CD370 (CLEC9A) antibodies, human - Primary antibodies - Antibodies - MACS Flow Cytometry - Products - Miltenyi Biotec - Great...
Clone REA976 recognizes the human CD370 antigen, also known as C-type lectin domain family 9 member A (CLEC9A). CD370 is a type II transmembrane glycoprotein member of 241 amino acids with a predicted molecular mass of ~30 kDa. It is also known as DNGR-1 and is expressed on BDCA-3+ myeloid dendritic cells from peripheral blood and lymphoid tissues. CD370 acts as a receptor for necrotic cells and plays an important role in cross-presentation. Additional information: Clone REA976 displays negligible binding to Fc receptors. - Great Britain
CD370 (CLEC9A) Antibody, anti-human, REAfinity™ - Recombinant antibodies - MACS Antibodies - Products - Miltenyi Biotec - España
Clone REA976 recognizes the human CD370 antigen, also known as C-type lectin domain family 9 member A (CLEC9A). CD370 is a type II transmembrane glycoprotein member of 241 amino acids with a predicted molecular mass of ~30 kDa. It is also known as DNGR-1 and is expressed on BDCA-3+ myeloid dendritic cells from peripheral blood and lymphoid tissues. CD370 acts as a receptor for necrotic cells and plays an important role in cross-presentation.Additional information: Clone REA976 displays negligible binding to Fc receptors. - España
PE anti-human CD13 Antibody anti-CD13 - WM15
PE anti-human CD13 Antibody - CD13 is a 150-170 kD type II transmembrane glycoprotein also known as aminopeptidase N, APN, and gp150.
CD38 (ADP Ribosyl Cyclase I) Antibody - Without BSA and Azide - Mouse Monoclonal Antibody [Clone AT2 ] IF, FC - Buy Now! |Abgent
CD38 (ADP Ribosyl Cyclase I) Antibody - Without BSA and Azide, Mouse Monoclonal Antibody [Clone AT2 ] validated in IF, FC (AH12737-100), Abgent
The ecto-enzyme CD38 is a nicotinic acid adenine dinucleotide phosphate (NAADP) synthase that couples receptor activation to...
Nicotinic acid adenine dinucleotide phosphate (NAADP) is the most potent Ca(2+)-mobilizing intracellular messenger and is linked to a variety of stimuli and cell surface receptors. However, the enzyme responsible for endogenous NAADP synthesis in vivo is unknown, and it has been proposed that another enzyme differing from ADP-ribosyl cyclase family members may exist. The ecto-enzyme CD38, involved in many functions as diverse as cell proliferation and social behavior, represents an important alternative. In pancreatic acinar cells, the hormone cholecystokinin (CCK) stimulates NAADP production evoking Ca(2+) signals by discharging acidic Ca(2+) stores and leading to digestive enzyme secretion. From cells derived from CD38(-/-) mice, we provide the first physiological evidence that CD38 is required for endogenous NAADP generation in response to CCK stimulation. Furthermore, CD38 expression in CD38-deficient pancreatic AR42J cells remodels Ca(2+)-signaling pathways in these cells by restoring Ca(2+)
ADP ribosyl Cyclase - Medical Dictionary online-medical-dictionary.org
A Membrane-bound or cytosolic enzyme that catalyzes the synthesis of Cyclic ADP-Ribose (cADPR) from Nicotinamide Adenine Dinucleotide (NAD). This enzyme generally catalyzes the Hydrolysis of cADPR to ADP-Ribose, as well, and sometimes the synthesis of Cyclic ADP-Ribose 2 phosphate (2-P-cADPR) from NADP ...
Formation and hydrolysis of cyclic ADP-ribose catalyzed by lymphocyte antigen CD38
CD38 is a 42-kilodalton glycoprotein expressed extensively on B and T lymphocytes. CD38 exhibits a structural homology to Aplysia adenosine diphosphate (ADP)-ribosyl cyclase. This enzyme catalyzes the synthesis of cyclic ADP-ribose (cADPR), a metabolite of nicotinamide adenine dinucleotide (NAD +) with calcium-mobilizing activity. A complementary DNA encoding the extracellular domain of murine CD38 was constructed and expressed, and the resultant recombinant soluble CD38 was purified to homogeneity. Soluble CD38 catalyzed the formation and hydrolysis of cADPR when added to NAD+. Purified cADPR augmented the proliferative response of activated murine B cells, potentially implicating the enzymatic activity of CD38 in lymphocyte function ...
