGACGCTTCTACTTCATGGAGGTCAACTGCCGTATCCAGGTCGAGCATCCGGTCACA ...
Common origin of ornithine-urea cycle in opisthokonts and stramenopiles. | J. Craig Venter Institute
Eukaryotic complex phototrophs exhibit a colorful evolutionary history. At least three independent endosymbiotic events accompanied by the gene transfer from the endosymbiont to host assembled a complex genomic mosaic. Resulting patchwork may give rise to unique metabolic capabilities; on the other hand, it can also blur the reconstruction of phylogenetic relationships. The ornithine-urea cycle (OUC) belongs to the cornerstone of the metabolism of metazoans and, as found recently, also photosynthetic stramenopiles. We have analyzed the distribution and phylogenetic positions of genes encoding enzymes of the urea synthesis pathway in eukaryotes. We show here that metazoan and stramenopile OUC enzymes share common origins and that enzymes of the OUC found in primary algae (including plants) display different origins. The impact of this fact on the evolution of stramenopiles is discussed here.. ...
Table 1: List of all of the K
am1a04d AJ229366 409 Homolog to proteins of other species than S. cerevisiae (see table 2) am1a07d AJ229367 307 am1a12d AJ229368 234 am1b02d AJ229369 236 am1b03d AJ229370 123 am1b04d AJ229371 314 7.0 E-41 YFL036w RPO41 DNA-directed RNA pol., mitochondrial am1b06d AJ229372 410 4.7 E-41 YGR208w SER2 phosphoserine phosphatase am1b11d AJ229373 327 2.1 E-42 YDL213c RNA recognition domain in the N-terminal region am1b12d AJ229374 280 am1c01d AJ229375 489 3.0 E-100 YMR229c RRP5 processing of pre-ribosomal RNA am1c05d AJ229376 275 am1c08d AJ229377 288 1.5 E-56 YDL102w CDC2 DNA-directed DNA pol. delta, catalytic 125 KD subunit am1c11d AJ229378 157 am1c12d AJ229379 145 am1d02d AJ229380 322 am1d05d AJ229381 195 repeats or mito am1d06d AJ229382 302 5.1 E-55 YBR208c DUR1,2 urea amidolyase am1d08d AJ229383 241 am1d12d AJ229384 174 am1e05r AJ229385 220 6.6 E-15 YMR287c MSU1 3-5 exonuclease for RNA 3 ss-tail, mitochondrial am1e06d AJ229386 290 am1e09r AJ229387 241 am1e10r AJ229388 138 1.7 E-06 YDL153c SAS10 ...
anti-HCS antibody | GeneTex
HCS antibody (holocarboxylase synthetase (biotin-(proprionyl-CoA-carboxylase (ATP-hydrolysing)) ligase)) for IHC-P, WB. Anti-HCS pAb (GTX109815) is tested in Human samples. 100% Ab-Assurance.
RCSB PDB - 4S27: Crystal structure of Arabidopsis thaliana ThiC with bound aminoimidazole ribonucleotide, 5-deoxyadenosine, L...
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Biotinyl-(Leu⁸,D-Trp²²,Tyr²⁵)-Somatostatin-28 H-3204 | Bachem
Bachem offers H-3204 Biotinyl-(Leu⁸,D-Trp²²,Tyr²⁵)-Somatostatin-28 for your research. Find all specific details here. Find product specific information including available pack sizes, CAS, detailed description and references here.
CTP synthase GATase domain (IPR033828) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Product-ProtTech Inc.
ProtTech Inc. is providing world-class services and products for analyzing proteins, biologics, NeoAntigen discovery. It also provides protein products such as PD-L1, PD-1,Biotin Ligase, BirA, SARS-CoV-2 nucleocapsid protein, TMPRSS2 mAb AL20, Sphingosine 1-phosphate Receptor 1, S1PR1 Antibody, E1-49, PNGase F, IL-4, TNF-alpha, Interferon-gamma
SAUSA300 2081 - AureoWiki
Staphylococcus aureus; strain: USA300_FPR3757; locus tag: SAUSA300_2081 (SAUSA300_RS11455); symbol: pyrG; product: CTP synthetase
Strategies for Achieving Measurement Assurance for Cell Therapy Products | NIST
Cell therapy products (CTPs) need quantitative, validated, and robust assays to support informed decision making during their development, manufacturing, and re
TRANSREPORT | Boston Region MPO
Sign up for our mailing list. Signing up for our email list from our website requires that your browser support Javascript and have it enabled, which doesnt appear to be the case for your browser. Alternatively, you can use email or phone to complete the process by contacting Kate White, MPO staff, at [email protected] or 857.702.3700 ...
