Hexachlorophene, also known as Nabac, is an organochlorine compound that was once widely used as a disinfectant. The compound occurs as a white odorless solid, although commercial samples can be off-white and possess a slightly phenolic odor. It is insoluble in water but dissolves in acetone, ethanol, diethyl ether, and chloroform. In medicine, hexachlorophene is a useful as a topical anti-infective, anti-bacterial agent, often used in soaps and toothpaste. It is also used in agriculture as a soil fungicide, plant bactericide, and acaricide. In 1972, the U.S. Food and Drug Administration (FDA) halted the production and distribution of products containing more than 1% of hexachlorophene. After that point, most products that contain hexachlorophene were available only by prescription from a doctor. The restrictions were enacted after 15 deaths in the United States and 39 deaths in France were reported following brain damage caused by hexachlorophene. At least three companies manufactured ...
An antiseptic kills the bacteria or prevents the multiplication of bacteria. These also prevent pus formation. Antiseptics do not harm living tissues. Tincture iodine, phenol (0-2%), dettol, chloroxylenol, etc. are applied on skin and bactrim, septran, etc. are taken orally as pills. Bad odour coming out of the wounds due to bacterial decomposition on the body or in the mouth are also reduced by the use of antiseptics.. For such purposes, antiseptics are usually incorporated in face-powder, breath purifiers, deodorants, etc. to reduce the inten-sity of bad odour. Neem soaps containing the extract of neem seeds are also used as antiseptic soaps. Dettol is a mixture of chloroxylenol and terpineol in a suitable solvent is commonly used antiseptic. Bithionol antiseptic is added to soap to provide antiseptic properties to it. Tincture iodine is 2-3% solution of iodine in alcohol and water ...
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
Drug repurposing or re-profiling has been the hallmark to bring strong business growth and the trend is being followed by majority of the pharmaceutical an
A novel machine-learning technique leverages gene expression data to improve drug repurposing and can even predict new associations based on incomplete data.
Market research report on drug repurposing service provides with a focus on current market landscape and future growth opportunities
>Salmonella Typhimurium DT8 was a very rare cause of human illness in Ireland between 2000 and 2008, with only four human isolates from three patients being identified. Over a 19-month period between August 2009 and February 2011, 34 confirmed cases and one probable case of Salmonella Typhimurium DT8 were detected, all of which had an MLVA pattern 2-10-NA-12-212 or a closely related pattern. The epidemiological investigations strongly supported a link between illness and exposure to duck eggs. Moreover, S. Typhimurium with an MLVA pattern indistinguishable (or closely related) to the isolates from human cases, was identified in 22 commercial and backyard duck flocks, twelve of which were linked with known human cases. A range of control measures were taken at farm level, and advice was provided to consumers on the hygienic handling and cooking of duck eggs. Although no definitive link was established with a concurrent duck egg-related outbreak of S. Typhimurium DT8 in the United Kingdom, it seems
Biovista Vizit is a visual exploration tool for biomedical literature based on NCBI PubMed. Vizit allows scientists to search and explore a biomedical domain, such as a disease, a pathway or a gene, and to create biomedical networks and graphs.
A Wyss Institute-led collaboration spanning four research labs and hundreds of miles has used the Institutes organ-on-a-chip (Organ Chip) technology to
Question: Dear Moriel.org I have much appreciation and thanks for the service your site provides to the Church at large. I think your article opposing...
A unique collection of 1154 clinical compounds for high throughput screening (HTS) and high content screening (HCS). • Research areas include anticancer, anti-infection, anti inflammation, nervous disease, and more. • A useful tool for drug repurposing. • Currently in clinical stage, some are withdrawn or terminated. • Structurally diverse, medicinally active, and cell permeable. • Detailed compound information with structure, IC50, and brief introduction. • Validated NMR and HPLC to ensure high purity and quality. • All compounds are in stock and continuously updated. ...
Zamani M, Sharifi Tehrani A, Ali Abadi AA (2007). Evaluation of antifungal activity of carbonate and bicarbonate salts alone or in combination with biocontrol agents in control of citrus green mold. Communications in Agricultural and Applied Biological Sciences. 72 (4): 773-7. PMID 18396809 ...
