Bone Alkaline Phosphatase Antibody | Alkaline Phosphatase, Bone | Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody
Bone Alkaline Phosphatase, also known as Bone Specific Alkaline Phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takaras Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20-49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.. ...
Bone Alkaline Phosphatase Antibody | Alkaline Phosphatase, Bone | Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody
Bone Alkaline Phosphatase, also known as Bone Specific Alkaline Phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takaras Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20-49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.. ...
Quantitative method for determining serum alkaline phosphatase isoenzyme activity: estimation of intestinal component. |...
Intestinal alkaline phosphatase activity was measured using levamisole inhibition, and results were compared with a previously reported method using L-phenylalanine. Sixty two per cent intestinal, 39% placental, and 1.3% of either bone or liver alkaline phosphatase activity remained when alkaline phosphatase activity was inhibited in a 2-amino-2-methyl-1-propanol (AMP) buffer reagent system with 10 mmol/l levamisole (final assay concentration 8.1 mmol/l). The assay imprecision (SD) was 0.6 U/l compared with 3.9 U/l using L-phenylalanine for specimens with total alkaline phosphatase activity less than 250 U/l (reference range 30-120 U/l). In serum pools with raised total alkaline phosphatase activity errors in recovered intestinal activity were small (usually less than 3 U/l) when intestinal alkaline phosphatase was added. Much larger errors and many underestimated results were found using L-phenylalanine. For non-haemolysed specimens it is concluded that an assay based on levamisole inhibition ...
Benign Transient Hyperphosphatasemia Associated With Epstein-Barr Virus Enteritis in a Pediatric Liver Transplant Patient: A...
TY - JOUR. T1 - Benign Transient Hyperphosphatasemia Associated With Epstein-Barr Virus Enteritis in a Pediatric Liver Transplant Patient. T2 - A Case Report. AU - Hranjec, T.. AU - Bonatti, H.. AU - Roman, A. L.. AU - Sifri, C.. AU - Borowitz, S. M.. AU - Barnes, B. H.. AU - Flohr, T. R.. AU - Pruett, T. L.. AU - Sawyer, R. G.. AU - Schmitt, T. M.. PY - 2008/6. Y1 - 2008/6. N2 - Transient hyperphosphatasemia was found in a 3-year-old male liver transplant recipient. The condition was associated with diarrheal disease due to the Epstein-Barr virus (EBV). Immunosuppression was tapered and valganciclovir prescribed for 3 months, after which the diarrhea resolved and the EBV polymerase chain reaction assays became negative. After 6 months, alkaline phosphatase levels normalized. Isolated elevation of alkaline phosphatase in conjunction with enteric infection is a rare condition. No further diagnostic or therapeutic interventions except treatment of the underlying infection are needed, as this has ...
High serum alkaline phosphatase levels, a study in 181 Thai adult hospitalized patients | BMC Family Practice | Full Text
During the one-year period, a total of 181 hospitalized patients with serum ALP level over 1000 IU/L were identified. They were 102 male and 96 female patients with ages ranging from 21 to 90 years old (mean age 49.4 ± 16.1 years). The ALP levels ranged from 1,001 to 3,067 IU/L.. The most common diagnosis in patients with high ALP in our series was malignant biliary obstruction. This was found in 58 patients, 48 of whom were cases with cholangicocarcinoma (CCA). Of the remaining 10, three were with pancreatic cancer, one with ampullary cancer, one with metastatic cancer, and five with periampullary cancer. The ALP levels ranged from 1,005 to 3,067 IU/L (average 1,869.8 ± 325.3 IU/L). In addition, benign duct obstruction from choledocholithiasis was found in another 14 patients, six of which cases were complicated by ascending cholangitis. The ALP level in this group ranged from 1,001 to 2,864 IU/L (average 1,498.3 ± 541.2 IU/L). Comparing these two groups, the mean ALP levels in the malignant ...
Immobilization of alkaline phosphatase on magnetic particles by site-specific and covalent cross-linking catalyzed by microbial...
TY - JOUR. T1 - Immobilization of alkaline phosphatase on magnetic particles by site-specific and covalent cross-linking catalyzed by microbial transglutaminase. AU - Moriyama, Kousuke. AU - Sung, Kyunga. AU - Goto, Masahiro. AU - Kamiya, Noriho. N1 - Funding Information: We are grateful to Ajinomoto Co., Inc. (Japan) for providing MTG samples. This work was supported by a Grant-in-Aid for the Global COE program Science for Future Molecular Systems, from the Ministry of Education, Culture, Sports, Science and Technology of Japan .. PY - 2011/6. Y1 - 2011/6. N2 - Bacterial alkaline phosphatase (BAP) was site-specifically and covalently immobilized on magnetic particles (MPs) using the enzymatic reaction of microbial transglutaminase (MTG). Immobilization efficiency was affected by the chemical surface treatment of MPs and immobilized BAP exhibited more than 90% of the initial activity after 10 rounds of recycling.. AB - Bacterial alkaline phosphatase (BAP) was site-specifically and covalently ...
Recombinant Human intestinal alkaline phosphatase protein (ab114266) | Abcam
Recombinant Human intestinal alkaline phosphatase protein is a Wheat germ Protein fragment 74 to 162 aa range and validated in WB, ELISA, SDS-PAGE.
Alkaline phosphatase levels in children - Doctor answers
Alkaline phosphatase levels in children - Medicine for high alkaline phosphatase levels? Wrong approach. Alkaline phosphatase is a lab value to tell a physician what is happening, not a medical problem to treat. It can be high just because you
Tips From Other Journals - American Family Physician
Treatment of Pagets disease of bone traditionally has been limited to patients with severe disease, defined as serum alkaline phosphatase levels of more than two times the upper limit of normal, bone pain not responsive to analgesics and higher risk for complications such as fracture. Newer antiresorptive treatments, including pamidronate, alendronate, tiludronate and etidronate, offer more widespread therapeutic intervention and shorter treatment courses. Risedronate is a pyridinyl bisphosphonate that is about 1,000 times more potent than etidronate and three to five times more potent than alendronate. These attributes allow for a shorter duration of treatment at a lower dosage. Miller and associates compared the effectiveness of risedronate with that of etidronate in the treatment of Pagets disease of bone.. Patients with documented Pagets disease were included if their serum alkaline phosphatase levels were at least two times the upper limit of normal. Women were required to be ...
Characterization of a second promoter for the mouse liver/bone/kidney-type alkaline phosphatase gene: Cell and tissue specific...
TY - JOUR. T1 - Characterization of a second promoter for the mouse liver/bone/kidney-type alkaline phosphatase gene. T2 - Cell and tissue specific expression. AU - Studer, Michela. AU - Terao, Mineko. AU - Giannì, Maurizio. AU - Garattini, Enrico. PY - 1991/9/30. Y1 - 1991/9/30. N2 - The second leader exon and the relative promoter of the mouse liver/bone/kidney-type alkaline phosphatase gene were identified and characterized. The transcription initiation site was determined by S1 mapping analysis. The differential expression of the two alternatively spliced transcripts was assessed in cell lines of different origin and in various tissues by polymerase chain reaction and RNase mapping analysis. The first promoter is active in embryo derived cells, whereas the second promoter is silent in basal conditions but it is activated by dibutyryl cAMP in fibroblastic cells. In the whole animal, the transcript driven by the first promoter is found in most tissues albeit at different levels, while the one ...
ALP isoenzyme test - Symptoms, Treatments and Resources for ALP isoenzyme test
ALP isoenzyme test - MedHelps ALP isoenzyme test Center for Information, Symptoms, Resources, Treatments and Tools for ALP isoenzyme test. Find ALP isoenzyme test information, treatments for ALP isoenzyme test and ALP isoenzyme test symptoms.
Liver test done, shows albumin serum, alkaline phosphate, SGPT, SGOT levels. Normal report? - Doctors insight on...
Question - Liver test done, shows albumin serum, alkaline phosphate, SGPT, SGOT levels. Normal report?. Ask a Doctor about Alkaline phosphates, Ask a Gastroenterologist
Leukocyte Alkaline Phosphatase Decreased: Causes & Diagnoses | Symptoma.com
Leukocyte Alkaline Phosphatase Decreased Possible Causes (Differential Diagnoses) include ❗ Infectious Mononucleosis ❗ Chronic Lymphocytic Leukemia ❗ Chronic Myeloid Leukemia ❗ Check more at Symptoma.com
Elevated alkaline phosphatase - Liver Disorders - MedHelp
I recently had a liver function test as part of my regular blood work. My alkaline phosphatase level was 145.0, where the normal range is 35.0-123.0. My doctor told me that the results indicated that...
