1FFU: The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
CP000667.PE356 Location/Qualifiers FT CDS 407150..408517 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Strop_0356" FT /product="glutamyl-tRNA reductase" FT /EC_number="1.2.1.70" FT /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate FT 5-dehydrogenase" FT /db_xref="EnsemblGenomes-Gn:Strop_0356" FT /db_xref="EnsemblGenomes-Tr:ABP52841" FT /db_xref="GOA:A4X1U1" FT /db_xref="InterPro:IPR000343" FT /db_xref="InterPro:IPR006151" FT /db_xref="InterPro:IPR015895" FT /db_xref="InterPro:IPR015896" FT /db_xref="InterPro:IPR036291" FT /db_xref="InterPro:IPR036343" FT /db_xref="InterPro:IPR036453" FT /db_xref="UniProtKB/Swiss-Prot:A4X1U1" FT /protein_id="ABP52841.1" FT /translation="MKLLVVGASYRTAPVAALERLTVAPADLSRVLTRLVAQPYVSEAV FT LVSTCNRVEVYAVVSGFHGGLGDICAVLAESTGCQPAALADHLYVHFDAAAVNHVFRVA FT VGLDSMVVGEAQILGQLRDAYHWASEAETVGRLLHELMQQALRVGKRAHSETGIDRAGQ FT SVVTAALGLATELLHSDLACRPALVVGAGAMGSLGVATLARLGAGPVSVTNRGVDRAIR FT LAESYGATAVPIADLTATLSTVDIVVAATAAPEAVLTRAVVTQALAGRNPSRGPLVLLD FT ...
Description of disease Fatty aldehyde dehydrogenase deficiency. Treatment Fatty aldehyde dehydrogenase deficiency. Symptoms and causes Fatty aldehyde dehydrogenase deficiency Prophylaxis Fatty aldehyde dehydrogenase deficiency
Shop Alcohol-forming fatty acyl-CoA reductase ELISA Kit, Recombinant Protein and Alcohol-forming fatty acyl-CoA reductase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
A 3.2 kb fragment of an indigenous Anabaena azollae plasmid was isolated and fully sequenced. Sequence analysis identified an open reading frame of 1110-bp that showed high similarity (56-71%) with glutathione dependent formaldehyde dehydrogenase genes (gdfaldh) from various bacteria. The identity of the gene was confirmed by expressing the gene in Escherichia coli with a pET-32 (a) vector followed by enzyme assay. Adjacent to the gdfaldh a second gene was detected that showed high similarity (53%) with an S-formylglutathione hydrolase (fgh) gene from the methylotrophic bacterium Paracoccus denitrificans. The presence of gdfaldh and fgh-like genes adjacent to each other may suggest that the corresponding gene products interact in a common metabolic pathway involved in removing exogenous or endogenous formaldehyde ...
Alcohol dehydrogenases (ADH) (EC 1.1.1.1) are a group of dehydrogenase enzymes that occur in many organisms and facilitate the interconversion between alcohols and aldehydes or ketones with the reduction of nicotinamide adenine dinucleotide (NAD+ to NADH). In humans and many other animals, they serve to break down alcohols that otherwise are toxic, and they also participate in generation of useful aldehyde, ketone, or alcohol groups during biosynthesis of various metabolites. In yeast, plants, and many bacteria, some alcohol dehydrogenases catalyze the opposite reaction as part of fermentation to ensure a constant supply of NAD+. Genetic evidence from comparisons of multiple organisms showed that a glutathione-dependent formaldehyde dehydrogenase, identical to a class III alcohol dehydrogenase (ADH-3/ADH5), is presumed to be the ancestral enzyme for the entire ADH family. Early on in evolution, an effective method for eliminating both endogenous and exogenous formaldehyde was important and this ...