Preface xvi. Abacacavir (Ziagen) 435. Abacavir + Lamivudine + Dolutegravir (Triumeq) 381. Acyclovir (Zovirax) 442. Adefovir (Hepsera) 187. Albendazole (Albenza) 3. Amikacin (Amikin) 9. Amoxicillan 11. Amoxicillin-Clavulanate (Augmentin, Augmentin 600ES, Augmentin XR) 32. Amphotericin B (Fungizone) 169. Amphotericin B Colloidal Dispersion - ABCD (Amphotec) 13. Amphotericin B Lipid Complex (Abelcet) 1. Ampicillin 15. Ampicillin-Sulbactam (Unasyn) 394. Anidulafungin (Eraxis) 149. Artemether/Lumefantrine (Coartem) 92. Artesunate 27. Atazanavir (Reyataz) 317. Atazanavir + Cobicistat (Evotaz) 152. Atovaquone (Mepron) 240. Atovaquone/Proguanil (Malarone) 230. Azithromycin (Zithromax, Zmax) 437. Aztreonam (Azactam) 40. Bedaquiline (Sirturo) 337. Benznidazole 51. Bithionol (Bitin) 57. Capreomycin (Capastat) 62. Caspofungin (Cancidas) 60. Cefaclor 66. Cefadroxil (Duricef) 135. Cefamandole (Mandol) 232. Cefazolin (Ancef) 18. Cefdinir (Omnicef) 270. Cefditoren Pivoxil (Spectracef) 343. Cefepime (Maxipime) ...
Along the lines that have been discussed in a recent Frontiers short paper, here is a list of our patent discussions in the December 2017 drug repurposing special issue of ASSAY and Drug Development Technologies:. WO/2017/059389 (Kythera Biopharmaceuticals, USA): Statins as an alternative to liposuction and cryolipolysis. WO/2017/060308 (AB Science, France): Masitinib switches to human use. WO/2017/066421 (Ovid Therapeutics, USA): Eplivanserin for improving cognition in psychoses. WO/2017/068143 (Individual, Germany): BAY 11-7082 or dimethyl fumarate for adiposity or cardiovascular diseases. WO/2017/080919 (Freiburg University, Germany): Roflumilast for metabolic lipid disorders. WO/2017/081609 (Individuals): Febuxostat: from gout to neurology. WO/2017/085407 (Pierre et Marie Curie University et al., France): Mirabegron, an overactive bladder drug, for macular degeneration. WO/2017/091644 (AZ Therapies, USA): Cromolyn for cerebral ischemia and dementia. WO/2017/096013 (Cornell University, USA): ...
The platform for pet owners and breeders that contains all the important information at a glance. LABOKLIN has many years of experience with the implementation and development of genetic tests, particularly in the areas of genetic disorders, colour analysis, DNA profiles, ancestry and sex determination in birds. Our high quality standard is characterised particularly by the fact that all the results of our genetic studies are controlled in a second independent test run before they are shipped. ...
Noncyclical breast pain. This type of breast pain is not related to periods and is most common in women aged over 40. Pain can be present all the time, or come and go in a random way. The pain may be in just one breast, and may be localisedtoan area in breast .Reasonof this pain is unknown in most cases, however in few cases it might be due to,muscular or bony problems of the chest wall or Infection .Breast tumours, cancer are very rare cause of breast pain.The symptom of breast cancer is usually a painless lump. Pain is not usually an early symptom. As there are various causes it is best to see a doctor for assessment. What is the treatment for noncyclical breast pain?. NSAIDs such as ibuprofen may ease the pain. Topical NSAIDs may also work. Other treatments may be appropriate, depending on whether a cause is found.. ...
Hexachlorophene is a toxic chemical that induces edema, membrane damage, and increased sodium /decreased potassium in brain cells. (Hexachlorophene was used in shampoos, soaps and other personal care products until about a decade ago.) Rats were fed hexachlorophene orally for 3 weeks, then given Piracetam or one of 5 other drugs by injection for 6 days. Hexachlorophene seriously disrupted the rats ability to navigate a horizontal ladder without frequently falling off the rungs. Piracetam reduced the fall rate 75% compared to saline-injected controls on the first day of treatment. None of the other drugs came close to that improvement. (24). Piracetam increases the survival rate of rats subjected to severe hypoxia. (1,25) When mice, rats and rabbits have been put under diverse experimental hypoxic (low oxygen) conditions, Piracetam has acted to attenuate or reverse the hypoxia-induced amnesia and learning difficulties, while speeding up post-hypoxic recovery time and reducing time to renormalize ...