E7389 Versus Treatment of Physician's Choice in Patients With Locally Recurrent or Metastatic Breast Cancer - Full Text...
Adequate liver function as evidenced by bilirubin ,= 1.5 times the upper limits of normal (ULN) and alkaline phosphatase, alanine aminotransferase (ALT), and aspartate aminotransferase (AST) ,= 3 x ULN (in the case of liver metastases ,= 5 x ULN), unless there are bone metastases, in which case liver specific alkaline phosphatase must be separated from the total and used to assess the liver function instead of the total alkaline phosphatase. In case alkaline phosphatase is ,3 x ULN (in absence of liver metastases) or , 5 x ULN (in presence of liver metastases) AND patient is known to have bone metastases, the liver specific alkaline phosphatase must be separated from the total and used to assess the liver function instead of the total alkaline phosphatase ...
ALKALINE PHOSPHATASE
Serum alkaline phosphatase levels are of interest in the diagnosis of hepatobiliary disorders and bone disease associated with increased osteoblastic activity. Moderate elevations of alkaline phosphatase may be seen in several conditions that do not involve the liver or bone. Among these are Hodgkins disease, congestive heart failure, ulcerative colitis, regional enteritis, and intra-abdominal bacterial infections. Elevations are also observed during the third trimester of pregnancy.. ...
Alkaline Phosphatase Assay Kit (ab83371) | Abcam
Assay Alkaline phosphatase in 1 hr in cell culture media, cell/tissue extracts, and biofluids with Alkaline Phosphatase Assay Kit (Fluorometric) ab83371. For microplate readers.
GastroHep News Story
The doctors found that the median survival time from the diagnosis of AIDS and AIDS cholangiopathy was 23 and 9 months, respectively. In addition, they determined that HAART significantly improved the mortality of patients with AIDS cholangiopathy.. The team determined that any opportunistic infection of the digestive tract, lung, eye, nervous system, skin, or systemic involvement at diagnosis was an indicator of poor prognosis.. They also found that patients with high serum ALP levels tended to have a shorter life expectancy than those with normal or slightly elevated serum ALP levels. However, CD4 lymphocyte counts, type of cholangiopathy, and the performance of sphincterotomy were not correlated with patient survival.. Dr Wei-Fang Kos team concluded, HAART administration most likely accounts for the recent dramatic improvement in survival of patients with AIDS cholangiopathy. Underlying immunosuppressive status, reflected by the presence or history of any opportunistic infections, is ...
The efficacy of modified neutrophil alkaline phosphatase score, serum IL-6, IL-18 and CC16 levels on the prognosis of moderate...
The efficacy of modified neutrophil alkaline phosphatase score, serum IL-6, IL-18 and CC16 levels on the prognosis of moderate and severe COPD patients, Jinbiao Zhang, Rongqin Dai,
IntechOpen Open Access Publisher - Open Science Open Minds | IntechOpen
Royal Jelly and Human Interferon-Alpha (HuIFN-αN3) Affect Proliferation, Glutathione Level, and Lipid Peroxidation in Human Colorectal Adenocarcinoma Cells In Vitro. By Bratko Filipič, Lidija Gradišnik, Klemen Rihar, Adriana Pereyra, Damir Đermić and Hrvoje Mazija. The purpose was to investigate the influence of RJ-F(M), 10-hydroxy-2-decenoic acid and HuIFN-αN3 on the proliferation of CaCo-2 cells and ascertain their effects on intracellular glutathione level and lipid peroxidation. The antiproliferative (AP) activity of RJ-F (M) (0.1 g/10 mL PBS), HuIFN-αN3 (1000 IU mL−1), 10-HDA (100.0 μmol L−1) and their combinations, in the ratios 1:1, 1:2, and 2:1 on CaCo-2 cells were measured. Single RJ-F (M) had a low AP activity: 2.0 (0.5 mg mL−1). HuIFN-αN3 had an AP activity of 2.5 (208.33 IU mL−1), while 10-HDA had an AP activity of 1.5 (37.5 μmol mL−1). AP activity of 3.8 was obtained when RJ-F(M) and HuIFN-αN3 were in the ratio 2:1. In it, the level of GSH was 24.9 ± 2.4 nmol ...
Alkaline phosphatase. I. Comparison of the physical and chemical properties of enzyme preparations from mammalian cell cultures...
TY - JOUR. T1 - Alkaline phosphatase. I. Comparison of the physical and chemical properties of enzyme preparations from mammalian cell cultures, various animal tissues, and Escherichia coli. AU - Cox, Rody P.. AU - Griffin, Martin J.. PY - 1967/12. Y1 - 1967/12. N2 - Some of the chemical and physical properties of alkaline phosphatase preparations derived from mammalian tissues, cell cultures, and E. coli have been compared. A number of chemical and physical properties of the various enzyme preparations are similar, such as the concentration of cysteine and histidine that inhibits alkaline phosphatase activity, and the phosphotransferase activity of different enzyme preparations. Other properties of the various alkaline phosphatases are markedly different, such as heat stability at 56 °, electrophoretic mobility, and the concentrations of Zn ions, L-phenylalanine, and L-tryptophan required to inhibit enzyme activity by 50%. These differences provide a means of distinguishing between alkaline ...
The study of biogenesis and secretion of alkaline phosphatase and its mutant forms in Escherichia coli. I. Introduction of...
TY - JOUR. T1 - The study of biogenesis and secretion of alkaline phosphatase and its mutant forms in Escherichia coli. I. Introduction of mutations into alkaline phosphatase gene. AU - Karamyshev, A. L.. AU - Shlyapnikov, M. G.. AU - Khmelnitsky, M. I.. AU - Nesmeyanova, M. A.. AU - Ksenzenko, V. N.. PY - 1994. Y1 - 1994. N2 - Various mutations in E. coli alkaline phosphatase gene were obtained by oligonucleotide-directed mutagenesis. They result in amino acid substitutions in the signal peptide cleavage site [Val for Ala(-1)] and in the N terminus of mature polypeptide chain: Ala for Arg(+1) and Gln for Glu(+4); Gln for Glu(+4). Enzyme activity was observed in all E. coli strains transformed by plasmids with cloned mutant genes. In addition, an amber mutation was introduced into the Arg(+1) position, and the synthesis of mutant alkaline phosphatase was shown in E. coli strains containing suppressor tRNAs specific for Ser, Gln, Tyr, Leu, Ala, Glu, Phe, Gly, His, Pro, and Cys.. AB - Various ...
The effect of intestinal alkaline phosphatase on intestinal epithelial cells, macrophages and chronic colitis in mice. | Sigma...
Sigma-Aldrich offers abstracts and full-text articles by [Changhyun Lee, Jaeyoung Chun, Sung Wook Hwang, Seung Joo Kang, Jong Pil Im, Joo Sung Kim].
A CHEMICAL METHOD FOR THE ISOLATION OF HELA CELL NUCLEI AND THE NUCLEAR LOCALIZATION OF HELA CELL ALKALINE PHOSPHATASE |...
M. J. Griffin, R. P. Cox, N. Grujic; A CHEMICAL METHOD FOR THE ISOLATION OF HELA CELL NUCLEI AND THE NUCLEAR LOCALIZATION OF HELA CELL ALKALINE PHOSPHATASE . J Cell Biol 1 April 1967; 33 (1): 200-203. doi: https://doi.org/10.1083/jcb.33.1.200. Download citation file:. ...
Abstract for TR-481
Groups of 10 male and 10 female rats were admin istered 0, 25, 50, 100, 200, or 400 mg oleic acid diethanolamine condensate/kg body weight in ethanol dermally for 13 weeks. All male and female rats survived until the end of the study. The final mean body weights and body weight gains of 200 and 400 mg/kg males and the mean body weight gain of 400 mg/kg females were significantly less than those of the vehicle controls. The only chemical-related clinical finding was irritation of the skin at the site of application in most males administered 100 mg/kg or greater and in all females administered 50 mg/kg or greater. Segmented neutrophil counts were increased relative to the vehicle controls in the 400 mg/kg male group on days 5 and 19, in the 200 mg/kg female group on day 19 and at week 13, and in the 400 mg/kg female group on days 5 and 19 and at week 13. Alkaline phosphatase concentrations were significantly increased in the 200 mg/kg male group on day 19, the 200 mg/kg female group at week 13, ...