Birds clean and lubricate their feathers with waxes that are produced in the uropygial gland, a holocrine gland located on their back above the tail. The type and the composition of the secreted wax esters are dependent on the bird species, for instance the wax ester secretion of goose contains branched-chain fatty acids and unbranched fatty alcohols, whereas that of barn owl contains fatty acids and alcohols both of which are branched. Alcohol-forming fatty acyl-CoA reductases (FAR) catalyze the reduction of activated acyl groups to fatty alcohols that can be esterified with acyl-CoA thioesters forming wax esters. cDNA sequences encoding fatty acyl-CoA reductases were cloned from the uropygial glands of barn owl (Tyto alba), domestic chicken (Gallus gallus domesticus) and domestic goose (Anser anser domesticus). Heterologous expression in Saccharomyces cerevisiae showed that they encode membrane associated enzymes which catalyze a NADPH dependent reduction of acyl-CoA thioesters to fatty alcohols. By
Figure 2. A, The observed NADP+ in the binding pocket of SbCCR1. NADP+ and all interacting residues are represented as stick models. The backbone of SbCCR1 is represented as a ribbon diagram, and dashed lines represent hydrogen bonds or ionic interactions. All residues that contribute to NADP+ binding are labeled according to their single-letter abbreviations and numbered according to sequence positions. The catalytic triad, composed of Ser-149, Tyr-183, and Lys-187, is in close proximity to the nicotinamide ring and serves to promote hydride transfer to hydroxycinnamoyl-CoA substrates. B, Coniferaldehyde docked into the putative phenylpropanoid-binding region of SbCCR1. The backbone of SbCCR1 is represented by a ribbon diagram, with protruding side chains that contribute to coniferaldehyde binding modeled as sticks. Coniferaldehyde, which is the product of the reaction with the preferred substrate feruloyl-CoA, is shown in gray. Kinetics experiments with T154A and Y310F mutants revealed that ...
In contrast to the published description of S. mucosus [7], which suggests a strictly aerobic and chemoheterotrophic metabolism, the genome reveals an astonishing metabolic versatility. Besides genes for the degradation of organic substrates, we also found genes encoding enzymes for the utilization of alternative electron donors enabling facultative lithotrophic growth: a Sox multienzyme complex encoded by the genes salmuc_00587 - 00597 could be utilized for the oxidation of thiosulfate to sulfate, while molecular hydrogen may be utilized as electron donor by a multimeric uptake hydrogenase of the [NiFe]-type (salmuc_04814 - 04830). A further potential substrate is carbon monoxide, which might be oxidized by an aerobic-type carbon monoxide dehydrogenase encoded by the genes salmuc_05576 - 05578. Additional genes encoding subunits of carbon monoxide dehydrogenase were found dispersed at several sites in the genome. The metabolic plasticity of this species is further reflected in a multiple ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Previous studies have shown that the steady state mRNA levels of RALDH2 are significantly increased during recovery from induced myopia.17 In the present study, RALDH2 protein expression was compared in 4-day control (C) and recovering (R) eyes by Western blot with chick specific anti-RALDH2 antibodies (Fig. 4A). The 4-day time point was used since RALDH2 mRNA levels were shown previously to be significantly increased at this time point.17 Quantification of the band intensities demonstrated that RALDH2 protein levels were significantly increased in 4-day recovering choroids (3.65 ± 0.45 RALDH2 IOD/8-mm punch) compared to controls (1.62 ± 0.31 RALDH2 IOD/8-mm punch; P , 0.05, paired t-test; n = 4) (Figs. 4A, 4B). RALDH2 protein expression in 8-mm posterior choroidal punches was examined subsequently at several time points throughout the recovery process (0 hours to 15 days; Fig. 5). RALDH2 was detected in control and recovering choroids at all time points examined as an approximately 55 kDa ...
Retinal Dehydrogenase: A metalloflavoprotein enzyme involved the metabolism of VITAMIN A, this enzyme catalyzes the oxidation of RETINAL to RETINOIC ACID, using both NAD+ and FAD coenzymes. It also acts on both the 11-trans- and 13-cis-forms of RETINAL.
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Jaspers, M. H. J.; Pflanz, R.; Riedel, D.; Kawelke, S.; Feussner, I.; Schuh, R.: The fatty acyl-CoA reductase Waterproof mediates airway clearance in Drosophila. Developmental Biology 385 (1), pp. 23 - 31 (2014 ...