TRANSREPORT | Boston Region MPO
Sign up for our mailing list. Signing up for our email list from our website requires that your browser support Javascript and have it enabled, which doesnt appear to be the case for your browser. Alternatively, you can use email or phone to complete the process by contacting Kate White, MPO staff, at [email protected] or 857.702.3700 ...
Contact | Boston Region MPO
Sign up for our mailing list. Signing up for our email list from our website requires that your browser support Javascript and have it enabled, which doesnt appear to be the case for your browser. Alternatively, you can use email or phone to complete the process by contacting Kate White, MPO staff, at [email protected] or 857.702.3700 ...
TRANSREPORT | Boston Region MPO
Sign up for our mailing list. Signing up for our email list from our website requires that your browser support Javascript and have it enabled, which doesnt appear to be the case for your browser. Alternatively, you can use email or phone to complete the process by contacting Kate White, MPO staff, at [email protected] or 857.702.3700 ...
HCS 310
hcs 310,uop hcs 310,uop hcs 310 entire course,uop hcs 310 week 1,uop hcs 310 week 2,uop hcs 310 week 3,uop hcs 310 week 4,hcs 310 tutorials,hcs 310 assignments,hcs 310 help,hcs 310 consumers perspective on health care questionnaire new
GoDaddy Domain Name Search
Pay less for domain names. Register your .com, .net and .org domains from $6.99/yr. Bulk pricing and private domain name registration options. Transfer domain names risk-free from $6.99.
GoDaddy Domain Name Search
Pay less for domain names. Register your .com, .net and .org domains from $6.99/yr. Bulk pricing and private domain name registration options. Transfer domain names risk-free from $6.99.
Produse naturiste CaliVita - Smokerade
Magazin online ce contine produse naturiste Calivita, vitamine calivita, minerale calivita, sanatate calivita, produse bio calivita.
P-METHYL BENZOYL CHLORIDE 874-60-2, China P-METHYL BENZOYL CHLORIDE 874-60-2 Manufacturers, China P-METHYL BENZOYL CHLORIDE 874...
We,China P-METHYL BENZOYL CHLORIDE 874-60-2 Suppliers and China P-METHYL BENZOYL CHLORIDE 874-60-2 Manufacturers, provide P-METHYL BENZOYL CHLORIDE 874-60-2 product and the products related with China P-METHYL BENZOYL CHLORIDE 874-60-2 - panoxi
7.2.2.05. | SynapseWeb
Fig. 7.2.2.05. Granulocytic leukocytes (G) from a rabbit brain granuloma containing phagocytosed Nosema protozoa (arrows). Scale = 2 µm. (Rabbit, neocortex.) Download the high resolution image.. ...
EWTN Multimedia - Video
THANKS to the ongoing support of viewers like you, EWTN is able to work day and night to bring you the best in quality Catholic programming whether its on EWTN television, EWTN Radio, or streaming on our ever-expanding, interactive website, EWTN.com.. Make a Donation. ...
Clustering of mutations in the biotin-binding region of holocarboxylase synthetase in biotin-responsive multiple carboxylase...
TY - JOUR. T1 - Clustering of mutations in the biotin-binding region of holocarboxylase synthetase in biotin-responsive multiple carboxylase deficiency. AU - Dupuis, Lucie. AU - Leon-Del-Rio, Alfonso. AU - Leclerc, Daniel. AU - Campeau, Eric. AU - Sweetman, Lawrence. AU - Saudubray, Jean Marie. AU - Herman, Gail. AU - Gibson, K. Michael. AU - Gravel, Roy A.. PY - 1996/7. Y1 - 1996/7. N2 - Holocarboxylase synthetase (HCS) catalyses the biotinylation of the four biotin-dependent carboxylases found in humans. A deficiency in HCS results in biotin-responsive multiple carboxylase deficiency (MCD). We have identified six different point mutations in the HCS gene in nine patients with MCD. Two of the mutations are frequent among the MCD patients analyzed. Four of the mutations cluster in the putative biotin-binding domain as deduced from the corresponding Escherichia coli enzyme and consistent with an explanation for biotin-responsiveness based on altered affinity for biotin. The two others may define ...