British Library EThOS: Alkaline phosphatase forms in plasma : a clinical study
The identification of the source of a raised total alkaline phosphatase activity in plasma, by the measurement of individual ALP forms, is of clinical value although many of the methods available for this purpose are complex, imprecise and non-specific. This thesis has validated, and in some cases modified, available methods for the measurement of the main forms of alkaline phosphatase (ALP; EC 3.1.3.1) in plasma: liver, bone, intestinal and high-molecular-mass ALP. The following methods were selected on the basis of their reliability and specificity: polyacrylamide gel electrophoresis, with densitometric scanning, for liver and bone ALP, an enzyme-linked immunosorbent assay (ELISA) for intestinal ALP and ion-exchange chromatography for high-molccular-mass ALP. These methods were then used to quantify individual ALP forms in specific disease groups and compare activities to those found in healthy adults. The diseases studied (diabetes mellitus and hyperthryoidism) were those where the source of ...
Studies on the subcellular localization of human neutrophil alkaline phosphatase | Journal of Cell Science
The intracellular localization of alkaline phosphatase has been determined in human neutrophils with analytical subcellular fractionation by density gradient centrifugation and EM cytochemistry. Centrifugation on sucrose gradients containing 1 mM DETA and 5 units/ml of heparin showed that alkaline phosphatase was associated with a membranous component distinct from plasma membrane, mitochondria, specific granules and azurophil granules. There was no resolution from the endoplasmic reticulum. Density gradient centrifugation on a sucrose-imidazole-heparin gradient showed a clear resolution of the alkaline phosphatase-containing membranes from the Golgi and endoplasmic reticulum. Density gradient centrifugation of neutrophils that had been disrupted in the presenceof 0.12 mmol/l. digitonin clearly separated alkaline phosphatase-containing membranes from the endoplasmic reticulum. Part of the gamma-glutamyl transferase has a similar localization to that of alkaline phosphatase. EM cytochemistry of ...
Alkaline Phosphatase, Tissue Non-Specific RNAi (H00000249-R01V): Novus Biologicals
Alkaline Phosphatase, Tissue Non-Specific RNAi. Tested Reactivity: Hu. Validated: WB, RNAi, RNAi SP. Backed by our 100% Guarantee.
The levels of Serum Alkaline Phosphatase and Lactate Dehydrogenase in Hodgkin Lymphoma - Iranian Journal of Blood and Cancer
Background: Hodgkins disease (HD) is a neoplastic disease originating in lymphoid tissue, which spreads to lymphoid structures and ultimately nonlymphoid tissues. Lactate Dehydrogenase and Alkaline Phosphatase are increased in blood following membrane cell damage. The aim of this study was to compare Lactate Dehydrogenase and Alkaline Phosphatase levels in children in ...
Am hepatitis B carrier. Taking treatment. Reason for high alkaline phosphate, creatinine? - Doctors insight on HealthcareMagic
Question - Am hepatitis B carrier. Taking treatment. Reason for high alkaline phosphate, creatinine?. Ask a Doctor about diagnosis, treatment and medication for Hepatitis b carrier, Ask a Gastroenterologist
SID.ir | EVALUATING SALIVARY ALKALINE PHOSPHATASE LEVELS AS A BIOCHEMICAL MARKER OF PERIODONTAL DISEASE IN PERIODONTAL PATIENTS...
Download Free Full-Text of an article EVALUATING SALIVARY ALKALINE PHOSPHATASE LEVELS AS A BIOCHEMICAL MARKER OF PERIODONTAL DISEASE IN PERIODONTAL PATIENTS IN A TERTIARY HOSPITAL IN NIGERIA
Transient Bile Duct Obstruction: Response of Serum Bilirubin and Alkaline Phosphatase Levels in the Rat | JAMA Surgery | JAMA...
• The immediate evolution of changes in serum bilirubin and alkaline phosphatase levels during and after brief temporary occlusion (12 hours or less) of the mai
Barry SHANE | Nutritional Sciences & Toxicology | University of California, Berkeley
Most Recent Publications. Bailey, L. B., Stover, P., McNulty, H., Fenech, M., Gregory, J., James Mills, J., Pfeiffer, C. M., Fazili, Z., Zhang, M., Ueland, P., Molloy, A., Caudill, M. A., Shane, B., Berry, R. J., Bailey, R., Raghavan, R. and Raiten, D. (2015) Biomarkers of Nutrition for Development (BOND) - Folate Review. J. Nutr. 145:1636S-80S. Carter, T. C., Pangilinan, F., Molloy, A. M., Fan, R., Wang, Y., Shane, B., Gibney, E. R., Midttun, O., Ueland, P. M, Cropp, C. D., Kim, Y., Wilson, A. F., Bailey-Wilson, J. E., Brody, L. C. and Mills, J. L. (2015) Common variants at putative regulatory sites of the tissue nonspecific alkaline phosphatase gene influence circulating pyridoxal 5-phosphate concentration in healthy adults. J. Nutr. 145:1386-93.. Deac, O. M., Mills, J. L., Shane, B., Midttun, O., Ueland, P. M., Brosnan, J. T., Brosnan, M. E., Laird, E., Gibney, E. R., Fan, R., Wang, Y., Brody, L. C. and Molloy, A. M. (2015) Tryptophan catabolism and vitamin B-6 status are affected by gender ...
Tagging exported proteins using Escherichia coli alkaline phosphatase gene fusions. - PubMed - NCBI
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Titan gel in vendita filippine olx - dverigermes.ru
Alkaline Phosphatase Isoenzymes High Resolution Titan gel in vendita filippine olx Immunofixation Immunoelectrophoresis The alkaline phosphatase ALP isoenzymes found in human serum originate from several sources with the greatest activity occurring in the bone, liver, intestine, and placenta. Because of wide distribution of alkaline phosphatase in tissue, limited information can be obtained from a total ALP assay. Fortunately, the tissue sources of elevated ALP in serum can be determined by identifying the isoenzyme.. The isoenzymes of alkaline phosphatase are unique in that some organs have only one major isoenzyme rather than multiple isoenzyme forms. The isoenzymes of ALP differ in their physicochemical and electrophoretic properties, and it is by taking advantage of these differences that individual isoenzymes can be titan gel in vendita filippine olx. In addition to the liver, bone, intestinal and placental isoenzymes, macrohepatic, Regan, PA, Nagao, and renal isoenzymes have also been ...
What Are the Causes of Elevated Alkaline Phosphatase? | Healthy Living
Erik Steel is a graduate of the University of Michigan, earning his bachelors degree in Russian. Steel has worked as writer for more than four years and has contributed content to eHow and Pluck on Demand. His work recently appeared in the literary journal Arsenic Lobster.. ...
Comparison between bone alkaline phosphatase immunoassay and electrophoresis technique in hemodialysis patients
Background: Problem of the variability between the different methods using for bone alkaline phosphatase(bALP) determination greately influences the clinical significance of bALP as direct marker of bone metabolism.The aim of this study was to compare immunoassay with electrophoresis technique for bALP determination. Methods: We measured bALP in 71 patients on hemodialysis with agar gel electrophoresis (ISO-PAL, SEBIA) and immunoassay (OSTASE, Beckman Coulter).Results: The analyzed methods showed significant correlation (Spearmans rho: 0.776, P , 0.01), but we found statistically significant (P , 0.01) positive bias (27%)for the results measured by immunoassay. In support of this, using electrophoresis technique we have detected presence of the intestinal isoenzymes of alkaline phosphatase in 55% of patients with median value of 30% of the total alkaline phoshatase and presence of liver-2 alkaline phosphatase... isoform in 42% of patients with median value of 16.6%. The Kendalls W of 0.787 ...
Role of Vitamin D3 on Alkaline Phosphatase, Collagen, and Bone Mineralization: Impact of Biofield Energy Healing Treatment -...
Journal: American Journal of Health Research Volume: 6 Issue: 1 Pages: 6-14 Published: January 10, 2018PDF Source: Trivedi EffectAuthors: Bonnie Patrice Hegarty-Diaz, Mahendra Kumar Trivedi, Alice Branton, Dahryn Trivedi, Gopal Nayak, Sambhu C
JFB | Free Full-Text | Biocompatibility and Alkaline Phosphatase Activity of Phosphorylated Chitooligosaccharides on the...