Complete information for FAR2P1 gene (Pseudogene), Fatty Acyl-CoA Reductase 2 Pseudogene 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Formaldehyde is an ubiquitous air pollutant in indoor and outdoor atmospheres. Possible sources are disinfectants, paints, resins, particle boards, tobbaco smoke and combustion processes. It is used in large amounts in the plastics manufacturing industry. The German government has set the maximum allowed workspace concentration, MAK-value, to 0.5 ppm (v/v). For non-occupational indoor environments 0.1 ppm (v/v) are recommended. Traditional systems for the determination of formaldehyde in air consist of a sampling step (e.g. washer, adsorber) followed by a quantification step (optical, enzymatic, or titration). There are only few reports where formaldehyde is determined directly in the gas phase in one step. We present an electrochemical enzyme biosensor that can detect gaseous formaldehyde directly without a separate sampling step. NAD-dependent formaldehyde dehydrogenase converts formaldehyde to formic acid. The formed NADH is oxidised by a redox mediator (e.g. naphthoquinone). The latter is ...
Anna was looking forward to receiving her third year trophy, and she was worried about what would happen to her partner in the show without her. Every co-dependent, desire-to-please/fix/make OK alarm sounded in my body; I wanted my girls there even if I was sweating it out and pushing George into the world at that very moment! I did not want to disappoint them... but if Emre was with me as labor coach, was that feasible? Practical? Prudent? Yes, I had a dance mom on standby, willing to come and pick them up and do their hair... but I dont know her well, neither do my girls, and while Anna would be old enough to handle this upheaval in stride, would little Gianna manage? What if one of them got hurt or fell ill while backstage? What to do!? My husband helped me to discern that I was stressing out over the possibility of separation; the actual separation into unchartered territory would create more anxiety for me during labor and that was exactly what I didnt need. Furthermore, my concerns were ...
resume formate for images resume formate. Take the most recent Glamorous photos of resume formate tagged at stagedeguitare.com. 22-Jan-18 06:53:45
Looking for SPECTRUM Cyanomethyl Formate,5g (19HA94)? Graingers got your back. Price:$60.50. Easy ordering & convenient delivery. Log-in or register for your pricing.
Looking for online definition of retinaldehyde dehydrogenase 1 in the Medical Dictionary? retinaldehyde dehydrogenase 1 explanation free. What is retinaldehyde dehydrogenase 1? Meaning of retinaldehyde dehydrogenase 1 medical term. What does retinaldehyde dehydrogenase 1 mean?
Preparations of sheep liver cytoplasmic aldehyde dehydrogenase obtained by published methods were found by analytical isoelectric focusing in the pH range 5-8 to contain 5-10% by weight of the mitochondrial aldehyde dehydrogenase. Under the conditions used the pI of the cytoplasmic enzyme is 6.2 and that of the mitochondrial enzyme 6.6. The mitochondrial enzyme can be removed from the preparation by selective precipitation of the cytoplasmic enzyme with (NH4)2SO4. Kinetic experiments and inhibition experiments with disulfiram show that the properties of the two sheep liver enzymes are so different that the presence of 10% mitochondrial enzyme in preparations of the cytoplasmic enzyme can introduce serious errors into results. Our results suggest that the presence of 10 microM-disulfiram in assays may completely inactivate the pure cytoplasmic enzyme. This result is in contrast with a previous report [kitson (1978) Biochem. U. 175, 83-90]. ...
Introduction: Diminished NO production and altered NO bioavailability promote vascular inflammation and atherosclerosis. S-nitrosoglutathione reductase (GSNOR) controls cellular NO balance by degrading S-nitrosoglutathione (GSNO), which is a major source of nitric oxide (NO) bioactivity. GSNOR inhibition increases protein S-nitrosylation and potentiates NO action. The role of GSNOR in vascular inflammation is undefined, and the purpose of our investigation was to determine if GSNOR targeting dampens inflammation and reduces atherosclerosis.. Methods and results: We evaluated vascular inflammation and atherosclerosis in wild type (WT) and GSNOR-deficient (GSNOR-/-) mice. TNF-induced NFκB activation was reduced by 40% (p,0.05) in endothelial cells (ECs) isolated from GSNOR-/- compared to WT mice, which was accompanied by attenuated expression of P-selectin, E-selectin, and VCAM-1 (,34% reduction, p,0.05). Decreased EC adhesion molecule expression led to a 45% reduction in leukocyte rolling in the ...