A unified mechanism of enzymatic synthesis of two calcium messengers: cyclic ADP-ribose and NAADP
Cyclic ADP-ribose (cADPR) and nicotinic acid adenine dinucleotide phosphate (NAADP) mobilize Ca2+ from two different types of intracellular stores and through completely independent mechanisms. The two Ca2+ messengers are also structurally distinct. cADPR is a cyclic nucleotide derived from NAD, whi …
Purified anti-human CD70 Antibody anti-CD70 - 113-16
Purified anti-human CD70 Antibody - CD70, also known as CD27L, is a 50 kD type II transmembrane glycoprotein and member of the tumor necrosis factor superfamily.
A1 northbound access from A639 | Northbound | Accident - Massive Hits
Location : The A1 northbound entry slip from the A639 . Reason : Road traffic collision. Status : Currently Active. Time To Clear : The event is expected to clear between 15:15 and 15:30 on 20 June 2021. Return To Normal : Normal traffic conditions are expected between 15:15 and 15:30 on 20 June 2021. Lanes Closed : All lanes are closed. ...
ADP-ribosyl cyclase 2 | definition of ADP-ribosyl cyclase 2 by Medical dictionary
Looking for online definition of ADP-ribosyl cyclase 2 in the Medical Dictionary? ADP-ribosyl cyclase 2 explanation free. What is ADP-ribosyl cyclase 2? Meaning of ADP-ribosyl cyclase 2 medical term. What does ADP-ribosyl cyclase 2 mean?
Chemical synthesis of the second messenger nicotinic acid adenine dinucleotide phosphate by total synthesis of nicotinamide...
Signaling dinucleotides: The first single-isomer synthesis of nicotinamide adenine dinucleotide phosphate (NADP) is reported. Installation and maintenance of sensitive phosphate and pyridinium functionalities were key to success. Significantly, conversion of NADP into the important mammalian second
Chemical synthesis of the second messenger nicotinic acid adenine dinucleotide phosphate by total synthesis of nicotinamide...
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
Chemical synthesis of the second messenger nicotinic acid adenine dinucleotide phosphate by total synthesis of nicotinamide...
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
Degradation of the novel calcium mobilizing messenger, nicotinic acid adenine dinucleotide phosphate, is calcium-dependent. -...
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
EXBIO Antibodies Product Data Sheet
CD38 (NAD+ glycohydrolase) is a type II transmembrane glycoprotein able to induce activation, proliferation and differentiation of mature lymphocytes and mediate apoptosis of myeloid and lymphoid progenitor cells. Another role of CD38 is provided by enzymatic activity of its extracellular part. CD38 acts as NAD+ glycohydrolase converting NAD+ into ADP-ribose, as ADP-ribosyl cyclase producing cADPR and as cADPR hydrolase, thus affecting levels of calcium-mobilizing metabolites. ADPR produced by CD38 serves as an important second messenger of neutrophil and dendritic cell migration ...
Human lymphocyte antigen CD38 catalyzes the production of cyclic ADP-ribose. - Oxford Neuroscience
The human lymphocyte antigen CD38 has been shown to share sequence homology with ADP-ribosyl cyclase, the enzyme that catalyzes the conversion of NAD+ to cyclic ADP-ribose (cADPR), a potent Ca(2+)-mobilizing agent. In this study COS1 cells from African Green Monkey kidney were transiently transfected with CD38 cDNA, inducing expression of authentic CD38 on the cell surface. We demonstrate that CD38 expressed in this manner can convert NAD+ to cADPR in the extracellular medium as assessed by Ca2+ release from sea-urchin egg microsomes.