Molecules | Free Full-Text | Computational Redesign of Bacterial Biotin Carboxylase Inhibitors Using Structure-Based Virtual...
As the spread of antibiotic resistant bacteria steadily increases, there is an urgent need for new antibacterial agents. Because fatty acid synthesis is only used for membrane biogenesis in bacteria, the enzymes in this pathway are attractive targets for antibacterial agent development. Acetyl-CoA carboxylase catalyzes the committed and regulated step in fatty acid synthesis. In bacteria, the enzyme is composed of three distinct protein components: biotin carboxylase, biotin carboxyl carrier protein, and carboxyltransferase. Fragment-based screening revealed that amino-oxazole inhibits biotin carboxylase activity and also exhibits antibacterial activity against Gram-negative organisms. In this report, we redesigned previously identified lead inhibitors to expand the spectrum of bacteria sensitive to the amino-oxazole derivatives by including Gram-positive species. Using 9,411 small organic building blocks, we constructed a diverse combinatorial library of 1.2 × 108 amino-oxazole derivatives. A subset
CTP Synthase 1, a Smooth Muscle-Sensitive Therapeutic Target for Effective Vascular Repair | Arteriosclerosis, Thrombosis, and...
Approach and Results-Using both rat balloon injury and mouse wire injury models, we identified CTP synthase 1 (CTPS1) as one of the potential targets that may be used for developing therapeutics for treating neointima-related disorders. CTPS1 was induced in proliferative SMCs in vitro and neointima SMCs in vivo. Blockade of CTPS1 expression by small hairpin RNA or activity by cyclopentenyl cytosine suppressed SMC proliferation and neointima formation. Surprisingly, cyclopentenyl cytosine had much less effect on EC proliferation. Of importance, blockade of CTPS1 in vivo sustained the re-endothelialization as a result of induction of CTP synthesis salvage pathway enzymes nucleoside-diphosphate kinase A and B in ECs. Diphosphate kinase B seemed to preserve EC proliferation via use of extracellular cytidine to synthesize CTP. Indeed, blockade of both CTPS1 and diphosphate kinase B suppressed EC proliferation in vitro and the re-endothelialization in vivo.. ...
Lirias: Phosphorylation of dGMP analogs by vaccinia virus TMP kinase and human GMP kinase
Vaccinia virus thymidylate kinase, although similar in sequence to human TMP kinase, has broader substrate specificity and phosphorylates (E)-5-(2-bromovinyl)-dUMP and dGMP. Modified guanines such as glyoxal-dG, 8-oxo-dG, O(6)-methyl-dG, N(2)-ethyl-dG and N(7)-methyl-dG were found present in cancer cell DNA. Alkylated and oxidized dGMP analogs were examined as potential substrates for vaccinia TMP kinase and also for human TMP and GMP kinases. Molecular models obtained from structure-based docking rationalized the enzymatic data. All tested nucleotides are found surprisingly substrates of vaccinia TMP kinase and also of human GMP kinase. Interestingly, O(6)-methyl-dGMP is the only analog specific for the vaccinia enzyme. Thus, O(6)-Me-dGMP could be useful for designing new compounds of medical interest either in antipoxvirus therapy or in experimental combined gene/chemotherapy of cancer. These results also provide new insights regarding dGMP analog reaction with human GMP kinase and their slow ...