Data are presented concerning the basic metabolism sites, the reaction paths crossing in them and regulatory and toxical effect of formaldehyde and nitric oxide being mediated through them. In particular, they include: glutathione-formaldehyde-dependent dehydrogenase path of S-nitrosoglutathione reduction, semi-carbaside-sensitive amino-oxidase (SSAO) and NO-synthase systems; transformation of thioproline and metallothioneines, including nitrosation reactions. Possibilities of hexamethylenetetramine synthesis in the organism as well as its metabolism in conditions of formaldehyde hyperproduction and nitrosative stress are discussed. The role of metabolism sites, common for formaldehyde and nitric oxi-de, in the mechanisms of toxical effect of these compounds and development of pathologic states is considered.. Key words: nitric oxide, formaldehyde, glutathione-dependent formaldehyde dehydrogenase, S-nitrosoglutathione reductase, semicarbaside-sensitive aminoxidase, thioproline, hexamethy-lene ...
Expression of alcohol-forming fatty acyl-CoA reductases in E. coli can result in the biosynthesis of fatty alcohols from endogenous E. coli fatty acids, but the levels were quite low [19]. To improve the production of fatty alcohols, Steen et al. carried out a further genetic modification of E. coli, and achieved an increased titer (~60 mg/L) of the medium chain fatty alcohols (C12 or C14 alcohols) [3]. In their strategy, they employed thioesterases with different substrate specificities to tailor the composition of the FFAs, and used the aldehyde-forming fatty acyl-CoA reductase Acr1 for the conversion of fatty acyl-CoAs to fatty aldehydes. The synthesized fatty aldehydes can be further converted to fatty alcohols by an unknown alcohol dehydrogenase/aldehyde reductase of E. coli [6].. However, Steen et al. just obtained a small quantity of C16/18 alcohol, though they used the thioesterase TesA, which was capable of yielding a large proportion of C16/18 FFA [3]. As aforementioned, expression of ...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Potassium atom in PDB 2wme: Crystallographic Structure of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa
TY - JOUR. T1 - Levels of retinoic acid and retinaldehyde dehydrogenase expression in eyes of the Mitf-vit mouse model of retinal degeneration.. AU - Duncan, T.. AU - Swint, C.. AU - Smith, S. B.. AU - Wiggert, B. N.. PY - 1999/6/28. Y1 - 1999/6/28. N2 - PURPOSE: Several reports have characterized the retinal degeneration observed in the Mitf(vit) mutant mouse. Despite these reports, the factor(s) that may cause or modulate the degeneration still are not well defined; however, it is known that the photoreceptors of Mitf(vit) mice die through an apoptotic mechanism. We reported previously that retinoid metabolism in the RPE of Mitf(vit)++ mice is perturbed. Retinoids regulate genes via the RAR and RXR nuclear receptor pathway that are involved in numerous cellular responses including apoptosis. It is possible that retinoic acid (RA) modulates the retinal degeneration observed in the Mitf(vit) mice. The purpose of this study was to evaluate the levels of RA in whole eyes, as well as its ...
In 1957, Sjögren and Larsson described a cohort of Swedish patients with an unusual combination of symptoms that included of congenital ichthyosis, intellectual disability, and spastic diplegia or tetraplegia. Family studies indicated that Sjögren-Larsson syndrome (SLS) was a genetic disorder with autosomal recessive inheritance.
Catalyzes the conversion of acetaldehyde to acetyl-CoA, using NAD(+) and coenzyme A. Is the final enzyme in the meta-cleavage pathway for the degradation of aromatic compounds.
Heme-dependent feedback inhibition of rate-limiting ALA-synthesis of plant tetrapyrrole biosynthesis depends on binding of heme to glutamyl-tRNA reductase-binding protein.