BB700 Mouse Anti-Human CD38
|span style=font-family:Times,serif;font-size:9pt;>The HB7 monoclonal antibody specifically binds to human CD38. CD38 is a type II transmembrane glycoprotein of 45 kDa with a protein core of 35 kDa. The CD38 antigen is expressed on essentially all pre-B lymphocytes, plasma cells, and thymocytes. It is also present on activated T lymphocytes, natural killer (NK) lymphocytes, myeloblasts, and erythroblasts. The antigen is expressed during the early stages of T- and B-lymphocyte differentiation, is lost during the intermediate stages of maturation, and then reappears during the final stages of maturation. The CD38 antigen is expressed on 90% of CD34+ cells, and is not expressed on pluripotent stem cells. Coexpression of CD38 antigen on CD34+ cells indicates lineage commitment of those cells. CD38 is a counter-receptor of CD31. It is also expressed in T- and B-acute lymphoblastic leukemia (ALL), Burkitts lymphoma, multiple myeloma, acute myeloid leukemia (AML), and chronic lymphocytic leukemia (CLL).|
Leukocyte Surface Antigen CD47 - ACROBiosystems
ACROBiosystems provides a unique set of CD47-relevant products, including mutilple avi tag pre-biotinylated proteins, for rapid high throughput screening.
T-cell surface antigen CD2 (P06729) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Quantitative differences in phospho MFI values distingu | Open-i
Quantitative differences in phospho MFI values distinguish ERA.The data from Figure 3 are plotted to (A) compare the CD8 MFI range/CD4 MFI range for each of p-A
CLEC12A - Википедия
Входит в надсемейство белков лектины C-типа/лектино-подобный домен C-типа (CTL/CTLD). Белки этого надсемейства имеют похожую конформацию и обладают различными функциями, включая клеточную адгезию, межклеточную передачу сигнала, обмен гликопротеинов, участие в воспалении и иммунном ответе. CLL-1 является отрицательным регулятором гранулоцитарных и моноцитарных функций. ...
Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5...
MarketResearchReports.biz has recently announced the addition of a market study Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) - Pipeline Review, H2 2016 , is a comparative analysis of the global market.. Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) - Pipeline Review, H2 2016. Summary. Global Markets Directs, Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) - Pipeline Review, H2 2016, provides in depth analysis on Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) targeted pipeline therapeutics.. The report provides comprehensive information on the Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or ...
Nicotinic acid adenine dinucleotide phosphate regulates skeletal muscle differentiation via action at two-pore channels. -...
Calcium signaling is essential for the differentiation of many cell types, including skeletal muscle cells, but its mechanisms remain elusive. Here we demonstrate a crucial role for nicotinic acid adenine dinucleotide phosphate (NAADP) signaling in skeletal muscle differentiation. Although the inositol trisphosphate pathway may have a partial role to play in this process, the ryanodine signaling cascade is not involved. In both skeletal muscle precursors and C2C12, cells interfering with NAADP signaling prevented differentiation, whereas promoting NAADP signaling potentiated differentiation. Moreover, siRNA knockdown of two-pore channels, the target of NAADP, attenuated differentiation. The data presented here strongly suggest that in myoblasts, NAADP acts at acidic organelles on the recently discovered two-pore channels to promote differentiation.
Nicotinic Acid Adenine Dinucleotide Phosphate Mediates Ca2+ Signals and Contraction in Arterial Smooth Muscle via a Two-Pool...
Thank you for your interest in spreading the word on Circulation Research.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address. ...
Emerging Roles of NAD+ and Its Metabolites in Cell Signaling | Science Signaling
Nicotinamide adenine dinucleotide (NAD+) is the universal currency of energy metabolism and electron transfer. Recent studies indicate that apart from its role as a coenzyme, NAD+ and its metabolites also function in cell signaling pathways; for example, they are substrates for nucleotide-metabolizing enzymes and ligands for extra- and intracellular receptors and ion channels. Moreover, the NAD+ and NAD+ phosphate metabolites adenosine 5′-diphosphoribose (ADP-ribose), cyclic ADP-ribose, and nicotinic acid adenine dinucleotide phosphate (NAADP) have emerged as key second messengers in Ca2+ signaling. A symposium in Hamburg, Germany, brought together 120 researchers from various fields, who were all engaged in the molecular characterization of the key players of NAD+ signaling (www.NAD2008.de).. ...
