There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a homologue of a drug-metabolising enzyme, appears to be a marker in human oestrogen receptor positive breast cancer. Mouse Nat2 is the mouse equivalent of human NAT1. The development of mouse models of breast cancer is important, and it is essential to explore the biological role of mouse Nat2. We have therefore produced mouse Nat2 as a recombinant protein and have investigated its substrate specificity profile in comparison with human NAT1. In addition, we have tested the effects of inhibitors on mouse Nat2, including compounds which are endogenous and exogenous steroids. We show that tamoxifen, genistein and diethylstilbestrol inhibit mouse Nat2. The steroid analogue, bisphenol A, also inhibits mouse Nat2 enzymic activity and is shown by NMR spectroscopy, through shifts in proton peaks, to bind close to the active site. A three-dimensional structure for human NAT1 has recently
Arylamine N-acetyltransferases (EC 2.3.1.5) (NATs) catalyse the biotransformation of many primary arylamines, hydrazines and their N-hydroxylated metabolites, thereby playing an important role in both the detoxification and metabolic activation of numerous xenobiotics. The recently published crystal structure of the Salmonella typhimurium NAT (StNAT) revealed the existence of a cysteine protease-like (Cys-His-Asp) catalytic triad. In the present study, a three-dimensional homology model of human NAT1, based upon the crystal structure of StNAT [Sinclair, Sandy, Delgoda, Sim and Noble (2000) Nat. Struct. Biol. 7, 560-564], is demonstrated. Alignment of StNAT and NAT1, together with secondary structure predictions, have defined a consensus region (residues 29-131) in which 37% of the residues are conserved. Homology modelling provided a good quality model of the corresponding region in human NAT1. The location of the catalytic triad was found to be identical in StNAT and NAT1. Comparison of ...
N-acetyltransferase 1 (arylamine N-acetyltransferase) is a protein that in humans is encoded by the NAT1 gene. This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat NAT2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]. GRCh38: Ensembl release 89: ENSG00000171428 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000051147 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". "Entrez Gene: N-acetyltransferase 1 (arylamine N-acetyltransferase)". Retrieved 2012-01-27. Gubin AN, Njoroge JM, Bouffard GG, Miller JL (July 1999). "Gene expression in proliferating human erythroid cells". Genomics. 59 ...
Human N-acetyltransferase 2 (NAT2) is polymorphic in humans and may associate with cancer risk by modifying individual susceptibility to cancers from carcinogen exposure. Since molecular epidemiological studies investigating these associations usually include determining NAT2 single-nucleotide polymorphisms (SNPs), haplotypes or genotypes, their conclusions can be compromised by the uncertainty of genotype-phenotype relationships. We characterized NAT2 SNPs and haplotypes by cloning and expressing recombinant NAT2 allozymes in mammalian cells. The reference and variant recombinant NAT2 allozymes were characterized for arylamine N-acetylation and O-acetylation of N-hydroxy-arylamines. SNPs and haplotypes that conferred reduced enzymatic activity did so by reducing NAT2 protein without changing NAT2 mRNA levels. Among SNPs that reduced catalytic activity, G191A (R64Q), G590A (R197Q) and G857A (G286E) reduced protein half-life but T341C (I114T), G499A (E167K) and A411T (L137F) did not. G857A ...
Compare N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
TY - JOUR. T1 - NAT2 fast acetylator genotype is associated with an increased risk of colorectal cancer in Taiwan. AU - Huang, Chi Chou. AU - Chien, Wen Pin. AU - Wong, Ruey Hong. AU - Cheng, Ya Wen. AU - Chen, Meng Cheng. AU - Chou, Ming Chih. AU - Lee, Huei. PY - 2007/7. Y1 - 2007/7. N2 - In Taiwan, colorectal cancer has one of the highest rates of increased incidence in the past two decades. Heterocyclic amines from dietary cooked meats are metabolically activated by NAT2 (N-acetyltransferase 2), which are associated with colorectal cancer incidence. Thus, the NAT2 fast acetylator genotype may be associated with colorectal cancer risk. However, the association between the NAT2 genotype and colorectal cancer risk is not clearly understood. We conducted a study with 244 primary colorectal cancer cases and 299 cancer-free healthy control subjects to verify the association of NAT2 polymorphisms with the risk of Taiwanese colorectal cancer. Our data showed that subjects with the NAT2 W/W ...
