Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase | Biochemical Society...
MARTA ISERN DE CALDENTEY, KENNETH P. WHEELER; Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase. Biochem Soc Trans 1 February 1977; 5 (1): 107-108. doi: https://doi.org/10.1042/bst0050107. Download citation file:. ...
Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Phosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Browsing Annual Medical Student Research Forum by Subject Adenosine Triphosphatases
BACKGROUND: Neurons can survive for decades via cell maintenance and protein degradation. This process includes the general protein endolysosomal degradation pathway, an integral part of which is the Rab GTPase proteins ...
Sodium-potassium-activated adenosine triphosphatase activity as a meas by M Levental and B Tabakoff
Levental, M and Tabakoff, B, Sodium-potassium-activated adenosine triphosphatase activity as a measure of neuronal membrane characteristics in ethanol-tolerant mice. (1980). Subject Strain Bibliography 1980. 2608 ...
Enhanced na+-k+-activated adenosine triphosphatase activity in trans- by L B. Kasarov and H Friedman
Kasarov, L B. and Friedman, H, Enhanced na+-k+-activated adenosine triphosphatase activity in trans- formed fibroblasts. (1974). Subject Strain Bibliography 1974. 1678 ...
A Fragment-Based Ligand Screen Against Part of a Large Protein Machine: The ND1 Domains of the AAA+ ATPase p97/VCP. | Sigma...
Sigma-Aldrich offers abstracts and full-text articles by [Michael S Chimenti, Stacie L Bulfer, R Jeffrey Neitz, Adam R Renslo, Matthew P Jacobson, Thomas L James, Michelle R Arkin, Mark J S Kelly].
Microtubule-severing protein Katanin regulates neuromuscular junction development and dendritic elaboration in Drosophila. |...
Sigma-Aldrich offers abstracts and full-text articles by [Chuan-Xi Mao, Ying Xiong, Zhaohuan Xiong, Qifu Wang, Yong Q Zhang, Shan Jin].
Atp13a5 - Probable cation-transporting ATPase 13A5 - Mus musculus (Mouse) - Atp13a5 gene & protein
integral component of plasma membrane, intracellular membrane-bounded organelle, calcium-transporting ATPase activity, cellular calcium ion homeostasis
AID 299465 - Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM - PubChem
BioAssay record AID 299465 submitted by ChEMBL: Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM.
Razvoj metode za mjerenje aktivnosti ekto-ATPaze u serumu čovjeka | Repozitorij Farmaceutsko-biokemijskog fakulteta Sveučilišta...
Ecto-ATPase is an enzyme which belongs to the group of the E-NTPDases. Those enzymes are ectoenzymes, and that they participate in the metabolism of extracellular molecules. Ecto-ATPase participate in metabolism of nucleoside triphosphate and nucleoside diphosphate with higher affinity for the nucleoside triphosphate. The metabolism of extracellular molecules with the appropriate enzymes is one of the steps in purinergic signaling that mediates a variety of physiological and pathophysiological processes. Therefore it is considered that value of ecto-ATPase activity in human serum may be a potential factor in the diagnosis of diseases associated with purinergic signaling. Ecto-ATPase activity in the human serum was measured by Fiske-Subbarow method, and the average value of 13 healthy samples was 992.3±281.2 nmol/ml/h. Results showed that the most suitable sample volume for the measuring enzyme activity is 50 μL, incubation time on 37 °C is 60 min and that 100 μL 1.12 mol/L TCA is required ...
Efecto antioxidante de nuevo esteroide sintético (4-cloro-17ð-acetoxi-4-pregnen-3,20-diona) en cerebro de ratas adultas
The aim of the present study was to evaluate the antioxidant effect of a new steroid (4-chloro-17α-acetoxy-4-pregnene-3,20-dione) in rat brain. Twelve adults rats of 500g were randomly distributed in groups of 6 that were treated with 4-chloro-17α-acetoxy-4-pregnene-3,20-dione (4 mg/kg/day), or vehicle, administered during 5 days. At the end of treatment all animals were sacrificed and the GSH levels in the brain were measured by fluorescence method, as well as lipid peroxidation (TBARS), Na+,K+-ATPase and total ATPase enzymatic activity by spectrophotometry methods. Na+,K+-ATPase and total ATPase activities increased, only the total ATPase activity increase was significant as compared to the control group ( ...
CCNA1 protein (human) - STRING interaction network
DNA replication licensing factor MCM6; Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for once per cell cycle DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differential ...
VPS4A antibody | acris-antibodies.com
VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In…
ATPaza presecanja mikrotubula - Википедија, слободна енциклопедија
Hartman, J.J., Mahr, J., McNally, K., Okawa, K., Iwamatsu, A., Thomas, S., Cheesman, S., Heuser, J., Vale, R.D. and McNally, F.J. (1998). „Katanin, a microtubule-severing protein, is a novel AAA ATPase that targets to the centrosome using a WD40-containing subunit. Cell. 93: 277-287. PMID 9568719 ...