Biochemistry - Pharmaceutical Chemistry - Pharmacological Sciences
Biotin is required for enzymatic activity of several important carboxylases (Table 28.10). Biotin is first attached to a lysine residue of biotin carboxyl carrier protein (BCCP) by biotin- [propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase (holocarboxylase [HCS], EC 6.3.4.10), which forms the biotinyl domain of the enzyme or separate subunit. The N1 position is subsequently carboxylated to form carboxy-biotin (Fig. 28.40), which is then able to transfer the carboxyl group to other substrates. The source of the carboxyl is either bicarbonate or decarboxylation of another substrate as is seen in transcarboxylation reactions.196 A typical carboxylation reaction mediated by biotin-BCCP is shown in Figure 28.41. The source of the carboxyl is bicarbonate with ATP supplying energy for the reaction. This is followed by the subsequent transfer of the carboxyl to the substrate with regeneration of the biotin-BCCP complex.. An interesting recent development is the finding that biotin is also attached to ...
BirA Biotin Ligase, MBP-tag, Recombinant | Amid Biosciences - Amid Biosciences | Protein Engineering Company
BirA biotin ligase was expressed as maltose-binding protein (MBP) fusion in an E. coli cells. The dual 6xHis-MBP tag at the N-terminus is useful for removal of BirA after biotinylation through either Ni-NTA or amylose resin columns. Catalog number: MBBL-301 Expression host: Escherichia coli (E. coli). Expressed Region
BirA Biotin Ligase, MBP-tag, Recombinant - Amid Biosciences | Protein Engineering Company
BirA biotin ligase was expressed as maltose-binding protein (MBP) fusion in an E. coli cells. The dual 6xHis-MBP tag at the N-terminus is useful for removal of BirA after biotinylation through either Ni-NTA or amylose resin columns. Catalog number: MBBL-301 Expression host: Escherichia coli (E. coli). Expressed Region
SMART: GARS C domain annotation
Glycinamide ribonucleotide synthetase (GAR-syn) catalyzes the second step of the de novo purine biosynthetic pathway; the conversion of phosphoribosylamine,glycine, and ATP to glycinamide ribonucleotide (GAR), ADP, and Pi. GAR-syncontaining an N-terminal polyhistidine tag was expressed as the SeMetincorporated protein for crystallographic studies. In addition, the protein asisolated contains a Pro294Leu mutation. This protein was crystallized, and thestructure solved using multiple-wavelength anomalous diffraction (MAD) phasedetermination and refined to 1.6 A resolution. GAR-syn adopts an alpha/betastructure that consists of four domains labeled N, A, B, and C. The N, A, and Cdomains are clustered to form a large central core structure whereas the smaller B domain is extended outward. Two hinge regions, which might readily facilitateinterdomain movement, connect the B domain and the main core. A search ofstructural databases showed that the structure of GAR-syn is similar toD-alanine:D-alanine ...
6yb9 - Proteopedia, life in 3D
The bifunctional human enzyme phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthetase (PAICS) catalyzes two essential steps in the de novo purine biosynthesis pathway. PAICS is overexpressed in many cancers and could be a promising target for the development of cancer therapeutics. Here, using gene knockdowns and clonogenic survival and cell viability assays, we demonstrate that PAICS is required for growth and survival of prostate cancer cells. PAICS catalyzes the carboxylation of aminoimidazole ribonucleotide (AIR) and the subsequent conversion of carboxyaminoimidazole ribonucleotide (CAIR) and L-aspartate to N-succinylcarboxamide-5-aminoimidazole ribonucleotide (SAICAR). Of note, we present the first structures of human octameric PAICS in complexes with native ligands. In particular, we report the structure of PAICS with CAIR bound in the active sites of both domains and SAICAR bound in one of the SAICAR synthetase domains. Moreover, we report ...