Phosphorylated chitooligosaccharides (P-COS) were prepared using a H3PO4, P2O5, Et3PO4 and hexanol solvent system. The P-COS were characterized by Fourier Transform Infrared Spectroscopy (FT-IR), Thermo gravimetric-Differential Thermal Analyzer (TG-DTA), 13C NMR, 31P NMR, X-ray diffraction analysis, solubility studies, biocompatibility and Alkaline Phosphatase Activity (ALP). The results reveal that phosphorylation occurred at the C3 and C6 position of OH groups and the C2 position of NH2 group. FT-IR confirmed no decomposition in pyranose ring in P-COS even with heating and treatment in acidic conditions. The amorphous nature of P-COS was confirmed by X-ray diffraction analysis. Further, the biocompatibility and alkaline phosphatase activity of P-COS were checked against the osteosarcoma MG63 cell line at different concentrations and no cytotoxicity was observed. After 12 h and 24 h of incubation, the ALP activity of P-COS was higher compared with the control group. These results suggest that P-COS is
Anti-Calf Intestinal Alkaline Phosphatase Antibody (Serum) - Goat Anti-Bovine Polyclonal Antibody IHC-P, IHC-F, E - Buy Now! ...
Anti-Calf Intestinal Alkaline Phosphatase Antibody (Serum), Goat Anti-Bovine Polyclonal Antibody validated in IHC-P, IHC-F, E (ABD10274), Abgent
Quantitation of phospholipase A<sub>2</sub> and phospholipase C activity using alkaline phosphatase impregnated...
TY - JOUR. T1 - Quantitation of phospholipase A2 and phospholipase C activity using alkaline phosphatase impregnated liposomes. AU - Buxton, Thomas B.. AU - Catto, Brian. AU - Horner, Jack. AU - Yannis, Rex. AU - Rissing, J. Peter. PY - 1986/12. Y1 - 1986/12. N2 - Phospholipase A2 and C activity was quantitated using liposomes impregnated with alkaline phosphatase. Release of alkaline phosphatase was dependent on phospholipase related hydrolysis of intact vesicles. Released alkaline phosphatase was quantitated after addition of its chromogenic substrate p-nitrophenyl phosphate. The lower limit of detectability for phospholipase A2 and C activity was 0.5 unit/ml. These limits were 10-fold lower than a titrimetric method. Liposome destruction as measured by alkaline phosphatase release was calcium dependent and inhibited by 1 mM EDTA and 1 mM ZnSO4. The assay was technically simple, generated same day results, and used automated enzyme-linked immunosorbent assay instrumentation.. AB - ...
Abstract 18200: Sortilin Levels Correlated With Renal Function and Reduced by Strong Statins With Increased PCSK9 in Primary...
Sortilin is encoded by the well-known cardiovascular risk gene SORT1, however Sortilin seems to modulate cardiovascular disease not only with lipids, and its function has not been well elucidated. Recent basic reports showed new aspects of Sortilin that it can bind to PCSK9, and also can enhance vascular calcification with non-lipid tissue nonspecific alkaline phosphatase. We investigated the clinical roles of Sortilin in statin-treated primary dyslipidemia.. Methods: A total of 62 patients (Male 33, Age 65±11 yrs) with primary dyslipidemia including 18 genetically confirmed heterozygous familial hypercholesterolemia were included. Non-FH group was treated with 10mg Atorvastatin, and FH group was treated with 20mg Rosuvastatin for 8 weeks. ELISA determined plasma levels of Sortilin and PCSK9 (free-fragment and hetero-dimer).. Results: Strong statins lowered LDL-C (-44% in non-FH, -54% in FH), and increased hetero-dimer PCSK9 (+21% in non-FH, +102% in FH) but not in free-fragment PCSK9. Statins ...
ALKALINE PHOSPHATASE RESEARCH: Tumor necrosis factor-α increases alkaline phosphatase expression in vascular smooth muscle...
Vascular calcification is implicated in many diseases including atherosclerosis and diabetes. Tumor necrosis factor-α (TNF-α) has been shown to promote vascular calcification both in vitro and in vivo. However, the molecular mechanism of TNF-α-mediated vascular calcification has not yet been fully defined. Therefore, in this study, we aimed to investigate whether MSX2 acts as a crucial regulator in TNF-α-induced vascular calcification and to define the regulatory mechanism of MSX2 induction in human vascular smooth muscle cells (VSMCs ...
The Big C: Summer time, summer time, sum-sum-summer time!
Alkaline Phosphatase, serum Bone-specific alkaline phosphatase (BAP.) When alkaline phosphatase is measured, it is actually the sum of the bone-specific and liver-specific components (isoenzymes.) BAP can indicate excess osteoblastic cell activity which may indicate bone metastases. Metra Systems, Inc., says that Bone Alkaline Phosphatase is an osteoblast membrane-bound molecule which is involved in bone formation. Levels of this enzyme are thought to be indicative of the activity of osteoblasts. Another description of AlkPhos is that it is an enzyme that is found on the surface of osteoblasts(the cells that build bone) and as such is used as a serum marker of increased osteoblast activity. Since bone is being added at prostate cancer bone metastases, an increased alkaline phosphatase can mean increased bone met formation. A recent paper by MR Smith et al in Urology discussed BAP and NTx in their role as predictors of skeletal complications in HRPC patients (MR Smith, et al, Urology 70: 315-319, ...
Inhibition of pyrophosphatase activity of mouse duodenal alkaline phosphatase by magnesium ions | Biochemical Journal
Duodenal alkaline phosphatase of juvenile (11-day-old) mice, like other non-specific alkaline phosphatases, has the ability to hydrolyse PPi. When a constant Mg2+/PPi concentration ratio is maintained, plots of velocity as a function of PPi concentration are consistent with Michaelis-Menten kinetics. Mg2+ activates pyrophosphate hydrolysis and maximal activity is obtained at a constant Mg2+/PPi concentration ratio of 0·66. At higher ratios there is strong inhibition. At constant concentrations of Mg2+ and increasing concentrations of PPi, the velocity-substrate (PPi) concentration plots show sigmoidal dependence. By assuming that the true substrate is MgP2O72− complex, and using complexity constants, the concentrations of free Mg2+, Mg2P2O7 and MgP2O72− were calculated in assay mixtures ranging in PPi concentration from 0·1 to 2·5mm and in total Mg2+ concentration from 0·6 to 2·6mm. From these data, the concentrations of added Mg2+ and PPi in the assay mixtures were selected so that the ...
Gene expression in tooth: references
The effect of a 2 hour exposure to adriamycin (1 mg/litre) on alkaline phosphatase (ALPase) activity of the golden hamster 4-5 day old second maxillary molars (M2) was investigated in vitro. The molars were grown in BGJb medium containing 15% fetal bovine serum, glutamine (200 micrograms/ml), vitamin C (250 micrograms/ml), penicillin G (50 micrograms/ml), and streptomycin sulphate (30 micrograms/ml). The gas phase contained 50% O2 + 5% CO2 + 45% N2. The molars were supported on cellulosic membrane filters and grown for 3, 5, and 7 days at the medium-gas interface in a closed humidified chamber. Biochemical analysis indicated a steady increase in ALPase activity throughout this study in the control samples. However, after adriamycin treatment no increase in ALPase activity could be observed. The histochemical data showed that the increased activity in the control was confined to the peripheral pulp, sub-odontoblastic layer, stratum intermedium, ameloblasts and odontoblasts. Although these layers ...
Possible functions of alkaline phosphatase in dental mineraliz...
Possible functions of alkaline phosphatase in dental mineralization: cadmium effects.: In mineralizing dental tissues the non-specific alkaline phosphatase, usi
Bone-specific alkaline phosphatase and bone turnover in African Americ by Lenar Yessayan, Carol Moore et al.
INTRODUCTION: Noninvasive measures of bone activity include intact parathyroid hormone (iPTH) and bone-specific alkaline phosphatase (BSAP). Whether BSAP measurement alone or in combination with other biochemical data provides more reliable information about bone turnover than iPTH alone in African Americans on hemodialysis is unknown.
METHODS: This cross-sectional study aimed to determine the optimal predictor and cutoff points for BSAP, iPTH, calcium and phosphorus in classifying bone biopsy findings. Forty-three African American hemodialysis patients were available for analysis. Biochemical data on the day of biopsy across a spectrum of qualitative histologic bone features were compared. Classification and regression tree analysis was used to determine both the optimal predictor and cutoff points for BSAP, iPTH, calcium and phosphorus in identifying bone turnover status.
FINDINGS: Seven subjects had adynamic disease, 31 had mild/moderate hyperparathyroid bone features, and five had severe
anti-Intestinal Alkaline Phosphatase antibody (Alkaline Phosphatase, Intestinal)</span...