Buy NAT8B elisa kit, Human N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) ELISA Kit-NP_057431.2 (MBS9318897) product datasheet at MyBioSource, ELISA Kits
This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq, Jul 2008 ...
Sigma-Aldrich offers abstracts and full-text articles by [Natasa Djordjevic, Juan Antonio Carrillo, Nobuhisa Ueda, Guillermo Gervasini, Takashi Fukasawa, Akira Suda, Slobodan Jankovic, Eleni Aklillu].
Acetyl coenzyme A-dependent N-acetyltransferase and O-acetyltransferase activities were examined in liver cytosols derived from homozygous rapid acetylator C57BL/6J and A.B6 congenic inbred mouse strains, from homozygous slow acetylator A/J and B6.A congenic inbred mouse strains, and from the (C57BL/6J x A/J)F1 heterozygous acetylator hybrid mouse strain. Acetylator genotype-dependent N-acetyltransferase activity was exhibited for the N-acetylation of p-aminobenzoic acid, 2-aminofluorene, and 4-aminobiphenyl. In contrast, levels of isoniazid N-acetyltransferase and N-hydroxy-3,2-dimethyl-4-aminobiphenyl O-acetyltransferase activities in mouse liver cytosol appeared to be independent of the arylamine Nat acetylator gene. Although cytosolic N-acetyltransferase activities differed about 2-fold between the parental C57BL/6J and A/J strains for p-aminobenzoic acid, 2-aminofluorene, and 4-aminobiphenyl, the same N-acetyltransferase activities differed about 6-7-fold between the homozygous rapid ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
The human arylamine N-acetyltransferases first attracted attention because of their role in drug metabolism. However, much of the current literature has focused on their role in the activation and detoxification of environmental carcinogens and how genetic polymorphisms in the genes create predispositions to increased or decreased cancer risk. There are two closely related genes on chromosome 8 that encode the two human arylamine N-acetyltransferases-NAT1 and NAT2. Although NAT2 has restricted tissue expression, NAT1 is found in almost all tissues of the body. There are several single-nucleotide polymorphisms in the protein coding and 3-untranslated regions of the gene that affect enzyme activity. However, NAT1 is also regulated by post-translational and environmental factors, which may be of greater importance than genotype in determining tissue NAT1 activities. Recent studies have suggested a novel role for this enzyme in cancer cell growth. NAT1 is up-regulated in several cancer types, and ...
Christie, Angela, Burgess, Anne P. and Sim, Edith (1987) N-Acetyltransferase activity in cultured-cells. Biochemical Society Transactions, 15(3), p. 449. ISSN (print) 0300-5127 ...
Antila E, Westermark T, On the etiopathogenesis and therapy of Down syndrome. Int. J. Dev. Biol. 33: 183-188, 1989 Medline. Baez S, Segura-Aguilar J, Widersten M, et al. Glutathione transferases catalyze the detoxification of oxidized metabolites (o-quinones) of catecholamines and may serve as an antioxidant system preventing degenerative cellular processes. Biochem. J. 324 (pt.1): 25-28, 1997 Medline. Bandmann O, Vaughen J, Holmans P, et al. Association of slow acetylator genotype for N-acetyltransferase 2 with familiar Parkinsons disease. Lancet 350: 1136-1139, 1997 Medline. Berry T. A selenium transport protein model of a sub-type of schizophrenia. Med. Hypothesis 43: 409-414, 1994 Medline. Brown K, Reid A, White T, et al. Vitamin E, lipids and lipid peroxidation products in tardive dyskinesia. Biol. Psychiatry 43: 863-867, 1998 Medline. Brugge KL, Nichols S, Delis D, et al. The role of alterations in free radical metabolism in mediating cognitive impairments in Down syndrome. EXS 62: ...