SWISSPROT: C7QJ90 CATAD
ID C7QJ90_CATAD Unreviewed; 417 AA. AC C7QJ90; DT 13-OCT-2009, integrated into UniProtKB/TrEMBL. DT 13-OCT-2009, sequence version 1. DT 07-JUN-2017, entry version 57. DE RecName: Full=Phosphoribosylamine--glycine ligase {ECO:0000256,HAMAP-Rule:MF_00138}; DE EC=6.3.4.13 {ECO:0000256,HAMAP-Rule:MF_00138}; DE AltName: Full=GARS {ECO:0000256,HAMAP-Rule:MF_00138}; DE AltName: Full=Glycinamide ribonucleotide synthetase {ECO:0000256,HAMAP-Rule:MF_00138}; DE AltName: Full=Phosphoribosylglycinamide synthetase {ECO:0000256,HAMAP-Rule:MF_00138}; GN Name=purD {ECO:0000256,HAMAP-Rule:MF_00138}; GN OrderedLocusNames=Caci_0279 {ECO:0000313,EMBL:ACU69232.1}; OS Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC OS 102108 / JCM 14897). OC Bacteria; Actinobacteria; Catenulisporales; Catenulisporaceae; OC Catenulispora. OX NCBI_TaxID=479433 {ECO:0000313,EMBL:ACU69232.1, ECO:0000313,Proteomes:UP000000851}; RN [1] {ECO:0000313,EMBL:ACU69232.1, ECO:0000313,Proteomes:UP000000851} RP NUCLEOTIDE SEQUENCE ...
DUR1,2 (YBR208C) Result Summary | BioGRID
Urea Amidolyase; Contains Both Urea Carboxylase And Allophanate Hydrolase Activities, Degrades Urea To CO2 And NH3; Expression Sensitive To Nitrogen Catabolite Repression And Induced By Allophanate, An Intermediate In Allantoin Degradation; Protein Abundance Increases In Response To DNA Replication Stress
pyrG - CTP synthase - Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) - pyrG gene & protein
pyrG - CTP synthase - Rickettsia peacockii (strain Rustic) - pyrG gene & protein
A new bivalent fluorescent fusion protein for differential Cu(II) and Zn(II) ion detection in aqueous solution -...
Simple and easy to engineer metal-sensing molecules that are capable of differentiating metal ions and producing metal-specific signals are highly desirable. Metal ions affect the thermal stability of proteins by increasing or decreasing their resistance to unfolding. This work illustrates a new strategy for designing bivalent fluorescent fusion proteins capable of differentiating metal ions in solution through their distinct effects on a proteins thermal stability. A new dual purpose metal sensor was developed consisting of biotin protein ligase (BirA) from B. pseudomallei (Bp) fused to green fluorescent protein (GFP). When coupled with differential scanning fluorimetry of GFP-tagged proteins (DSF-GTP) for signal-transduction detection, Bp BirA-GFP yields distinct protein unfolding signatures with Zn(II) and Cu(II) ions in aqueous solutions. The limit of detection of the system is ∼1 μM for both metal species. The system can be used in a variety of high-throughput assay formats including ...
Norcoclaurine HCl-Thoughts? - AnabolicMinds.com
Norcoclaurine HCl (Norcoline TM ) Effective as a stimulant or not? Ive been seeing it a bit more in Supplements, wondering its effectiveness, if any
Regulations - GEVES
To develop, implement and improve these variety and seed regulations, the Ministry of Agriculture relies on an Advisory Committee: the Permanent Technical Committee for the Selection of Cultivated Plants (CTPS).. One of the primary missions of the CTPS is to assist and guide genetic progress by developing the technical rules for variety registration. These rules aim to ensure the best possible match between the objectives of variety users, civil society, public authorities, and the scientific and technical capacities of breeders, in order to meet the needs of sustainable and diverse agriculture. The CTPS proposes the listing and de-listing of plant varieties in the Official French Catalogue.. In France, the Ministry delegates seed production controls to various bodies: the Official Control Service (GNIS / SOC) for agricultural and vegetable plants, the Interprofessional Technical Centre for Fruits and Vegetables (CTIFL) for fruit trees, FranceAgriMer for Vine plants.. Post-marketing controls are ...
HCEF, in Cooperation with CRS and HLCS, Launches a Pilot Project to Improve the Health and Safety of Artisans in the Bethlehem...