RCSB PDB - Protein Feature View
- Putative ATPase, AAA family - Q7V3J8 (Q7V3J8 PROMP)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
The yeast secretory pathway is perturbed by mutations in PMR1, a member of a Ca2+ ATPase family
The genes for two new P-type ATPases, PMR1 and PMR2, have been identified in yeast. A comparison of the deduced sequences of the PMR proteins with other known ion pumps showed that both proteins are very similar to Ca2+ ATPases. PMR1 is identical to SSC1, a gene previously identified by its effect o …
anti-ATAD3A antibody | GeneTex
ATAD3A antibody (ATPase family, AAA domain containing 3A) for IHC-P, WB. Anti-ATAD3A pAb (GTX116301) is tested in Human samples. 100% Ab-Assurance.
EMBL: CP001115.PARA
CP001115.PARA Location/Qualifiers FT CDS_pept 204..965 FT /codon_start=1 FT /transl_table=11 FT /gene=parA FT /locus_tag=Deide_1p00010 FT /product=putative ATPase involved in plasmid/chromosome FT partitioning FT /db_xref=EnsemblGenomes-Gn:Deide_1p00010 FT /db_xref=EnsemblGenomes-Tr:ACO47390 FT /db_xref=InterPro:IPR025669 FT /db_xref=InterPro:IPR027417 FT /db_xref=UniProtKB/TrEMBL:C1D1V1 FT /protein_id=ACO47390.2 FT /translation=MITATVFNHAGGAGKTSIVRDVGYELARQGQRVLVVDLDPQANLT FT AWLGVVDVQMEQTVYQVATEGAELPEPVAVHGLHLIPSQVDLALAETGMLGVPGSQLFL FT QQALRTVQDRYDLVLVDSPPSVGQLAILGAAAADRLIVPVPTRTKGLNALPGLQKATNL FT YRRLRPELAMGLYVPTMYDARRTHDREVLALLRQHLSPLAEPVPERAAVWLDSTMAGEP FT VGVYKAGSPAHQDVLRLTDEVARSLGLKVNA atgatcacag cgaccgtgtt caaccacgcg ggtggtgcag gcaagaccag catcgtccgc 60 gacgtcggtt atgaattggc ccgccagggc cagcgcgttc tggtagtgga cctcgatcca 120 caggccaacc tcaccgcatg gctgggtgtg gttgacgtgc agatggagca gacggtgtat 180 caagtcgcca cagaaggtgc tgagcttcca gagcctgtcg ccgttcacgg acttcacctg 240 ...
Ubxn10 MGI Mouse Gene Detail - MGI:2443123 - UBX domain protein 10
View mouse Ubxn10 Chr4:138709837-138737167 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
sodium:potassium-exchanging ATPase complex QuickView - Correlation Engine
Sodium:potassium-exchanging ATPases are tetrameric proteins, consisting of two large alpha subunits and two smaller beta subunits. The alpha subunits bear the active site and penetrate the membrane, while the beta subunits carry oligosaccharide groups and…
Testing nucleotide-protein interaction - Biochemistry - BioForum
Testing nucleotide-protein interaction - posted in Biochemistry: Hi everybody
I work with an intrinsically disordered protein with unknown function and no close homologs. Psi Blasts show some low degree of homology to ATPsaes, but with e-values above cutoff. Motif searches predict an incomplete Walker A motif. If so, only the GKS motif is conserved, but not the P-loop.
The protein forms a stable complex with Ca-calmodulin.
I tried atpase assays, but there was no activity. Upon addition...
SPAST DICDI » Spastin - Membranome database
MLFDLINSFL KNGINNSNNN NNNNNNKNNF YNSLEDDDYL LNNQTTKVSL YLYFFIFAFM FLVVDLIMLY YKHRENIESR ETDLSLKLNK MLIDFENDNK IKSSPTTSTT TTTITPTTTS SSQLRQPSTP KTTTKTINSP PSTPKSPPPL PSLESKLLYK DDIKQQLSLN EAKSQIDSAK QLDESLKYNS CIKLYIDGIE KLMALFSSYN SKEYRDYIDF YLKRAEYLKN ELKKGTNLKS ITNFNNFSKE YQINYNNKIL EQQQQQQQQS SSTYRNSLNL SSSKSNSTIN NRHSISSLSS LNSTTATTTT PSNTSTITSP GNKYGLQKSL SSTTLSLKKS SNSTNFQQPS PPSMVIPDIK GIDKSMVTLI MNEIMDRKNP VKWDDVVGLD KVKQSLMESV ILPNLRPDVF TGLRAPPKGL LLFGPPGNGK TMIAKAVAYE SKVTFFSISS SSLTSKYVGD GEKLVRALFA VATHFQPSII FIDEIDSLLT ERSSNESEAS RRLKTEILVQ FDGARTNGDE RVLVMGATNR PEDLDDAALR RLVKRIYVGL PELETRLQII QHLLVGQRHS LTKQQINSLA EVTQGYSGFD LAALCKDAAY EPIRRLGIGI KDLELNEISL ISFKDFANSL KQIRPSVTSQ SLKSFEKWNQ KFGTI ...