MME - Elisa kits supplier for Research
Description: This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5 untranslated region of this gene is alternatively spliced, resulting in four separate mRNA transcripts. The coding region is ...
Cadp-ribose - Alfa Chemistry
Cadp-ribose/ACM119340535 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
Antigens, CD38 | Profiles RNS
A bifunctional enzyme that catalyzes the synthesis and HYDROLYSIS of CYCLIC ADP-RIBOSE (cADPR) from NAD+ to ADP-RIBOSE. It is a cell surface molecule which is predominantly expressed on LYMPHOID CELLS and MYELOID CELLS ...
Ryanodine receptor subtype 2 encodes Ca2+ oscillations activated by acetylcholine via the M2 muscarinic receptor/cADP-ribose...
Although activation of M2 muscarinic receptors is classically known to inhibit adenylyl cyclase activity (Peralta et al., 1988) or to modify membrane potential by inhibiting Ca2+-activated K+ channel (Kotlikoff et al., 1992), it has been recently proposed that M2 muscarinic receptors may induce Ca2+ signals by activation of the cADPR pathway (White et al., 2003) or by stimulation of a voltage-dependent Ca2+ channel (Cav1.2b) via the phosphatidylinositol 3-kinase/PKC pathway (Callaghan et al., 2004). Activation of the cADPR pathway by ACh in duodenum myocytes is shown by: (1) inhibition of Ca2+ oscillations by application of the cADPR competitive antagonist (8Br-cADPR), (2) inhibition of ACh-induced Ca2+ oscillations by inhibitors of ADP-ribosyl cyclase (ZnCl2, anti-CD38 antibody) and (3) detection of ADP-ribosyl cyclase activity by fluorescence experiments as the enzyme cyclizes NGD+ (non fluorescent) to produce cGDPR, a fluorescent compound (Graeff et al., 1994). This method has been used ...
KEGG PATHWAY: pps04020
The other principal source of Ca2+ for signalling is the internal stores that are located primarily in the endoplasmic/sarcoplasmic reticulum (ER/SR), in which inositol-1,4,5-trisphosphate receptors (IP3Rs) or ryanodine receptors (RYRs) regulate the release of Ca2+. The principal activator of these channels is Ca2+ itself and this process of Ca2+-induced Ca2+ release is central to the mechanism of Ca2+ signalling. Various second messengers or modulators also control the release of Ca2+. IP3, which is generated by pathways using different isoforms of phospholipase C (PLCbeta, delta, epsilon, gamma and zeta), regulates the IP3Rs. Cyclic ADP-ribose (cADPR) releases Ca2+ via RYRs. Nicotinic acid adenine dinucleotide phosphate (NAADP) may activate a distinct Ca2+ release mechanism on separate acidic Ca2+ stores. Ca2+ release via the NAADP-sensitive mechanism may also feedback onto either RYRs or IP3Rs. cADPR and NAADP are generated by CD38. This enzyme might be sensitive to the cellular metabolism, ...
7-Deaza-8-bromo-cyclic ADP-ribose, the first membrane-permeant, hydrolysis-resistant cyclic ADP-ribose antagonist. - Department...
Cyclic ADP-ribose (cADPR) is a putative second messenger that has been demonstrated to mobilize Ca2+ in many cell types. Its postulated role as the endogenous regulator of ryanodine-sensitive Ca2+ release channels has been greatly supported by the advent and use of specific cADPR receptor antagonists such as 8-NH2-cADPR (Walseth, T. F., and Lee, H. C. (1993) Biochim. Biophys. Acta 1178, 235-242). However, investigations of the role of cADPR in physiological responses, such as fertilization, stimulus-secretion coupling, and excitation-contraction coupling, have been hindered by the susceptibility of cADPR receptor antagonists to hydrolysis and the need to introduce these molecules into cells by microinjection or patch clamp techniques. We have recently reported on the discovery of a poorly hydrolyzable analogue of cADPR, 7-deaza-cADPR (Bailey, V. C., Sethi, J. K., Fortt, S. M., Galione, A., and Potter, B. V. L. (1997) Chem. Biol. 4, 41-51) but this, like cADPR, is an agonist of ryanodine-sensitive Ca2+
Mutant p53 enhances leukemia-initiating cell self-renewal to promote leukemia development<...