Sir Rateb Rabie, President/CEO of HCEF commented: The beauty of the project is that it is a joint effort of three partners (HCEF, CRS, and HLCS) who brought their respective expertise and resources to serve Palestinian craftsmen in order to make them efficient workers with high quality production. This program could not exist without the joint support of all partners.. For 15 years, HCEF has been involved with helping handicraft workers improve productivity and marketability of their crafts. In the past, HCEF worked to open new markets for artisans products and advised workshops about the need for quality control and improved packaging.. ...
rs6495446 - SNPedia
rs6495446, an intronic SNP in the MTHFS gene, was associated with increased risk for chronic kidney disease based on a study associated with the Framingham Heart Study of ~1,000 Caucasian individuals. The odds ratio rs6495446(C) allele was 1.24 (CI: 1.09-1.41, p=0.001).news 23andMe reports this same information with a different emphasis since the T allele is the minor allele in both European and Asian populations: each T allele lowers the odds of chronic kidney disease by 0.8 times. [PMID 18522750 ...
L-allo-isoleucine:holo-[CmaA peptidyl-carrier protein] ligase elisa and antibody
Shop L-allo-isoleucine:holo-[CmaA peptidyl-carrier protein] ligase ELISA Kit, Recombinant Protein and L-allo-isoleucine:holo-[CmaA peptidyl-carrier protein] ligase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
CTPαS, [35S]- 1250Ci/mmol, 70mCi/ml, 1 mCi | PerkinElmer
Cytidine triphosphate, labeled on the alpha phosphate group with 35S, is typically used in reactions involving enzymes that will incorporate the ribonucleoside monophosphate (base, sugar, and alpha-labeled phosphate) into a chain of RNA. The advantage of 35S, when compared to other short-lived isotopes, is its relatively low signal (which contributes to a sharp band width), as well as longer shelf life.. Common applications include:. ...
CTP, [α-32P]- 800Ci/mmol 10mCi/ml , 250 µCi | PerkinElmer
Cytidine triphosphate, labeled on the alpha phosphate group with 32P, is typically used in reactions involving enzymes that will incorporate the ribonucleoside monophosphate (base, sugar, and alpha-labeled phosphate) into a chain of RNA. Common applications include:. ...
US Dollar</strong>
Biotinylated histone H3 peptide acetylated methylated phosphorylated for use in enzyme assays, histone binding and pulldown experiments
Biotinylation Reagents
Biotinylation reagents enable isolation, separation, concentration and further downstream processing or analysis of biomolecules.
Equilife Biotin Plus Small Animal | EquestrianCollections
Equilife Biotin Plus Small Animal Formulation. Biotin Plus is a small animal formulation of concentrated biotin that improves skin and coat health of all your small
Biotin | Centrum
Biotin helps your body produce energy from carbohydrate, proteins, and fats. Learn about food sources of biotin & problems associated with deficiency
Considerations To Know About biotin benefits
I had been skeptical After i to start with commenced utilizing Biotin, and soon became a believer within the efficacy with the product provided by Bulk Provides. As time goes on, And that i use the biotin I am gaining power, in a position to move way more freely, have energy to previous throughout the day, and am over the verge of beginning a toughness routine that I havent been ready to do in above ten years. ;)* On 12/21/2015 Robert claimed ...
Everything about where to buy biotin
I had been skeptical After i very first began using Biotin, and shortly turned a believer in the efficacy of the products supplied by Bulk Materials. As time goes on, and I use the biotin I am gaining strength, equipped to maneuver way more freely, have energy to final each day, and am within the verge of commencing a Full Article energy regimen that I have not been capable of do in Learn More Here above ten years. ;)* On twelve/21/2015 Robert explained ...
The biotin Diaries
I was skeptical After i 1st started using Biotin, and shortly turned a believer in the efficacy with the product provided by Bulk Materials. As time goes on, And that i use the biotin I am attaining power, equipped to move way more freely, have Vitality to final each day, and am within the verge of starting a power plan that I have not been ready to do in in excess of a decade. ;)* On 12/21/2015 Robert stated ...
biotin benefits - An Overview
I had been skeptical when I very first commenced utilizing Biotin, and shortly became a believer while in the efficacy of your item provided by Bulk Provides. As time goes on, And that i utilize the biotin Im getting energy, equipped to move a great deal more freely, have energy to very last learn the facts here now throughout the day, and am to the verge of starting a strength schedule that I have not been capable to do in about a decade. ;)* On 12/21/2015 Robert stated ...
Biotin 0.2% Fuso - Drugs.com
Biotin 0.2% Fuso is a medicine available in a number of countries worldwide. A list of US medications equivalent to Biotin 0.2% Fuso is available on the Drugs.com website.