Steve Braun of Cures Within Reach, a nonprofit focused on breathing new life into old medicines, describes the potential benefits of drug repurposing.. 1 Comment. ...
Steve Braun of Cures Within Reach, a nonprofit focused on breathing new life into old medicines, describes the potential benefits of drug repurposing.. 1 Comment. ...
Daniel Griffin provides a clinical update on COVID-19, then we review an Ad5 vectored SARS-CoV-2 vaccine, reports on remdesivir and hydroxychloroquine, a drug repurposing study, why some patients infect many others, reducing viral transmission, and much more, including listener email.. ...
Find the Q&A between Director of Scientific Consulting, Dr. Maciej Czerwinski, and the editorial team at Outsourcing Pharma for more answers about how DDI testing and data interpretation adds value to the drug repurposing process. ...
Slack and sales, together? In a word, yes. Combined with the power of Salesforce, Slack helps sales teams close deals and grow revenue fast.
Slack is where work flows. Its where the people you need, the information you share, and the tools you use come together to get things done.
Urease is a nickel-dependent amidohydrolase that catalyses the decomposition of urea into carbamate and ammonia, a reaction that constitutes an important source of nitrogen for bacteria, fungi and plants. It is recognized as a potential antimicrobial target with an impact on medicine, agriculture, and the environment. The list of possible urease inhibitors is continuously increasing, with a special interest in those that interact with and block the flexible active site flap. We show that disulfiram inhibits urease in Citrullus vulgaris (CVU), following a non-competitive mechanism, and may be one of this kind of inhibitors. Disulfiram is a well-known thiol reagent that has been approved by the FDA for treatment of chronic alcoholism. We also found that other thiol reactive compounds (l-captopril and Bithionol) and quercetin inhibits CVU. These inhibitors protect the enzyme against its full inactivation by the thiol-specific reagent Aldrithiol (2,2′-dipyridyl disulphide, DPS), suggesting that the three
Abstract Between 1974 and 1985, 10 patients were studied who presented with either gastrointestinal complaints or unexplained peripheral blood eosinophilia, and had eggs typical for N. salmincola recovered from their stools. Clinical findings in 8 of the 10 included increased frequency of bowel movements or diarrhea (6), peripheral blood eosinophilia (6), abdominal discomfort (5), nausea and vomiting (3), weight loss (2), and fatigue (2). Two were asymptomatic. Eight recalled eating fish prior to the onset of symptoms. Anthelminthic treatment consisting of three 2-g doses of niclosamide (2 patients) or two 50 mg/kg doses of bithionol (1 patient) proved effective. In the remaining individuals symptoms resolved slowly over several months.
Findacure has found an innovative way to use this financial tool to fund drug repurposing research for rare diseases. This is the rare disease drug repurposing social impact bond - RDDR SIB for short.. But how would it work?. Our SIB is based on the premise that successfully repurposing low cost generic drugs for rare disease patients will save the NHS money. Rare diseases left untreated cost the NHS lots in surgery, care, appointments, hospital, stays, and much more - a cost that can be significantly reduced by a cheap, repurposed treatment. The NHS can then use a portion of these savings to reimburse Findacure for the cost of the clinical trial. We will use this reimbursement to pay back private investors, whose money was required to initially run the trial. Surplus reimbursement will be invested by us in more clinical trials: the project is self-sustaining and non-profit.. ...
Hexachlorophene is a broad spectrum anti-bacterial agent. It is used in hospital scrubs, shampoos, and deodorants. Once widely used in over-the-counter products, hexachlorophene is now prescription-only, after overdose incidents in infants in France in the 1970s. It has been largely replaced by the related compound Triclosan. ...
The virus is still found in tropical and subtropical areas in South America and Africa and remains a very rare cause of illness in U.S. travelers, according to CDC.
You can manage your cookie settings via your browser at any time. To learn more about how we use cookies, please see our cookies policy. ...
Congenital abnormalities of the cardiovascular system are defects that are present at birth. They can occur as a result of genetic defects, environmental conditions, infections, poisoning, medication taken...
Health officials have confirmed the presence of Exserohilum rostratum in unopened recalled steroid vials from New England Compounding Pharmacy.