TY - JOUR. T1 - Mutant p53 enhances leukemia-initiating cell self-renewal to promote leukemia development. AU - Nabinger, Sarah C.. AU - Chen, Sisi. AU - Gao, Rui. AU - Yao, Chonghua. AU - Kobayashi, Michihiro. AU - Vemula, Sasidhar. AU - Fahey, Aidan C.. AU - Wang, Christine. AU - Daniels, Cecil. AU - Boswell, H. Scott. AU - Sandusky, George E.. AU - Mayo, Lindsey D.. AU - Kapur, Reuben. AU - Liu, Yan. PY - 2019/6/1. Y1 - 2019/6/1. UR - http://www.scopus.com/inward/record.url?scp=85060583910&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=85060583910&partnerID=8YFLogxK. U2 - 10.1038/s41375-019-0377-0. DO - 10.1038/s41375-019-0377-0. M3 - Letter. C2 - 30675010. AN - SCOPUS:85060583910. VL - 33. SP - 1535. EP - 1539. JO - Leukemia. JF - Leukemia. SN - 0887-6924. IS - 6. ER - ...
Cyclic ADP-ribose and hydrogen peroxide synergize with ADP-ribose in the activation of TRPM2 channels
Cyclic ADP-ribose and hydrogen peroxide synergize with ADP-ribose in the activation of TRPM2 channels. Mol Cell. 2005 Apr 1;18(1):61-9. PMED ID: 15808509. ...
Gene Ontology Classifications
Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5' untranslated region of this gene is ...
TumorPortal
This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases ...
Mutagenetix > Incidental...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases. [provided by RefSeq, Jul 2008 ...
Negative feedback control of neuronal activity by microglia | Nature
Microglia, the brains resident macrophages, help to regulate brain function by removing dying neurons, pruning non-functional synapses, and producing ligands that support neuronal survival1. Here we show that microglia are also critical modulators of neuronal activity and associated behavioural responses in mice. Microglia respond to neuronal activation by suppressing neuronal activity, and ablation of microglia amplifies and synchronizes the activity of neurons, leading to seizures. Suppression of neuronal activation by microglia occurs in a highly region-specific fashion and depends on the ability of microglia to sense and catabolize extracellular ATP, which is released upon neuronal activation by neurons and astrocytes. ATP triggers the recruitment of microglial protrusions and is converted by the microglial ATP/ADP hydrolysing ectoenzyme CD39 into AMP; AMP is then converted into adenosine by CD73, which is expressed on microglia as well as other brain cells. Microglial sensing of ATP, the ensuing
Murine Stromal Cells Counteract the Loss of Long-Term Culture-Initiating Cell Potential Induced by Cytokines in CD34+CD38low...
Abstract. Evidence has been provided recently that shows that high concentrations of cytokines can fulfill functions previously attributed to stromal cells, su
T- surface antigen CD2, (CD2-2) Antibody | Technique alternative | 03012544598 - AniGenetics
productone is a polyclonal antibody of high purity and binding affinity for the antigen that it is risen against. Properly used, this antibody will ensure excellent and reproducible results with guaranteed success for the applications that it is tested in. Polyclonal antibodies have series of advantages - larger batches can be supplied at a time, they are inexpensive to manufacture and respectively to buy, the time needed for production is considerably shorter. Polyclonal antibodies generally are more stable and retain their reactivity under unfavorable conditions. To obtain more detailed information on productone, please, refer to the full product datasheet ...
Social Mobilizer Jobs in Pakistan | Latest September 2021 Jobs
Social Mobilizer Jobs in Pakistan for the month of September 2021. You can find Social Mobilizer Jobs online at JobStock in Pakistan.
Cancer Stem Cell News: Imatinib refractoriness of leukemia-initiating cells
From the Editor : I switched some time ago to the use of Twitter, instead of this blog, as a place to post items about selected recent news... ...
MFI2抗体| Abcam中国
购买MFI2兔多克隆抗体(ab115334),MFI2抗体经IHC-P验证,可与人样本反应。产品出库一年都在质保范围内。中国现货速达。
Knowing More About the Cloud-Based Computing in the Health Care Sector
Knowing more about the cloud-based EMR. Learn more about EMRs and EHRs in relation to the healthcare sector. Cloud technology in the health care sector.