Rabbit Polyclonal Intestinal Alkaline Phosphatase antibody for IHC (p), ELISA, WB. Order anti-Intestinal Alkaline Phosphatase antibody ABIN1731689.
Indenopyridine hydrochloride induced testicular spermatogenesis failure with high seminal alkaline phosphatase levels in male...
Indenopyridine hydrochloride (IH), an antispermatogenic agent, was tested to determine the testicular pathological changes, seminal spermatozoa concentrations and seminal plasma alkaline phosphatase levels in male dogs. A single oral dosage of 30 mg IH/kg BW induced the dissociation and premature release of germ cells into the lumens of seminiferous tubules. Ring-shaped spermatid nuclei, nuclear pykonosis of spermatocytes and multinucleated cell associations were also observed. Thereafter, the spermatogenic index (SI) significantly decreased one day after IH administration. Moreover, seminal spermatozoa concentrations decreased two weeks after drug treatment; and there was a statistically significant difference in spermatozoa production inhibited by IH compared to the control. Reversible spermatogenesis was noted 7 weeks after IH treatment in male dogs. Meanwhile, seminal plasma alkaline phosphatase levels also significantly increased two weeks after IH treatment. These data confirm that IH ...
Liver histopathology and liver and serum alanine aminotransferase and alkaline phosphatase activities in epileptic dogs...
Phenobarbital (PB) therapy is frequently associated with elevated serum alanine aminotransferase (ALT) and alkaline phosphatase (AP) activities in dogs without clinical signs of liver disease. The goal of this study was to determine if increased serum ALT and AP activities in clinically healthy PB-treated epileptic dogs are due to hepatic enzyme induction or to subclinical liver injury. Liver biopsies were obtained from 12 PB-treated dogs without clinical signs of liver disease but with elevated Show morePhenobarbital (PB) therapy is frequently associated with elevated serum alanine aminotransferase (ALT) and alkaline phosphatase (AP) activities in dogs without clinical signs of liver disease. The goal of this study was to determine if increased serum ALT and AP activities in clinically healthy PB-treated epileptic dogs are due to hepatic enzyme induction or to subclinical liver injury. Liver biopsies were obtained from 12 PB-treated dogs without clinical signs of liver disease but with elevated ...
Alkaline Phosphatase, Liver/Bone/Kidney Antibody (BGN/03/662) (NB100-66385): Novus Biologicals
Mouse Monoclonal Anti-Alkaline Phosphatase, Liver/Bone/Kidney Antibody (BGN/03/662). Validated: WB, ELISA. Tested Reactivity: Human, Bacteria. 100% Guaranteed.
ALPL - Wikipedia
3.0.CO;2-C. PMID 10737975. Khandwala HM, Mumm S, Whyte MP (2007). Low serum alkaline phosphatase activity and pathologic fracture: case report and brief review of hypophosphatasia diagnosed in adulthood. Endocrine Practice. 12 (6): 676-81. doi:10.4158/ep.12.6.676. PMID 17229666. Nye KE, Riley GA, Pinching AJ (1992). The defect seen in the phosphatidylinositol hydrolysis pathway in HIV-infected lymphocytes and lymphoblastoid cells is due to inhibition of the inositol 1,4,5-trisphosphate 1,3,4,5-tetrakisphosphate 5-phosphomonoesterase. Clin. Exp. Immunol. 89 (1): 89-93. doi:10.1111/j.1365-2249.1992.tb06883.x. PMC 1554388 . PMID 1321014. Henthorn PS, Raducha M, Fedde KN, et al. (1992). Different missense mutations at the tissue-nonspecific alkaline phosphatase gene locus in autosomal recessively inherited forms of mild and severe hypophosphatasia. Proc. Natl. Acad. Sci. U.S.A. 89 (20): 9924-8. doi:10.1073/pnas.89.20.9924. PMC 50246 . PMID 1409720. Nishihara Y, Hayashi Y, Adachi T, et al. ...
Hypophosphatasia - Wikipedia
Hypophosphatasia (also called deficiency of alkaline phosphatase or phosphoethanolaminuria) is a rare, and sometimes fatal, metabolic bone disease. Clinical symptoms are heterogeneous, ranging from the rapidly fatal, perinatal variant, with profound skeletal hypomineralization and respiratory compromise, to a milder, progressive osteomalacia later in life. Tissue non-specific alkaline phosphatase (TNSALP) deficiency in osteoblasts and chondrocytes impairs bone mineralization, leading to rickets or osteomalacia. The pathognomonic finding is subnormal serum activity of the TNSALP enzyme, which is caused by one of 200 genetic mutations identified to date, in the gene encoding TNSALP. Genetic inheritance is autosomal recessive for the perinatal and infantile forms but either autosomal recessive or autosomal dominant in the milder forms. The prevalence of hypophosphatasia is not known; one study estimated the live birth incidence of severe forms to be 1:100,000. There is a remarkable variety of ...
Hypophosphatasia - wikidoc
Hypophosphatasia is a rare inherited metabolic disease of decreased tissue nonspecific alkaline phosphatase (TNSALP) and defective bone mineralization. Both autosomal recessive and autosomal dominant variants of the disease exist. The disease comes in one of five forms, perinatal, infantile, childhood, adult, and odontohypophosphatasia. Perinatal hypophosphatasia is invariably lethal while infantile hypophosphatasia has a roughly 50% mortality rate with symptoms appearing within the first 6th months after birth. The other forms are generally non-lethal. Common symptoms include bone malformations and higher chance of bone fracture. Both the adult form and odontohypophosphatasial form are marked by premature teeth loss. There is no known cure for hypophosphatasia. However, there have been some claims that choline may have positive health benefits for those with the disease that take it as a dietary supplement. ...
Phosphate-irrepressible Alkaline Phosphatase of Zymomonas mobilis | Microbiology Society
The phosphate regulation and subcellular location of the hydrolytic enzyme alkaline phosphatase were investigated in the Gram-negative bacterium Zymomonas mobilis. The biosynthesis of alkaline phosphatase was not derepressed at a low phosphate concentration as is generally observed in other micro-organisms, nor was it repressed by high phosphate concentrations in the medium. The enzyme level was rather constant during the growth phases in batch culture, at a value at least 8.4-fold lower than that observed in Escherichia coli. The alkaline phosphatase of Z. mobilis was found associated with the membrane fraction after cell disruption, osmotic shock treatment or spheroplast formation. This is a rather unusual location, since most of the alkaline phosphatases from Gram-negative bacteria have been shown to be periplasmic enzymes. Activity staining on polyacrylamide gels after two-dimensional electrophoresis revealed two isoforms of alkaline phosphatase, each of approximate molecular mass 56 kDa. These two
A homozygous missense variant in the alkaline phosphatase gene ALPL is associated with a severe form of canine hypophosphatasia...
TY - JOUR. T1 - A homozygous missense variant in the alkaline phosphatase gene ALPL is associated with a severe form of canine hypophosphatasia. AU - Kyöstilä, Kaisa. AU - Syrjä, Pernilla. AU - Lappalainen, Anu K.. AU - Arumilli, Meharji. AU - Hundi, Sruthi. AU - Karkamo, Veera. AU - Viitmaa, Ranno. AU - Hytönen, Marjo K.. AU - Lohi, Hannes. PY - 2019/1/30. Y1 - 2019/1/30. KW - PYRIDOXINE-RESPONSIVE SEIZURES. KW - INFANTILE HYPOPHOSPHATASIA. KW - MATRIX VESICLES. KW - PERINATAL HYPOPHOSPHATASIA. KW - MUTATION. KW - BONE. KW - VITAMIN-B6. KW - NOSOLOGY. KW - GENOTYPE. KW - PYRIDOXAL-5-PHOSPHATE. KW - 413 Veterinary science. KW - 1184 Genetics, developmental biology, physiology. KW - 3111 Biomedicine. U2 - 10.1038/s41598-018-37801-2. DO - 10.1038/s41598-018-37801-2. M3 - Article. VL - 9. JO - Scientific Reports. JF - Scientific Reports. SN - 2045-2322. M1 - 973. ER - ...
A Multicenter, Post-Approval Clinical Study for Asfotase Alfa (Human Recombinant Tissue-nonspecific Alkaline Phosphatase Fusion...
This study will investigated Asfotase Alfa in patients with hypophosphatasia who completed the investigator-initiated clinical study (HPPJEAP-01) protocol for
Repositorio da Producao Cientifica e Intelectual da Unicamp: Hypophosphatasia-associated Deficiencies in Mineralization and...