The drug repurposing workflow system screens at least 20 bacterial proteomes against this set of proteins that are already being treated against using established drugs. By screening the bacterial proteomes it will be possible to find proteins of highly similar structure to those that are existing drug protein targets and so this will infer that it is highly likely that the drugs can be used as antimicrobials against these proteins of highly similar structure. Proteomes that will be screene ...
CXCL7 (Human) ELISA Kit is a sandwich enzyme-linked immunosorbent assay for quantitative detection of human CXCL7 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA). (KA5605) - Products - Abnova
Comparative Studies on Some Biology and Pathology of Corn and Broom Corn Isolates of Exserohilum turcicum (Pass) Leonard & Suggs ...
In 2019, IPOs ended in face-plants for some of the biggest unicorns: WeWork, Uber, Lyft, Slack, and Pinterest. Expect no lessons to be learned.
Authors. Andrew K. Gonsalves, Educational Specialist. Stephen A. Ferreira, Extension Plant Pathologist. Department of Plant Pathology, College of Tropical and Agriculture and Human Resources. University of Hawaii at Manoa. PATHOGENS & HOSTS. Over four Exserohilum species have been reported to occur in Hawaii (Raabe, et al., 1981). The following is a list of the reported pathogens from this genus (Exserohilum) and the hosts they infect. The list is organized by the scientific name of the pathogen species (CAPITAL LETTERS), followed by the various susceptible plant hosts. Words in blue indicate what symptom or disease a given pathogen causes on the listed hosts.. EXSEROHILUM PEDICELLATUM. Leafspot:. corn, maize (Zea mays). EXSEROHILUM ROSTRATUM. Flower Fleck:. Dendrobium sp.. Seedling Blight:. sorghum (Sorghum bicolor). feterita (Sorghum caudatum). EXSEROHILUM SP.. Leafspot:. golden-fruited palm (Chrysalidocarpus lutescens). Manilla grass (Zoysia matrella). ?mascarene grass (Zoysia ...
Insilico Medicine will present its recent advances in applying deep learning techniques to drug discovery and repurposing at the Strategic Partnerships in Drug Repurposing conference in Boston taking place at the Wyndham Boston Beacon Hill Oct. 27-28.
Nearly all the genes in human DNA have two copies, one inherited from the mother and one from the father. There are some genetic diseases where only one copy is normal and the other one is non-functional due to a mistake in the DNA. The idea behind this study was to see if the normal copy can be enhanced to make up for the non-functional copy, said Ali Djalilian, UIC professor of ophthalmology and corresponding author of the paper. Researchers used a mouse model of the human disease aniridia, an eye disorder that affects the iris and causes substantial visual impairment and can also be associated with systemic abnormalities. In aniridia, one copy of the gene PAX6 is normal and the other copy is non-functional. The PAX6 gene is important in eye development and patients with aniridia and PAX6 deficiency are born with eye problems, which limit their vision and can progress throughout life, Djalilian said. The investigators screened drugs that can enhance PAX6 and found a particular class of drugs ...
6:30 pm Reception and Dinner and Remarks by APMRF. June 5, 2017 8:00 am Breakfast. Presentations. There will be opportunities to submit abstracts for talks and the poster session. All submissions are due by April 1, 2017.. Speakers include:. Keynote address by Dr. Thijn Brummelkamp, Genetic studies on the function of NPC1 in pathogen entry and cholesterol trafficking. Dr. Roberto Zonco, Mechanisms of cholesterol sensing by the master growth regulator mTORC1 kinase. Dr. Wei Zheng, Therapeutic development for treatment of NPC: beyond cyclodextrin. Dr. Arun Radikrishnan, Intracellular trafficking routes of cholesterol. Dr. Kenji Ohgane, Identification of Chaperone Drugs for NPC through Drug Repurposing Screening. Dr. Yiannis Loannou, Targeting the Mitochondria-ER-Lysosome axis for the treatment of multiple lysosomal storage diseases. Dr. Charles Vite, Gene therapy in the CNS in large animal models. Dr. Xuntian Jiang, Biomarker discovery and development of diagnostics for early detection of NPC ...
BIONEXT is a French biotechnology company dedicated to the better understanding and treatment of various diseases. BIONEXT aims to accelerate and improve the effectiveness of drug development and biological research by developping programs and software-based tools to tackle problematics of prime importance in the pharmaceutical field, such as drug profile assesment or suggestion of drug repurposing.