The invention provides a method of chemically-mechanically polishing a substrate comprising tungsten through use of a composition comprising a tungsten etchant, an inhibitor of tungsten etching, and water, wherein the inhibitor of tungsten polishing is a polymer, copolymer, or polymer blend comprising at least one repeating group comprising at least one nitrogen-containing heterocyclic ring or a tertiary or quaternary nitrogen atom. The invention further provides a chemical-mechanical polishing composition particularly useful in polishing tungsten-containing substrates.
Betaine aldehyde dehydrogenase (BADH) is important enzyme which plays a dual role in cereals. It acts as an osmoprotectant and has an important role during abiotic stress. In addition it also influences the fragrance in rice. Therefore, this gene has both agronomical and breeding values. An 8pb deletion in exon 7 cause a premature termination codon in BADH2 resulting a mutate badh2 allele; which ultimately elevates the level of 2AP leading fragrance in fragrant rice (Bradbury et al., 2008). Unlike rice wheat is a hexaploid and has two BADH homologs i.e. BADH1 and BADH2. Our genomic data shows that there are three alleles for BADH homologs. One allele is present in the progenitors and these indicates that, these allele is inheritate from each of the progenitors during polyploidy in hexaploid wheat. Our data show that a total of 4 and 14 SNPs are present among the genomes in BADH2 and BADH1respectivly. Investigation on two different tissues (i.e. leaves and seeds), at two different time point (i.e. 14 DPA
S-hydroxymethylglutathione dehydrogenase from Paecilomyces variotii No. 5 strain (NBRC 109023), isolated as a formaldehyde-degrading fungus, was purified by a procedure that included ammonium sulfate precipitation, DEAE-Sepharose and hydroxyapatite chromatography and isoelectrofocusing. Approximately 122-fold purification was achieved with a yield of 10.5%. The enzyme preparation was homogeneous as judged by sodium dodecyl polyacrylamide gel electrophoresis (SDS-PAGE). The molecular mass of the purified enzyme was estimated to be 49 kDa by SDS-PAGE and gel filtration, suggesting that it is a monomer. Enzyme activity was optimal at pH 8.0 and was stable in the range of pH 7.0-10. The optimum temperature for activity was 40°C and the enzyme was stable up to 40°C. The isoelectric point was pH 5.8. Substrate specificity was very high for formaldehyde. Besides formaldehyde, the only aldehyde or alcohol tested that served as a substrate was pyruvaldehyde. Enzyme activity was enhanced by several divalent
Supported Au catalysts have been studied extensively for CO oxidation. These catalysts are known to catalyze this reaction even at sub-ambient temperatures. While recent literature demonstrates catalytic activity of gold nanoparticles |2 |nm, the next stage in fine tuning this catalysis process is to develop gold clusters prepared with atomic precision. Such atomically precise gold catalysts supported on TiO2 hitherto have not been investigated for CO oxidation. The main objective of this work is to synthesize atomically-precise Au38 clusters in a flask-based method using principles of wet chemistry, to characterize these clusters using various advanced spectroscopic techniques, and to test these clusters as potential catalytic materials for CO oxidation. Furthermore, we have tested TiO2-supported Au38 clusters and a commercially purchased Au/TiO2 catalyst for CO oxidation at 30 °C and 60 °C, and used DRIFTS as a probe spectroscopic technique to correlate kinetics with the mechanism occurring on the
ID ADHE_ECOLI Reviewed; 891 AA. AC P0A9Q7; P17547; DT 19-JUL-2005, integrated into UniProtKB/Swiss-Prot. DT 23-JAN-2007, sequence version 2. DT 22-NOV-2017, entry version 109. DE RecName: Full=Aldehyde-alcohol dehydrogenase; DE Includes: DE RecName: Full=Alcohol dehydrogenase; DE Short=ADH; DE EC=1.1.1.1; DE Includes: DE RecName: Full=Acetaldehyde dehydrogenase [acetylating]; DE Short=ACDH; DE EC=1.2.1.10; DE Includes: DE RecName: Full=Pyruvate-formate-lyase deactivase; DE Short=PFL deactivase; GN Name=adhE; Synonyms=ana; OrderedLocusNames=b1241, JW1228; OS Escherichia coli (strain K12). OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; OC Enterobacteriaceae; Escherichia. OX NCBI_TaxID=83333; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND PROTEIN SEQUENCE OF 2-11. RX PubMed=2695398; DOI=10.1016/0378-1119(89)90483-6; RA Goodlove P.E., Cunningham P.R., Parker J., Clark D.P.; RT "Cloning and sequence analysis of the fermentative alcohol- RT dehydrogenase-encoding gene of ...