Biotin, 비오틴 효능/효과 & side effects - eVitamins 대한민국
전세계 고객의 Biotin, 비오틴등급을 인증 한 한국 최대 소스. 오늘 방문하여 Biotin, 비오틴부작용, 혜택 등에 대해 알아보십시오.
Anti-CD45 抗体 [MEM-28] (Biotin) (ab28107)
国内在庫あります!Biotin標識済みマウス・モノクローナル抗体 ab28107 交差種: Hu 適用: Flow Cyt…CD45抗体一覧 一次抗体にBiotinを直接標識し、操作時間の短縮と低いバックグラウンドを実現。
Cpn10抗体(Biotin)|Abcam中国|Anti-Cpn10抗体(Biotin)
Biotin偶联Cpn10抗体(ab106171)可与人样本反应并经WB, ELISA, RIA实验严格验证,实验条件参看说明书。Abcam对所有产品均提供质保服务和专属技术支持,中国75%以上现货。
兔抗马Biotin(IgG H&L)
抗马Biotin (ab6920)经WB, ELISA, IHC-P, IHC-Fr, IM, Dot, ICC/IF实验严格验证。被多篇发表文献引用。其他多种Biotin偶联二抗可供选择。品质保证,中国80%以上现货。
HPSC HCS Admit Card 2021 - Check HCS (Ex. Br.) & Other Allied Services Prelims Exam Date @hpsc.gov.in - The College Information
HPSC HCS एडमिट कार्ड 2021: हरियाणा लोक सेवा आयोग, ने HCS (Ex.Br.) और अन्य संबद्ध सेवा परीक्षा के लिए प्रारंभिक परीक्षा की तारीखों में फिर से बदलाव किया है। जिन उम्मीदवारों ने HPSC HCS 2021 के लिए आवेदन किया है। वो उम्मीदवार एचपीएससी की आधिकारिक वेबसाइट.iehpsc.gov.in के माध्यम से नया परीक्षा अनुसूची डाउनलोड कर सकते हैं। नए शेड्यूल के अनुसार, HPSC HCS (Ex.Br.) और अन्य अलाइड सर्विसेज प्रीलिम्स 2021 को अस्थायी रूप से 12 सितंबर 2021 को ...
Gentaur Molecular :Jena Bio \ Dibenzylcyclooctyne-PEG4-Biotin Conjugate, 100 mg pack \ CLK-A105P4-100
Gentaur molecular products has all kinds of products like :search , Jena Bio \ Dibenzylcyclooctyne-PEG4-Biotin Conjugate, 100 mg pack \ CLK-A105P4-100 for more molecular products just contact us
Gentaur Molecular :Biotium \ BIOTIN 16 DUTP, 1 MM IN PH 7.5 TRIS HCL \ 40022
Gentaur molecular products has all kinds of products like :search , Biotium \ BIOTIN_16_DUTP, 1 MM IN PH 7.5 TRIS_HCL \ 40022 for more molecular products just contact us
Synthetic Mouse MCP1 protein (Biotin) (Animal Free) (ab176032)
Buy our Synthetic Mouse MCP1 protein (Biotin) (Animal Free). Ab176032 is a protein fragment produced syntheticaly (animal free) and has been validated in HPLC…
CTP sintaza - Википедија, слободна енциклопедија
CTP sintaza (EC 6.3.4.2, UTP-amonijak ligaza, citidin trifosfatna sintetaza, uridin trifosfatna aminaza, citidin 5-trifosfatna sintetaza) je enzim sa sistematskim imenom UTP:amonijak ligaza (formira ADP).[1][2] Ovaj enzim katalizuje sledeću hemijsku reakciju ...
roadworks! | Audi-Sport.net
well just looked out of the lounge window today to find that the whole street is being dug up. cant park outside my house, cant get on my drive, and...
Coacaze negre pudra bio 125g
Coacaze negre pudra bio 125g Ingrediente: 100% coacaze negre pudra* *din agricultura ecologica Amestecati pudra de coacaze negre in sucuri, smoothies, in salate de fructe, in inghetate, prajituri, preparate...