Multiple Calcium Stores: Separate but Interacting | Science Signaling
Multiple mechanisms exist for increasing the concentration of intracellular calcium. This Perspective by Lee is one in a series on intracellular calcium release mechanisms and focuses on the calcium store operated by nicotinic acid adenine dinucleotide phosphate (NAADP). The characterization of the NAADP-operated calcium store as separate from the inositol trisphosphate (IP3)-operated and cyclic ADP-ribose (cADPR)-operated calcium stores is discussed. Lee also addresses the role of NAADP in regulating intracellular calcium fluctuations during fertilization and hormonal activation of pancreatic acinar cells.. ...
Dr Julia Gerasimenko - People - Cardiff University
As the result of successful collaboration with Dr. K. Mikoshibas laboratory in RIKEN Brain Science Institute, Tokyo, Japan, we found that pancreatic protease activation by alcohol metabolite mainly depends on Ca2+ release via acid store IP3 receptors (Gerasimenko J. et al, PNAS, 2009). Currently there is no specific pharmacological treatment for pancreatitis. However, now our research has identified the critical proteins responsible for the excessive calcium release which is where the problem begins with the possibility to search for specific chemical compounds for the treatment of acute pancreatitis.. I am investigating the action of nicotinic acid adenine dinucleotide phosphate (NAADP), a novel Ca2+ releasing messenger and its role in the induction of pathological processes of exocrine pancreas. Our findings (Gerasimenko J, et al., JCS, 2006) show that the NAADP-sensitive Ca2+ pool is located in the endoplasmic reticulum and in acidic organelles, which are represented by secretory granules, ...
Most recent papers with the keyword umbilical cord stem cells | Read by QxMD
The ectoenzymes CD39 and CD73 regulate the purinergic signaling through the hydrolysis of adenosine triphosphate (ATP)/ADP to AMP and to adenosine (Ado), respectively. This shifts the pro-inflammatory milieu induced by extracellular ATP to the anti-inflammatory regulation by Ado. Mesenchymal stem cells (MSCs) have potent immunomodulatory capabilities, including monocyte modulation toward an anti-inflammatory phenotype aiding tissue repair. In vitro, we observed that human cardiac adipose tissue-derived MSCs (cATMSCs) and umbilical cord MSCs similarly polarize monocytes toward a regulatory M2 phenotype, which maintained the expression of CD39 and induced expression of CD73 in a cell contact dependent fashion, correlating with increased functional activity ...
CD2 - T-cell surface antigen CD2 precursor - Equus caballus (Horse) - CD2 gene & protein
CD2 interacts with lymphocyte function-associated antigen (LFA-3) to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.
The Mobilizer Archetype. Case Study From the 7 Archetypes of… | by idmloco | Medium
Celebrity is a fickle thing. Some who have it prefer to hide - the Kevin Spaceys, Dave Chapelles and Doris Days of the world - while others seem to relish the spotlight - the Kanye Wests, Joseph…
Thyrotropin-releasing hormone-degrading ectoenzyme
MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGA 1 - 70 SATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLR 71 - 140 LSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFL 141 - 210 YPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFD 211 - 280 EPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGV 281 - 350 VVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL 351 - 420 LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLT 421 - 490 DVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYG 491 - 560 NAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKAL 561 - 630 KLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRL 631 - 700 LIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDR 701 - 770 MENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW 771 - 840 ...
30 Mango Butter Recipes
Mango butter is a cosmetic ingredient with deep moisturizing, softening and soothing properties. Since this butter is great for skin, it is perfect to add to any of your bath and body products. It is so wonderful that we couldnt go without recognizing 30 Mango Butter Recipes that have been formulated at Natures Garden. These various soap and cosmetic recipes are amazing for your skin and are free for you to create at any time. Not only do all of these recipes contain this skin-loving butter, but they have other properties in addition. In this craft blog, we will talk about many of our recipes that use mango butter to create an amazing product. So, take a look at some of our recipes for fantastic bath and body products!. ...