We have mapped SARS CoV-2 human Protein-Protein Interactions from A SARS-CoV-2 protein interaction map reveals targets for drug repurposing human drug target interacted with SARS CoV-2 are highlighted in black arrow. ...
Plxna1 (Rat) ELISA Kit is a sandwich enzyme-linked immunosorbent assay for quantitative detection of rat Plexin A1 in cell culture supernates, serum and plasma (heparin, EDTA). (KA5555) - Products - Abnova
Salesforce is one of the worlds largest players in the cloud computing sector. They will buy Slack Technologies, the owner of Slacks corporate messenger. The Wall Street Journal reports, Messenger will cost Salesforce $ 27.7 billion, which will be the largest acquisition of the company in its history.. The terms of the deal include that Slack shareholders will receive $ 26.79 billion in cash and 0.0776 ordinary Salesforce shares for each Slack share. According to a company press release, at the closing price of ordinary shares of Salesforce on November 30 ($ 245.8), it gives a total of $ 27.7 billion.. The deal is expected to be completed in the second quarter of next fiscal year Salesforce, i.e. from May to July 2021.. The first reports of a possible deal between Slack and Salesforce appeared last week. During this time, Slack Technologies quotes rose by 47%. At the same time, Salesforce securities for the same period asked for almost 10%. Trading on December 1 quoted Salesforce quotes down ...
A novel double-antigen sandwich enzyme-linked immunosorbent assay (ELISA) was developed to measure rabies antibodies in dogs. G and N protein was synthesized and found to be immunogenic in mice (3), suggesting that the chimeric peptide derived from rabies virus may be used as a diagnostic antigen for detecting rabies antibodies. Iressa Two recombinant plasmids, pGEX4T2/ep and pET32a/ep, were constructed through the in-frame fusion of a chimeric peptide (AVYTRIMMNGGRLKRPPDQLVNLHDFRSDEIEHLVVEE) representing rabies G (amino acids 253 to 275) and N (amino acids 404 to 418) proteins to the C-terminal coding sequence of glutathione = 400) and unvaccinated (= 100) dogs and equally prediluted with sample diluent buffer (phosphate-buffered saline buffer, pH 7.4, including 4% [wt/vol] polyethylene glycol 6000, 3% [wt/vol] NaCl, 0.05% [vol/vol] Tween 20), were added to the wells in duplicate. The negative sera (collected from unvaccinated dogs that tested negative by neutralization test) were added in ...
http://ift.tt/eA8V8J. The northern hemispheres summer is ending and that is definitely bad news. The good news is that this was not a silly season in health and healthcare research.. Heres the best and worst news of the summer.. The best. Drug repurposing screening reveals possible candidates for anti-Zika therapy. Developing a new drug is a long process, but the Zika virus outbreak has created a global health emergency and a pressing need for therapies that is incompatible with the timings of drug development. This led to a major study published in Nature Medicine in which over 6,000 compounds were screened for possible drug repurposing, including approved drugs, clinical trial drug candidates and pharmacologically active compounds. This screening allowed the identification of compounds that were able to inhibit Zika infection, suppress the effects of infection in neurons, or inhibit viral replication. Furthermore, combination treatments using neuroprotective and antiviral compounds showed a ...
The worlds growing knowledge of the virology and clinical presentation of COVID-19 has widened the pool of pharmacological targets. In particular, it has increased interest in drug repurposing to either inhibit SARS-CoV-2 replication or to counteract the effects of a massive cytokine release that causes acute respiratory distress syndrome (ARDS) and coagulopathy. (See Janet Sultana, Challenges for Drug Repurposing in the covid-19 Pandemic Era. Front. Pharmacol., 06 November 2020 , https://doi.org/10.3389/fphar.2020.588654). Geneva based Relief Therapeutics has repurposed aviptadil, a vasoactive intestinal polypeptide (VIP) analog with a 20-year history of safe use in humans in multiple human trials for sarcoidosis, pulmonary fibrosis, asthma/allergy, and pulmonary hypertension. In November 2020, the drug was granted FDA Fast Track Designation, FDA emergency use IND authorization, and an expanded access protocol for the treatment of Respiratory Distress Syndrome (ARDS).. Zurich based Metripharm ...