Introduction: Mutations in the gene ALPL in hypophosphatasia (HPP) reduce the function of tissue nonspecific alkaline phosphatase, and the resulting increase in pyrophosphate (PPi) contributes to bone and tooth mineralization defects by inhibiting physiologic calcium-phosphate (P-i) precipitation. Although periodontal phenotypes are well documented, pulp/dentin abnormalities have been suggested in the clinical literature although reports are variable and underlying mechanisms remains unclear. in vitro analyses were used to identify mechanisms involved in HPP-associated pulp/dentin phenotypes. Methods: Primary pulp cells cultured from HPP subjects were established to assay alkaline phosphatase (ALP) activity, mineralization, and gene expression compared with cells from healthy controls. Exogenous P-i was provided to the correct P-i/PPi ratio in cell culture. Results: HPP cells exhibited significantly reduced ALP activity (by 50%) and mineral nodule formation (by 60%) compared with the controls. ...
Thyroiditis and Alkaline Phosphatase | Annals of Internal Medicine | American College of Physicians
To the editor: In 1960 Vogt (1) called attention to the possible presence of elevated alkaline phosphatase levels in thyroiditis. Since the report of Dalovisio (2) last year, a number of letters confirming their finding have appeared.. We wish to report one case of subacute thyroiditis with serum levels of alkaline phosphatase only minimally raised, but in which the thermoestable fraction was markedly elevated, indicating a hepatobiliary origin.. A 35-year-old woman began to feel nervousness, tremor, occipital headache and pain in the anterior aspect of the neck around 3 March 1979. By 1 month later, she had developed fever (temperature ...
Index Catalog // Deep Blue Data
Craniosynostosis is the premature fusion of cranial bones. The goal of this study was to determine if delivery of recombinant tissue nonspecific alkaline phosphatase (TNAP) could prevent or diminish the severity of craniosynostosis in a C57BL/6 FGFR2C342Y/+ model of neonatal onset craniosynostosis or a BALB/c FGFR2C342Y/+ model of postnatal onset craniosynostosis. Mice were injected with a lentivirus encoding a mineral targeted form of TNAP immediately after birth. Cranial bone fusion as well as cranial bone volume, mineral content and density were assessed by micro computed tomography. Craniofacial shape was measured with calipers., Alkaline phosphatase, alanine amino transferase (ALT) and aspartate amino transferase (AST) activity levels were measured in serum. Neonatal delivery of TNAP diminished craniosynostosis severity from 94% suture obliteration in vehicle treated mice to 67% suture obliteration in treated mice, p,0.02) and the incidence of malocclusion from 82.4% to 34.7% (p,0.03), with ...
Human Embryonic Stem Cell Marker Antibody Panel. Contains 25 g each of anti-Alkaline Phosphatase, anti-Nanog, anti-Oct-3/4,...
Human Embryonic Stem Cell Marker Antibody Panel. Contains 25 g each of anti-Alkaline Phosphatase, anti-Nanog, anti-Oct-3/4, anti-SSEA-1, and anti-SSEA-4. from R&D Systems,,biological,biology supply,biology supplies,biology product
Frontiers | Alkaline Phosphatase, an Unconventional Immune Protein | Immunology
Recent years have seen an increase in the number of studies focusing on alkaline phosphatases (AP), revealing an expanding complexity of function of these enzymes. Of the four human AP proteins, most is known about tissue non-specific AP (TNAP) and intestinal AP (IAP). This review highlights current understanding of TNAP and IAP in relation to human health and disease. TNAP plays a role in multiple processes including bone mineralization, vitamin B6 metabolism and neurogenesis, is the genetic cause of hypophosphatasia, influences inflammation through regulation of purinergic signaling, and has been implicated in Alzheimers disease. IAP regulates fatty acid absorption and has been implicated in the regulation of diet induced obesity and metabolic syndrome. IAP and TNAP can dephosphorylate bacterial derived lipopolysaccharide (LPS), and IAP has been identified as a potential regulator of the composition of the intestinal microbiome, an evolutionarily conserved function. Endogenous and recombinant
Overexpression of tissue-nonspecific alkaline phosphatase increases the expression of neurogenic differentiation markers in the...
Sigma-Aldrich offers abstracts and full-text articles by [Stephanie Graser, Birgit Mentrup, Doris Schneider, Ludger Klein-Hitpass, Franz Jakob, Christine Hofmann].
Alkaline phosphatase activity on osteoblast: post #1
Alkaline phosphatase activity on osteoblast - posted in Tissue and Cell Culture: HelloI have cultured human fetal osteoblast (hFOB 1.19) and I need to check for the alkaline phosphatase activity (ALP) for that cells.I use the plant extract as for the treatment for differentiation and proliferation of the osteoblast.I never did ALP test before. Does everybody can help regarding the protocol for ALP assay?I will use ALP kit from RANDOX.Thank you for help.
Balloon gastrostomy migration leading to acute pancreatitis | Gut
A 57 year old woman with cerebrovascular disease had a 16 Fr Corflo percutaneous endoscopic gastrostomy (Merck Gastroenterology, West Drayton, Middlesex, UK) exchanged for a 20 Fr replacement Corflo balloon gastrostomy (volume 5 ml) as a bridge to eventual insertion of a permanent 20 Fr Corflo-cuBBy button gastrostomy. Four weeks later she presented with a seven day history of abdominal pain and vomiting. Initial investigations revealed a serum alanine transaminase level of 54 IU/l (normal range (NR) 0-35), serum alkaline phosphatase level of 491 IU/l (NR 70-300), serum bilirubin level of … ...
A particulate non-specific alkaline phosphatase in Saccharomyces cerevisiae
NOTE: This item is not available outside the Texas A&M University network. Texas A&M affiliated users who are off campus can access the item through NetID and password authentication or by using TAMU VPN. Non-affiliated individuals should request a copy through their local librarys interlibrary loan service ...
Hypophosphatasia
Hypophosphatasia is a genetic condition in which the activity of an enzyme called alkaline phosphatase is deficient. This enzyme plays an essential role in mineralization - when minerals such as calcium and phosphorus are deposited in developing bones and teeth. Low activity of this enzyme which characterizes hypophosphatasia also leads to rickets, osteomalacia, or both. The severity of the symptoms of hypophosphatasia varies widely, from fetal loss during pregnancy to cases in which pathologic fractures first present only in adulthood. Hypophosphatasia is caused by a mutation in a gene - called the ALPL gene - that provides instructions for making the alkaline phosphatase enzyme. A cure or proven medical therapy for hypophosphatasia has not yet been found. Treatment is generally directed towards preventing or correcting the symptoms or complications ...
Molecular Characterization of Alkaline Phosphatase and PLAP in the Germinal Epithelium of Pb and Se+Zn Treated Adult Sprague...
Aim: The role of alkaline phosphatase in cell metabolism and regulation is essential and cuts across cell proliferation, division, cell death, membrane transport and DNA cleavage. This study addresses the role and importance of alkaline phosphates (ALP) and Placenta Alkaline phosphatase (PLAP) in the cells of germinal epithelium of male Rat testes following induced lead (Pb) toxicity and rejuvenation by Selenium (Se) and Zinc (Zn) treatment. Method: Adult Sprague-Dawley Rats (males) were divided into 4 groups of 15 animals each and were treated as thus; Group 1: Normal saline and serves as the control, Group 2: 100 mg/Kg BW of Pb only, Group 3: 100 mg/Kg BW of Pb and 2.25 mg/Kg each of Se and Zn and group 4 received 2.25 mg.Kg each of Se and Zn only. The duration of treatment was 56 days following which the animals were sacrificed by the 57th day and testes fixed in Bouins fluid. Result: Pb induced toxicity could be apoptotic involving ROS activation of NO-dependent apoptotic pathway or ...
PIGO mutations in intractable epilepsy and severe developmental delay with mild elevation of alkaline phosphatase levels -...
Aberrations in the glycosylphosphatidylinositol (GPI)-anchor biosynthesis pathway constitute a subclass of congenital disorders of glycosylation, and mutations in seven genes involved in this pathway have been identified. Among them, mutations in PIGV and PIGO, which are involved in the late stages of GPI-anchor synthesis, and PGAP2, which is involved in fatty-acid GPI-anchor remodeling, are all causative for hyperphosphatasia with mental retardation syndrome (HPMRS). Using whole exome sequencing, we identified novel compound heterozygous PIGO mutations (c.389C,A [p.Thr130Asn] and c.1288C,T [p.Gln430*]) in two siblings, one of them having epileptic encephalopathy. GPI-anchored proteins (CD16 and CD24) on blood granulocytes were slightly decreased compared with a control and his mother. Our patients lacked the characteristic features of HPMRS, such as facial dysmorphology (showing only a tented mouth) and hypoplasia of distal phalanges, and had only a mild elevation of serum alkaline phosphatase ...