In recent times, an increasing number of different haplotypes of the arylamine N-acetyltransferase 2 gene are reported. Since most of the various alleles are defined by linkages of commonly known hereditary point mutations, some confusion may occur when the mutation pattern revealed by genotyping sh
The molecular genetic basis of N-acetylation polymorphism has been investigated in inbred mouse models of the human acetylation polymorphism. Two genomic clones, Nat1 and Nat2, were isolated from a C57BL/6J (B6) mouse (rapid acetylator) genomic library. The Nat1 and Nat2 genes both have intronless coding regions of 870 nucleotides and display greater than 47% deduced amino acid similarity with human, rabbit, and chicken N-acetyltransferases. Amplification of Nat1 and Nat2 from A/J (A) mouse (slow acetylator) genomic DNA by the polymerase chain reaction and subsequent sequencing revealed that Nat1 was identical in B6 and A mice, whereas Nat2 contained a single nucleotide change from adenine in B6 to thymine in A mice. This nucleotide substitution changes the deduced amino acid at position 99 from asparagine in B6 to isoleucine in A mice. Hydropathy analysis revealed that this amino acid change alters the hydropathy of the flanking peptide segment in NAT2 from hydrophilic in the B6 mouse to ...
‎The arylamine N-acetyltransferase 2 (NAT2 [5]; E.C. 2.3.1.5) is a polymorphic enzyme involved in the metabolism of drugs and aromatic amines. About 50% of white individuals are classified as slow acetylators, and these individuals show impaired metabolism of many therapeutically useful arylamine and…
Shop Histidine N-acetyltransferase ELISA Kit, Recombinant Protein and Histidine N-acetyltransferase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
N-Acetyltransferase antibody LS-C200960 is an unconjugated mouse monoclonal antibody to human N-Acetyltransferase. Validated for ELISA and LateralFlow.
In article ,31C894FB.1855 at odyssee.net,, dellaire at ODYSSEE.NET says... , ,I was wondering if the cDNA is out for the acetyl transferase gene for ,mammals.. mouse or human. I know the yeast homolog is cloned but the ,cDNA is not available yet I dont think (at least not through NCBI or ,Entrez). ,Has anyone worked with the yeast acetyl transferase? Youll have to be a bit more specific than acetyltransferase as there are quite a few of them. My own interest is/was arylamine N-acetyltransferases involved in xenobiotic metabolism and the sequences of the two human forms (and variants) and rabbit forms have been available for some time. What do you want acetylated? Bernard Bernard Murray, Ph.D. bernard at elsie.nci.nih.gov (National Cancer Institute, NIH, Bethesda MD, USA) If I knew what was going on Id really be indignant. -Crow T. Robot, MST3k (City Limits ...
We welcome your input and comments. Please use this form to recommend updates to the information in ZFIN. We appreciate as much detail as possible and references as appropriate. We will review your comments promptly ...
NAA60 - NAA60 (Myc-DDK-tagged)-Human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2 available for purchase from OriGene - Your Gene Company.
Purified Recombinant Rat Nat2 Protein, His/GST-tagged from Creative Biomart. Recombinant Rat Nat2 Protein, His/GST-tagged can be used for research.
Buy our Recombinant Human NAT8 protein. Ab160299 is a full length protein produced in Wheat germ and has been validated in WB, ELISA. Abcam provides free…
N-Acetyltransferase phenotype and risk in urinary bladder cancer: approaches in molecular epidemiology. Preliminary results in Sweden and Denmark: A variable bu
TY - GEN. T1 - N-Acetyltransferase 8-like regulates lipid metabolism in brown adipocytes. AU - Bogner-Strauß, Juliane Gertrude. AU - Pelzmann, Helmut Josef. PY - 2013. Y1 - 2013. M3 - Conference contribution. SP - 15. EP - 15. BT - 3rd Scientific Retreat of the DK-Metabolic and Cardiovascular Disease. PB - .. ER - ...