Interest in the biochemistry of nickel has been stimulated by recent discoveries of its essentiality to various microorganisms, plants, and animals and of the existence of several nickel metalloenzymes in plants and microorganisms. Signs of nickel deprivation have been described for six animal species-chick, cow, goat, minipig, rat, and sheep. Included among the more consistent signs of deficiency in mammals are depressed growth, unthriftiness characterized by rough hair coat, and an altered iron metabolism leading to depressed hematopoiesis. The predominant sign of nickel deficiency for microorganisms is depressed growth, and for plants is depressed nitrogen utilization. In plants and microorganisms, nickel is known to function in several metalloenzymes including urease, several hydrogenases, and carbon monoxide dehydrogenase. In higher animals, the evidence showing that nickel is essential has not defined its metabolic function. The finding of nickel metalloenzymes in lower forms of life ...
J:104523 Ribes V, Wang Z, Dolle P, Niederreither K, Retinaldehyde dehydrogenase 2 (RALDH2)-mediated retinoic acid synthesis regulates early mouse embryonic forebrain development by controlling FGF and sonic hedgehog signaling. Development. 2006 Jan;133(2):351-61 ...
Antabuse, also called disulfiram, is a famous drug for the treatment of alcohol and drug addiction. Its working mechanism is based on inhibition of the acetaldehyde dehydrogenase (the enzyme responsible for the split of acetaldehyde- the enzyme, which helps to digest alcohol.
Further information can be found in the Supplemental Methods.. Animals. Mice were housed in a pathogen-free, temperature- and light-controlled animal facility under a 12-hour light/dark cycle. ALDH2-/- LDLR-/- mice were obtained by crossing ALDH2-/- mice (a gift from Jun Ren and Aijun Sun, Zhongshan Hospital affiliated with Fudan University, Shanghai, China) (37, 40) and LDLR-/- mice (Jackson Laboratory). ALDH2-/-APOE-/- mice were obtained by crossing ALDH2-/- mice and APOE-/- mice (Shanghai Model Organisms). All mice used in the present study were on a C57BL/6 background. For atherosclerotic study, 6-week-old mice were fed Western Diet (Research Diets, catalog D12079B) for 12 weeks or 26 weeks (26-week experiment was done in duplicate). The number of mice studied in each experiment is shown in the figure legends.. Cell culture. HEK 293T cell lines were purchased from the CAS Cell Bank and cultured in DMEM containing 10% FBS. Isolation of bone marrow-derived macrophages (BMDMs) followed a ...
mag:amb2922 K03738 aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5] , (GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase (A) MSWTGKFLRIDLTNGSVKTEELNRAWARQYLGQRGLATKYFAEEVDPKVDPLSPANKMIF TTGPLTGTAASTGGRYSVVTKGPLTNCIACSNSGGFFGNELKNAGWDMIIVEGRSPKPVY LSIENETVEIRDAAEFWGKTVWETENGLKARHQDPMLRVATIGAAGEKGVLYACIVNDLH RAAGRSGVGAVMGSKNLKAIAVRGTRGVTVKDPDRFIKATIEQKKVLADNAVTGQGLPKY GTQVLMNVINEIGAMPTRNFKEVQFEGAHKISAEAMHEPRATDGKANLATNGACFGCTIA CGRISRMDPGHFSITSRPQYKEPSGGVEYEAAWAMGSDCGVDDLEACTFANFMCNEHGID PISFGSTLAAAMEMFEMGVITKEQTGGVELKFGSAEALVKMAELTGKGEGFGLELGQGSR RLCAKYGHPELSMTVKSQEFPAYDPRGIQGMGLTYATSNRGACHLRSYTVASEVLGIPFK SDPLATDGKAALVKAFQDATAAFDASGICIFTTFAWSLENLAPQIDAACEGEWTPEILLE VGERIWTLERQFNLAAGMTAADDTLPKRLLKDAAKTGPAKGLTSGLEKMLPEYYQLRGWT TDGVPTTETLKRLQLA ...