Here we identify hundreds of new drug-disease associations for over 900 FDA-approved drugs by quantifying the network proximity of disease genes and drug targets in the human (protein-protein) interactome. We select four network-predicted associations to test their causal relationship using large healthcare databases with over 220 million patients and state-of-the-art pharmacoepidemiologic analyses. Using propensity score matching, two of four network-based predictions are validated in patient-level data: carbamazepine is associated with an increased risk of coronary artery disease (CAD) [hazard ratio (HR) 1.56, 95% confidence interval (CI) 1.12-2.18], and hydroxychloroquine is associated with a decreased risk of CAD (HR 0.76, 95% CI 0.59-0.97). In vitro experiments show that hydroxychloroquine attenuates pro-inflammatory cytokine-mediated activation in human aortic endothelial cells, supporting mechanistically its potential beneficial effect in CAD. In summary, we demonstrate that a unique ...
The tapeworms described in this study were retrieved from a young male elephant that died at the Udawalawe Elephant Transit Home in Sri Lanka. Anoplocephala manubriata has very muscular suckers on its scolex which allows it to keep a firm grip on the host intestinal wall. But this is not so great for the elephant - the suction from the tapeworms suckers essentially end up leaving hickeys on the elephants intestinal mucosa, which is not a particularly healthy place for an elephant to get love bites, especially if they have been left there by a bunch of tapeworms. Indeed, the elephant that was necropsied in this study was found to have multiple lesions and ulcers on the gut lining as a result of these parasitic love bites. This tapeworm seems to be far more common among younger elephants than adults, possibly because older elephants have more developed immune systems, and have build up some kind of resistant towards these parasites ...
The tapeworms described in this study were retrieved from a young male elephant that died at the Udawalawe Elephant Transit Home in Sri Lanka. Anoplocephala manubriata has very muscular suckers on its scolex which allows it to keep a firm grip on the host intestinal wall. But this is not so great for the elephant - the suction from the tapeworms suckers essentially end up leaving hickeys on the elephants intestinal mucosa, which is not a particularly healthy place for an elephant to get love bites, especially if they have been left there by a bunch of tapeworms. Indeed, the elephant that was necropsied in this study was found to have multiple lesions and ulcers on the gut lining as a result of these parasitic love bites. This tapeworm seems to be far more common among younger elephants than adults, possibly because older elephants have more developed immune systems, and have build up some kind of resistant towards these parasites ...
Screening with magnetic resonance imaging identified 21% of patients with a spinal or paraspinal infection resulting from a tainted steroid injection, researchers reported in JAMA. A multistate outbreak of fungal meningitis that started in the fall of 2012 was linked to vials of methylprednisolone that were contaminated with Exserohilum rostratum at the New England Compounding Center. Besides
COVID-19 is sparking all kinds of innovation - from testing and treatments to drug repurposing and vaccines. Local health authorities are releasing new guidance at breakneck speed, making it increasingly difficult to stay on top of it all.. Cortellis Regulatory Intelligence makes it easy to track and access the critical documents you need to inform your regulatory strategy around the world - all in one intuitive platform. In this webinar (one of four in our Managing through todays (even more) dynamic R&D environment series), our experts will share tips and tricks to make your efforts more efficient - and help keep your regulatory compliance activities on track. Fill out the form at the right to learn how to:. ...
This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Collagen Type IV (COL4) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Macrophage inhibitory cytokine-1 (MIC-1) is a recently described divergent member of the transforming growth factor-ss superfamily. MIC-1 transcription up-regulation is associated with macrophage activation, and this observation led to its cloning. Northern blots indicate that MIC-1 is also present in human placenta. A sensitive sandwich enzyme-linked immunosorbent assay for the ...
Repurposing Drugs in Oncology (ReDO) project by the Anticancer Fund and GlobalCures reporting pre-clinical and clinical evidence for very promising candidates ...
Security researchers have unearthed a concerning vulnerability in Slack that allowed hackers to snatch your token and take control of your account.
Product excellence is hard. Slack product lead Paul Rosania gives an overview of the many risks that face software teams and how to get it right.
Ho provato di aggiornare slackware64-14.0 a 14.1 su una macchina virtuale prima di aggiornare la slack su portatile pero probabilmente non ho configurato bene lilo, e non sono riuscito piu avviarla. Pero almeno ho capito cosa non e chiaro per me per aggiornare la slack a 14.1 su portatile ...