Compare N-acetyltransferase 8 (putative) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
There is growing evidence of dysregulated very long non-coding RNAs (lncRNAs) offering mainly because potential biomarkers for malignancy prognosis. eight-lncRNA signature may have important implications for end result prediction and therapy decisions. [23], [24], [26], [27] and [28], possess indicated oncogenic and/or tumor suppressive functions like protein-coding genes in various cancers. As lncRNAs do not code for proteins, lncRNA appearance may be an improved signal from the tumor position, implying the and superiority as independent biomarkers for early prognosis and diagnosis prediction in cancers [29]. Currently, many expression-based lncRNA personal have been discovered to predict sufferers survival in a few malignancies, including glioblastoma multiforme [30], oesophageal squamous cell carcinoma [31], colorectal cancers [32], breast cancer tumor [33C35], lung cancers [36] and multiple myeloma [37]. Latest research have got uncovered that adjustments in lncRNA appearance had been ...
Accumulating evidence demonstrates that lengthy non-coding RNAs (LncRNAs) perform essential roles in regulating gene expression and so are involved in different cancers including colorectal cancer (CRC). evaluated by silencing the LncRNA and and ideals≥0.05 were removed and thus excluded from further analysis. The heat map of the 50 LncRNAs most obvious differences was created using a method of hierarchical clustering by GeneSpring GX version 7.3 (Agilent Technologies). Chosen LncRNAs were finally confirmed for altered transcription level using quantitative real-time PCR (qRT-PCR) between tumour and adjacent normal tissues. Primers used in qRT-PCR were as follows: LncRNA "type":"entrez-nucleotide" attrs :"text":"DQ786243″ term_id :"110631570″ term_text :"DQ786243″DQ786243: 5′-agaggtgggagatgaggg-3′ (forward probe) 5 (reverse probe). Other LncRNAs primer sequences are available upon request. RNA preparation invert transcription and quantitative real-time PCR Total RNAs had been ...
Limited epidemiological evidence suggests that genetic polymorphisms of drug-metabolizing enzymes such as cytochrome P450 (CYP), glutathione S-transferase (GST) and N-acetyltransferase (NAT) may be involved in tobacco-related hepatocarcinogenesis. We conducted a case-control study, including 209 incident cases with hepatocellular carcinoma (HCC) and two different control groups [275 hospital controls and 381 patients with chronic liver disease (CLD) without HCC], to investigate whether CYP1A1, CYP1A2, CYP2A6, CYP2E1, GSTM1 and NAT2 polymorphisms are related to the risk of HCC with any interaction with cigarette smoking. Overall, no significant associations with HCC were observed for any genotypes against either control group. However, we found a significant interaction (P = 0.0045) between CYP1A2 -3860G,A polymorphism and current smoking on HCC risk when we compared HCC cases with CLD patients; adjusted odds ratios [ORs; and 95% confidence intervals (CIs)] for G/A and A/A genotypes relative to ...
Accepted name: phenylalanine N-acetyltransferase. Reaction: acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine. Other name(s): acetyl-CoA-L-phenylalanine α-N-acetyltransferase. Systematic name: acetyl-CoA:L-phenylalanine N-acetyltransferase. Comments: Also acts, more slowly, on L-histidine and L-alanine.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: 9075-16-5. References: 1. Leuzinger, W., Baker, A.L. and Cauvin, E. Acetylcholinesterase. II. Crystallization, absorption spectra, isoionic point. Proc. Natl. Acad. Sci. USA 59 (1968) 620-623. [PMID: 5238989]. ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Вивчення біохімічної активності ферменту N-ацетилтрансферази, продукції гена NAT2 у дітей з екологічно несприятливих регіонів (ЕНР) є надзвичайно в...
Human NAT2 full-length ORF ( AAH15878.1, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. (H00000010-P02) - Products - Abnova
Complete information for HGSNAT gene (Protein Coding), Heparan-Alpha-Glucosaminide N-Acetyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for HGSNAT gene (Protein Coding), Heparan-Alpha-Glucosaminide N-Acetyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
When it comes to what we do, how we chose to live, eat and breathe, there certainly isnt a one size fits all kind of method. In fact, you can be forgiven to being totally at a loss whilst youre trying to work out just how you should.... Read more ...