NewYork-Presbyterian Queens - Pagets Disease of the Bone
a bone-specific alkaline phosphatase test - a test that involves the alkaline phosphatase levels (an enzyme found throughout the body) in the bone being measured; any condition of bone growth or an increased activity of bone cells, including Pagets disease, will cause alkaline phosphatase levels to rise. ...
CDX1 - wikidoc
This gene is a member of the caudal-related homeobox transcription factor family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.[2] CDX1 has also been shown to play an important role in embryonic epicardial development. It has been demonstrated that CDX proteins suppress cardiac differentiation in both zebrafish and mouse embryonic stem cells, but the overall mechanism for how this happens is poorly understood.[5] However, CDX1 has been shown to be transiently expressed in the embryonic heart 11.5 days post coitum (dpc). This transient expression is thought to induce epicardial epithelial-to-mesynchemal transition and thus proper cardiovascular formation. It has been shown that low-dose CDX1 induction caused enhanced migration and differentiation of epicardium-derived cells into vascular ...
Gamma Glutamyl Transferase (GGT)
Elevated GGT is found in all forms of liver disease. Measurement of GGT is used in the diagnosis and treatment of alcoholic cirrhosis, as well as primary and secondary liver tumors. It is more sensitive than alkaline phosphatase, the transaminases, and leucine aminopeptidase in detecting obstructive jaundice, cholangitis, and cholecystitis. Normal levels of GGT are seen in skeletal diseases; thus, GGT in serum can be used to ascertain whether a disease, suggested by elevated alkaline phosphatase, is skeletal or hepatobiliary. ...
The Treatment of Malignant Tumours of Bone in the Dog by Intra-Arterial Injection or Perfusion of Epodyl (Triethyleneglycol...
As well as regression assessed directly by measuring the circumference of the limb at the point of maximum tumour swelling, radiographic changes in tumour appearance occurred in the St. Bernard and Great Dane. There was resorption of periosteal new bone and a much smoother outline of the affected areas was apparent (Fig. 6). Recurrence was heralded by the proliferation of periosteal new bone. An increase in serum alkaline phosphatase values was present the day after perfusion (Fig. 7). This was not solely a feature of osteosarcomas as an increased amount of the enzyme in the blood also occurred when the limb of a dog bearing a squamous cell carcinoma was perfused. A similar effect was seen when a normal dog and a nephrecto- mised dog were perfused. An increase in serum alkaline phosphatase occurred when an osteosarcoma was treated by radiotherapy. Where therapy resulted in regression of osteosarcoma and radiography showed resorption of new bone values fell below the pre-treatment figure, rising ...
Zoledronate or Observation in Maintaining Bone Mineral Density in Patients Who Are Undergoing Surgery to Remove Both Ovaries -...
PRIMARY OBJECTIVE:. I. Compare the effect of zoledronate vs observation on bone loss associated with surgery (at a minimum, any surgical procedure that results in removal of both ovaries) in patients undergoing excision of both ovaries.. SECONDARY OBJECTIVE:. I. Compare the change in bone mineral density of the bilateral hip in patients treated with these regimens.. TERTIARY OBJECTIVE:. I. Compare the effect of zoledronate vs observation on biochemical markers of bone resorption and bone formation (N-telopeptide and bone specific alkaline phosphatase) during 1 year of treatment.. OUTLINE: This is a randomized, multicenter study. Patients are randomized to 1 of 2 treatment arms.. All patients undergo surgery, with removal of both ovaries, in month 1. All patients are requested to take calcium supplements twice daily and a multivitamin containing vitamin D once daily beginning in month 1 and continuing for up to 18 months.. ARM I: Beginning 60-90 days after surgery, patients receive zoledronate IV ...
Presence of gamma-glutamyltransferase in the renal microvascular compartment
The association between the brush border enzyme alkaline phosphatase and gamma-glutamyltransferase was determined by sucrose density gradient analysis of crude kidney homogenates, isolated glomeruli, and isolated microvessels. As previously established there is an overlap of these enzyme activities …
ISO - ISO 11816-1:1997 - Milk and milk products - Determination of alkaline phosphatase activity using a fluorometric method -...
Milk and milk products - Determination of alkaline phosphatase activity using a fluorometric method - Part 1: Milk and milk-based drinks
Impact of hypophosphatasia on neonates and infants
aData from a noninterventional, retrospective chart review study designed to understand the natural history of 48 patients ≤5 years of age with severe perinatal- and infantile-onset hypophosphatasia. Patients included in the study were those diagnosed with hypophosphatasia based on at least one of the following: serum biomarker levels (below-normal alkaline phosphatase [ALP] and above-normal PLP or PEA), below-normal ALP and radiographic abnormalities, or genetic analysis of the ALPL gene. Additionally, onset of hypophosphatasia must have occurred prior to 6 months of age based on signs that included at least one of the following: respiratory compromise, rachitic chest deformity, and/or vitamin B6-responsive seizures.12. bRadiographs are from different patients with hypophosphatasia.. ...
Alkaline Phosphatase assay - Randox Online Store
SKU: AP3877 Categories: Clinical Chemistry, Clinical Chemistry Analysers, Diagnostic Reagents, RX daytona, RX daytona and RX imola Reagents, RX imola, Veterinary Reagents Method: AMP Format: Lyophilised Size: R1 6x17.5ml, R2 6x3.5ml Assay Range: Measuring range 18.3 to 1117 U/l Working Stability: To expiry at +2 to +8℃ Available Applications: Applications are available for a wide range of instruments Tags: Assay, Clinical Chemistry Reagents, RX daytona, RX imola, Veterinary Reagents ...
Blood tests show elevated health risks for Gulf spill cleanup workers | Fuel Fix
As blood carries chemicals through the body, it can go through bone marrow, which is the basis for production of blood cells. The liver also filters toxins.. DAndreas study with colleague G. Kesava Reddy documented a wide range of abnormal values for enzymes in the blood of 117 former cleanup workers, compared to a control group of 130 patients not involved in sopping up the spill.. The workers had decreased levels of blood-clotting platelets, as well as lower numbers for blood urea nitrogen and creatinine, which are indicators of kidney health.. The amount of three liver enzymes - alkaline phosphatase, aspartate transaminase and alanine transaminase - in the cleanup workers blood also was higher than the non-exposed patients, a warning sign of liver dysfunction and damage.. DAndrea said various studies show that patients with damaged bone marrow have higher incidence of possible leukemias, lymphoma and myelomas, and that liver damage increases risk of liver, pancreas and gallbladder ...
Membrane permeabilization by conjugated oligoelectrolytes accelerates whole-cell catalysis | www.icb.ucsb.edu
Conjugated oligoelectrolytes (COEs) boost the electrical performance of a wide range of bioelectrochemical systems, yet their mechanism of action remains incompletely understood. One possible mode of action is that COEs permeabilize the cell envelope. We thus examined the effect of tetracationic COE, DSSN+, on the permeability of the inner and outer membrane of Escherichia coli by detecting extracellular activity of normally periplasmic and cytoplasmic enzymes. DSSN+ increases the release of the periplasmic enzyme alkaline phosphatase (ALP) up to 20-fold, but does not significantly change the release of the cytoplasmic enzyme β-galactosidase. Additionally, DSSN+ caused a 2-fold increase in the turnover of a cytoplasmic substrate. These studies present a more complete understanding of the mechanism of action in bioelectrochemical systems and pivot future applications of COEs towards a method for improving whole-cell catalysis.. ...
High liver function levels in blood test
high liver function levels in blood test Alpha fetoprotein blood AFP test. Normally the liver serves various important functions in our body including breaking down waste or toxic substance changing nutrient into energy for body function and hormone production. Your liver enzymes may be elevated even if there is no damage to the liver at all. The liver is very active in handling fat. Badly harmed liver can not produce albumin. 60. Liver function test abnormalities are common in patients with EM but were mild most often not associated with symptoms and improved or resolved by 3 weeks after the onset of antibiotic therapy in most patients. The liver is responsible for producing albumin a protein that prevents If one value of the liver profile is elevated alkaline phosphatase AST lactate dehydrogenase or bilirubin common bile duct stones will found in 20 of cases. The Hepatic Profile or Liver Function Tests LFT is a group of blood tests that provide information about the state of your liver. As ...