Semantic Scholar extracted view of Aldehyde dehydrogenase activity and level of dopamine in certain sections of the brain of rats preferring and refusing ethanol by Kharchenko Nk
Sci. Rep. Aldehyde dehydrogenase enzymes (ALDHs) are very common proteins involved in the oxidation of aliphatic and aromatic aldehydes to their corresponding…
Sjögren-Larsson syndrome presents with ichtyosis, spastic diplegia and cognitive deficits. It is caused by a deficiency of fatty aldehyde dehydrogenase. Treatments are limited to symptomatic therapies; for example, ziluteon (an inhibitor of 5-lipoxygenase) can reduce pruritus.. In a recent article, bezafibrate has been shown to induce the expression of the deficient protein in fibroblasts from some patients. This discovery could become of clinical importance ...
NCT 501 (CAS: 1802088-50-1)is a potent and selective theophylline-based inhibitor of aldehyde dehydrogenase 1A1 (ALDH1A1), inhibits hALDH1A1 with IC50 of 40 nM, typically shows better selectivity over other ALDH isozymes and other dehydrogenases (hALDH1B1
FUJIWARA Ken , DAVAADASH Bulgan , YATABE Megumi , KIKUCHI Motoshi , HORIGUCHI Kotaro , KUSUMOTO Kenji , KOUKI Tom , YASHIRO Takashi Medical molecular morphology : official journal of the Japanese Society for Clinical Molecular Morphology 41(3), 126-131, 2008-09-01 医中誌Web 参考文献20件 ...
The IUPHAR/BPS Guide to Pharmacology. aldehyde dehydrogenase 5 family member A1 - GABA turnover. Detailed annotation on the structure, function, physiology, pharmacology and clinical relevance of drug targets.
Spectral data for 41 aldehydes have been recorded from 1/700 cm to 1/300 cm and analyzed for spectra-structure correlations. The information so attained can be applied in identifying aliphatic and aromatic aldehydes. Specific correlations were determined for aliphatic aldehydes with or without alpha-branching. Tentative correlations were observed for alphaolefinic, alicyclic, and aromatic aldehydes. (Author)
A two-stage combustion is one of the Mitsubishi GDI™ technologies for a quick catalyst warm-up on a cold-start. However, when the combustion is continued for a long time, an increase in the fuel consumption is a considerable problem. To solve the problem, a stratified slight-lean combustion is newly introduced for utilization of catalysis. The stratified mixture with slightly lean overall air-fuel ratio is prepared by the late stage injection during the compression stroke. By optimizing an interval between the injection and the spark timing, the combustion simultaneously supplies substantial CO and surplus O2 to a catalyst while avoiding the soot generation and the fouling of a spark plug. The CO oxidation on the catalyst is utilized to reduce the cold-start emissions. Immediately after the cold-start, the catalyst is preheated for the minimum time to start the CO oxidation by using the two-stage combustion. Following that, the stratified slight-lean combustion is performed ...
A two-stage combustion is one of the Mitsubishi GDI™ technologies for a quick catalyst warm-up on a cold-start. However, when the combustion is continued for a long time, an increase in the fuel consumption is a considerable problem. To solve the problem, a stratified slight-lean combustion is newly introduced for utilization of catalysis. The stratified mixture with slightly lean overall air-fuel ratio is prepared by the late stage injection during the compression stroke. By optimizing an interval between the injection and the spark timing, the combustion simultaneously supplies substantial CO and surplus O2 to a catalyst while avoiding the soot generation and the fouling of a spark plug. The CO oxidation on the catalyst is utilized to reduce the cold-start emissions. Immediately after the cold-start, the catalyst is preheated for the minimum time to start the CO oxidation by using the two-stage combustion. Following that, the stratified slight-lean combustion is performed ...
Or ALDH, this breaks down various aldehydes into the corresponding carboxylic acids. Its most notable substrate is, of course ethanal the breakdown prod...