Aralkylamine N-acetyltransferase (AANAT) (EC 2.3.1.87), also known as arylalkylamine N-acetyltransferase or serotonin N-acetyltransferase (SNAT), is an enzyme that is involved in the day/night rhythmic production of melatonin, by modification of serotonin. It is in humans encoded by the ~2.5 kb AANAT gene containing four exons, located on chromosome 17q25. The gene is translated into a 23 kDa large enzyme. It is well conserved through evolution and the human form of the protein is 80% identical to sheep and rat AANAT. It is an acetyl-CoA-dependent enzyme of the GCN5-related family of N-acetyltransferases (GNATs). It may contribute to multifactorial genetic diseases such as altered behavior in sleep/wake cycle and research is on-going with the aim of developing drugs that regulate AANAT function. The systematic name of this enzyme class is acetyl-CoA:2-arylethylamine N-acetyltransferase. Other names in common use include: AANAT Arylalkylamine N-acetyltransferase Melatonin rhythm enzyme Serotonin ...
Science & Technology, Life Sciences & Biomedicine, Neurosciences, Neurosciences & Neurology, NEUROSCIENCES, chicken, pineal gland, retina, circadian rhythm, light, melatonin, serotonin N-acetyltransferase, MELATONIN SYNTHESIS, PERCEIVED LIGHT, JAPANESE-QUAIL, CLOCK, SYSTEM, SUPPRESSION, RECEPTORS, CELLS ...
RESULTS: Forty-five (32.1%) patients were diagnosed with ATDH. No significant differences were reported in age and sex between patients with and without ATDH. Slow acetylators defined by NAT2 genotypes had a higher risk of hepatotoxicity than rapid acetylators (51.2% vs. 25.2%, P = 0.0026). Odds ratio (OR) analysis showed that slow acetylator status (OR 3.15, 95%CI 1.47-6.48) was the only independent risk factor for ATDH. Pyrazinamide co-administration induced hepatitis was also associated with NAT2 acetylator status. CYP2E1 c1/c1 homozygotes are prone to developing more severe hepatotoxicity than other c1/c2 and c2/c2 genotypes ...
Over the past years natural products and/or their derivatives have continued to provide cancer chemotherapeutics. Glycosides derivatives of emodin are known to possess anticancer activities. An in silico study was carried out to evaluate emodin derivatives as inhibitors of Arylamine N-Acetyltransferase 2, Cyclooxygenase 2 and Topoisomerase 1 enzymes, predict their pharmacokinetics and explore their bonding modes. Molecular docking study suggested that D2, D5, D6 and D9 to be potent inhibitors of NAT2, while D8 was suggested to be a potent inhibitor of TOP1. Derivatives D2, D5, D6 and D9 bind to the same pocket with different binding conformation. Pharmacokinetic study suggested that selected emodin derivatives can be potential cancer chemotherapeutic agent. Physicochemical parameters such density, balaban index, surface tension, logP and molar reflectance correlated to compounds activity. These finding provides a potential strategy towards developing NAT2 and TOP1 inhibitors.
Rabbit polyclonal Serotonin N-acetyltransferase (phospho T29) antibody validated for WB and tested in Rat. Immunogen corresponding to synthetic peptide
Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Overexpression Lysate (Native). Tested Reactivity: Hu. Validated: WB. Backed by our 100% Guarantee.