Alkaline Phosphatase quenching reagent, Levamisole Solution | Vector Labs
Tissues can contain endogenous alkaline phosphatase activity that will produce background staining if an alkaline phosphatase detection system and substrate are used.
Native Human Alkaline Phosphatase Placental | Cell Sciences
Prices are in US dollars.. These products are for laboratory research purposes only, not for any human or animal diagnostic or therapeutic use.. All site content © 2017 Cell Sciences, Inc.. ...
Hypophosphatasia (HPP): Background, Pathophysiology, Epidemiology
Initially recognized by Rathbun in 1948, hypophosphatasia is a rare inborn error of metabolism caused by mutations in the gene encoding tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). TNSALP is a phosphomonoesterase of 507 residues and is anchored at its carboxyl terminus to the plasma membrane by a phosphatidylinositol-glycan ...
Hypophosphatasia Treatment & Management: Medical Care, Surgical Care, Consultations
Initially recognized by Rathbun in 1948, hypophosphatasia is a rare inborn error of metabolism caused by mutations in the gene encoding tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). TNSALP is a phosphomonoesterase of 507 residues and is anchored at its carboxyl terminus to the plasma membrane by a phosphatidylinositol-glycan ...
Case Report: An Adult-Onset Stills Disease Mimic - The Rheumatologist
The arthralgias had started six weeks prior to his new admission. The joint pain had started in his left wrist. It then spread to the knees, ankles, hips and shoulders. The pain did not worsen with activity and was not relieved by rest. The patient reported he had noticed progressive hand swelling. His pain had worsened to the point that walking was unbearable. He reported fever, loss of appetite, nausea and vomiting. He also reported having had one or two extremely watery, mucous-laden stools just prior to his emergency department visit.. On admission, the patient was noted to have numerous laboratory abnormalities: hyponatremia with a sodium level of 130 mEq/L (reference range [RR]: 136-145); hypokalemia with potassium at 3.0 mEq/L (RR: 3.5-5.1); a chloride level of 92 mEq/L (RR: 98-107); hypocalcemia with a level of 7.9 mg/dL (RR: 8.5-10.1); aspartate amino-transferase of 109 units/L (RR: 15-37); alanine aminotransferase of 84 units/L (RR: 12-78); elevated alkaline phosphatase of 158 units/L ...
Quantitation of Regulatory Activity for the Complement ...
Complement pathways function to identify and remove pathogens and infected cells. There are three complement pathways: the classical, lectin and alternative pathway (AP). While all pathways are activated following pathogen stimuli, the AP is constitutively active and tightly controlled by activators (e.g., Factor B, Factor D) and negative regulators (e.g., Factor H). Complement activity can be measured by well-established methods that are often used in a diagnostic setting to determine the CH50 (50% complement hemolytic activity) or AP50, specifically to measure AP activity. The protocol here has adapted the traditional AP50 method designed to measure AP activity in human sera, to measure the positive or negative AP regulatory activity within a given test sample. The assay relies on the ability of AP components in human serum to lyse rabbit erythrocytes under in vitro conditions specific for the AP with subsequent release of hemoglobin that is quantitated by measurement of optical density. Our method
Nitric Oxide Synthase | Profiles RNS
Rentea RM, Lam V, Biesterveld B, Fredrich KM, Callison J, Fish BL, Baker JE, Komorowski R, Gourlay DM, Otterson MF. Radiation-induced changes in intestinal and tissue-nonspecific alkaline phosphatase: implications for recovery after radiation therapy. Am J Surg. 2016 Oct; 212(4):602-608 ...
Hepatobiliary Infections, Parasitic | Quick Answers Surgery | AccessSurgery | McGraw-Hill Medical
Leukocytosis. • Elevated alkaline phosphatase. • Elevated transaminases. • Hypoalbuminemia rare for amebic abscess. • Entamoeba histolytica serologic studies (positive in 95% of cases) in amebic abscess. • Hydatid serologic studies (positive in > 80% of cases). • Schistosomal ova in feces. • Eosinophilia in hydatid disease ...
Enjoypath
86 year-old white female was in good heath. Two days before admission to ER, she had an increased abdominal pain in the left lower quadrant without bowel movement, and she had three times of vomiting with possible blood. On admission, she was found to have severe extensive abdominal pain (10/10) with movement, urinary tract infection, dehydration,hypercalcemia (13.9), elevated alkaline phosphatase (414), and white cell count (32K). One day later, she had decreased air entry bilaterally with minimal atelectasis, acute renal failure with metabolic and respiratory acidosis (Potassium 6.2, pH 7.11, BUN 84, Cr 2.7, AST 960, ALT 428, CK 2441, Myoglobin ,1000). CT scan showed distended small bowel and colon with distal colon obstruction and abdominal aortic atherosclerosis. The patients expired two days later ...
GFIT result for T01004
sp:PPBT_MOUSE] Alpl, ALP, APTNAP, Akp-2, Akp2, TNAP, TNSALP; alkaline phosphatase, liver/bone/kidney; K01077 alkaline phosphatase [EC:3.1.3.1] ...
Determinants of membrane protein topology | PNAS
The topology of the integral membrane protein MalF, which is required for maltose transport in Escherichia coli, has been analyzed using fusions of alkaline phosphatase (EC 3.1.3.1). The properties of such fusion strains support a MalF structure previously proposed on theoretical grounds. Several transmembrane segments within MalF can act as signal sequences in exporting alkaline phosphatase. Other transmembrane sequences, in conjunction with cytoplasmic domains, can stably anchor alkaline phosphatase in the cytoplasm. Our results suggest that features of the amino acid sequence (possibly the positively charged amino acids) of the cytoplasmic domains of membrane proteins are important in anchoring these domains in the cytoplasm. These studies in conjunction with our earlier results show that alkaline phosphatase fusions to membrane proteins can be an important aid in analyzing membrane topology and its determinants.. ...
alkaline phosphatase - Digestive Disorders / Gastroenterology - MedHelp
I received blookwork results that showed that my alkaline phosphatase level is 153, my doctor said that high normal is 136. All other bloodwork and enzymes are fine. I am being sent for a gall bladde...
December | 2019 | pkc inhibitors
BL21/pES2KI pellets were subjected to ammonium sulfate precipitation (30-40%), resuspended in buffer A (30 mM NaCl and 20 mM Tris-Cl, pH 8.0), and applied to a Fractogel column (Merck, USA). The fraction. was eluted by a NaCl gradient (30 mM-1.4 M). After purification through a P-100 size-exclusion column (BioRad, USA), the CaroS2K fractions were CB-5083 pooled and concentrated using an Amicon centriprep-50 column (Millipore, USA) and dissolved in buffer A. BL21/pES2I pellets were precipitated by ammonium sulfate (70-100%) and resuspended in buffer A. CaroS2I purification involved a similar chromatographic procedure using the Amicon centriprep-3 column (Millipore, USA). The concentration of protein was determined by the Bradford assay (Amresco, USA). In vitro determination of Carocin S2 activity Total RNA was treated with calf intestinal alkaline phosphatase (Promega, USA) at 55°C for 30 min as recommended by the manufacturer. The reaction was arrested by adding 5 mM nitrilotriacetic acid, and ...
A comparative study of digoxigenin, 2,4-dinitrophenyl, and alkaline phosphatase as deoxyoligonucleotide labels in non...
AIM: To determine the optimum form of labelling and the most efficient reporter molecule for non-radioisotopic in situ hybridisation (ISH). METHODS: Nine deoxyoligonucleotides complementary to histone mRNA were synthesised and labelled either enzymatically or during solid-phase synthesis with the reporter molecules digoxigenin, 2,4-dinitrophenyl (DNP), or alkaline phosphatase. Pooled deoxyoligonucleotide cocktails were then used in non-radioisotopic ISH detection of histone mRNA in human tonsil. Hybrid detection was by nitroblue tetrazoleum/5-bromo-4-chloro-3-indolyl phosphate colorimetric development. RESULTS: The use of a spacer in 3 enzymatic labelling and when labelling with alkaline phosphatase significantly increased ISH signal. The 3 and 5 labelling of oligonucleotides with triple DNP groups during solid-phase synthesis produced the strongest signal as determined by the highest cell signal intensity and shortest development time. CONCLUSIONS: 3 and 5 solid-phase labelling with triple ...