Myc-DDK-tagged ORF clone of Homo sapiens glucosaminyl (N-acetyl) transferase 4, core 2 (GCNT4) as transfection-ready DNA - 10 µg - OriGene - cdna clones
Interindividual and interethnic differences in allele frequencies of N-acetyltransferase (NAT2) single nucleotide polymorphisms (SNPs) are responsible for phenotypic variability of adverse drug reactions and susceptibility to cancer. We genotyped the seven NAT2 common SNPs in 127 randomly selected unrelated northern Sudanese subjects using allele-specific and RFLP polymerase chain reaction (PCR) based methods. Molecular genotyping was enough to designate alleles for 41 individuals unambiguously, whereas 63 individuals alleles were inferred from haplotypes previously described. In the remaining 23 individuals, however, the phase of the SNPs could not be decided because of multiple SNP heterozygotes. Using computational methods in the HAP and Phase programs, we confirmed the inferred alleles of the 62 individuals and predicted the remaining 23 ambiguous alleles. Twelve NAT2 alleles were identified. Four alleles coded for rapid acetylators (18%), and eight alleles coded for slow acetylators (82%). Two
Golka and colleagues (1) critically refer to our observation that NAT2 genotype had no impact on bladder cancer risk (2). We were able to demonstrate in our case-control study nested in the European Prospective Investigation into Cancer and Nutrition (EPIC) that occupational exposure to aromatic amines and polycyclic aromatic amines was associated with an increased bladder cancer risk. On the basis of the comprehensive genotyping of N-acetyltransferase 2 (NAT2), we observed that NAT2 slow acetylation was not itself associated with bladder cancer risk. Notably, our main effect of 1.02 [95% confidence interval (CI), 0.81-1.29] is clearly in line with the OR of 1.02 (95% CI, 0.87-1.19) for a tagging single-nucleotide polymorphism that the authors reported from a pooled analysis of their own studies (3).. We fully recognize that EPIC is a population-based cohort with a low prevalence of rare occupations known to entail a bladder cancer risk. We also mentioned in the article that the metabolism of ...
Triethylenetetramine (TETA), a copper II chelator and a polyamine analog traditionally used for the treatment of Wilsons disease, is currently in Phase I clinical trials for cancer in combination with carboplatin. However, the metabolism of TETA has never been thoroughly investigated, which is crucial for its further development in cancer treatment1. The two major metabolites of TETA found in humans are N1-acetyl-TETA (MAT) and N1,N10-diacetyl-TETA (DAT)2. Traditionally, acetylation of drug is thought to be catalyzed by N-acetyltransferase (NAT2). FDA requires that pharmacological properties of any drug metabolized via acetylation route have to be investigated in population with different NAT2 phenotype. However, our recent clinical study showed that there was no significant difference in pharmacokinetic and metabolites profiles of healthy volunteers with fast or slow NAT2 acetylation phenotype3. We therefore hypothesize that the enzyme responsible to TETA acetylation is spermidine/spermine ...
CP002160.PE153 Location/Qualifiers FT CDS 242742..243257 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Clocel_0156" FT /product="GCN5-related N-acetyltransferase" FT /note="PFAM: GCN5-related N-acetyltransferase; KEGG: FT hor:Hore_00330 GCN5-related N-acetyltransferase" FT /db_xref="EnsemblGenomes-Gn:Clocel_0156" FT /db_xref="EnsemblGenomes-Tr:ADL49944" FT /db_xref="GOA:D9SNS3" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:D9SNS3" FT /inference="protein motif:PFAM:PF00583" FT /protein_id="ADL49944.1" FT /translation="MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI FT MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG FT KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD FT LQMVCDVD" MIKFQLLTKE NMAENALDNY DRLQNVRRVY RKIDSEYMLV EDVGIMDWSF ERKQAVAKAL 60 ISDDYITFGA IREDEIVGFA SIEKQLQGKY IVLDMMQVSR KYRGKGMGRT LFQLVKEKAK 120 EMGAKQLYIS ACASEETIEF YKSMGCKITD NPIKKIAEDE PFDLQMVCDV D 171 ...
B159 Background: Heterocyclic amines (HCA) are pro-carcinogens produced when meat is cooked in direct heat, such as flame-broiled (FB) food. The N-acetyltransferases (NAT) are enzymes involved in the activation of HCAs. Laboratory data suggest that aspirin may inhibit NAT activity. Methods: In a population based nested case-control study, we assessed the association between flame-broiled food, meat consumption and the risk of breast cancer and whether it varies by NAT2 genotype status or aspirin intake in 312 cases and 316 controls. Genotyping for rapid, intermediate and slow metabolizers of NAT2 was carried out on three NAT2 alleles. Odds ratios (OR) and 95% confidence intervals (CI) were estimated from logistic regression models. The median intake level among controls was used as the cut point for meat consumption. Results: Breast cancer risk was significantly elevated among women who ate FB food greater than twice a month compared to women who never ate FB (O.R. 1.74, 95% CI 1.04, 2.89). Meat ...
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...