View gene SPAST - SpainMDB
We have used all reasonable efforts to ensure that the information displayed on these pages and contained in the databases is of high quality. We make no warranty, express or implied, as to its accuracy or that the information is fit for a particular purpose, and will not be held responsible for any consequences arising out of any inaccuracies or omissions. Individuals, organisations and companies which use this database do so on the understanding that no liability whatsoever either direct or indirect shall rest upon the curator(s) or any of their employees or agents for the effects of any product, process or method that may be produced or adopted by any part, notwithstanding that the formulation of such product, process or method may be based upon information here provided ...
Fluorescein Analogues Inhibit SecA ATPase: The First Sub-micromolar Inhibitor of Bacterial Protein Translocation - Huang - 2012...
SecA is a central component of the general secretion system that is essential for bacterial growth and thus an ideal target for antimicrobial agents. A series of fluorescein analogues were first screened against the ATPase activity using the truncated unregulated SecA catalytic domain. Rose bengal (RB) and erythrosin B (EB) were found to be potent inhibitors SecA with IC50 values of 0.5 μM and 2 μM, respectively. RB and EB inhibit the catalytic SecA ATPase more effectively than the F1F0-proton ATPase. We used three assays to test the effect of these compounds on full-length SecA ATPase: in solution (intrinsic ATPase), in membrane preparation, and translocation ATPase. RB and EB show the following trend in terms of IC50 values: translocation ATPase,membrane ATPase,intrinsic ATPase. Very importantly, the potency of these fluorescein analogues in inhibiting the truncated SecA ATPase correlates with their ability to inhibit the biologically relevant protein translocation activity of SecA. The in ...
Plus it
A cell surface-located nucleoside triphosphatase activity can be assayed in liver epithelial cultures in situ with the incubation of intact cells in a medium containing [γ-32P]adenosine triphosphate and correlated with the tumorigenicity of these cells in neonatal Wistar rats. The ectoenzyme activity of normal diploid cell lines is minimal, whereas a considerably high activity has been found in all tumorigenic cell lines tested. The optimum condition for the adenosinetriphosphatase activity is physiological with regard to osmolarity, ionic composition, pH, and substrate concentration in the medium. The enzyme is significantly stimulated by Ca2+, and its activation is controlled by Mg2+. Histochemical examinations indicate that glutaraldehyde-fixed cells of tumorigenic lines have Ca2+-stimulated adenosinetriphosphatase activity on the external surface. The isotopic assay of adenosine triphosphate hydrolysis by intact cells may provide a rapid method for screening oncogenesis in vitro of liver ...
Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial...
Fingerprint Dive into the research topics of Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial membrane. Together they form a unique fingerprint. ...
LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: ...
LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: CYTOCHEMICAL AND CELLISOLATION STUDIES ON THE BRANCHIAL EPITHELIUM OF THE PINFISH, LAGODON ...
Ca <sup>2+</sup> ](i) and pH(in) homeostasis in Kaposi sarcoma cells ...
TY - JOUR. T1 - [Ca 2+ ](i) and pH(in) homeostasis in Kaposi sarcoma cells AU - Martínez-Zaguilán, Raul. AU - Chinnock, Brian F.. AU - Wald-Hopkins, Sarah. AU - Bernas, Mike. AU - Way, Dennis. AU - Weinand, Martin. AU - Witte, Marlys H.. AU - Gillies, Robert J.. PY - 1996/1/1. Y1 - 1996/1/1. N2 - Changes in intracellular pH (pH(in)) and intracellular calcium concentration [Ca 2+ ](i) play a major role in signal transduction leading to cell growth, differentiation and transformation. In some tumor cell lines, vacuolar (V-type) H + -adenosine triphosphatases (ATPases) are important in pH(in) regulation. To clarify the neoplastic nature and endothelial origin of Kaposi sarcoma (KS), pH(in) and [Ca 2+ ](i) and the functional expression of V-type H + -ATPases were evaluated in cultured endothelial marker-positive KS cells derived from AIDS-KS skin lesions as compared to human umbilical vein endothelial cells (HUVEC). Human skin fibroblasts (HSF) were also examined. Cells were examined using ...
Adenosine triphosphatase test synonyms, adenosine triphosphatase test antonyms - FreeThesaurus.com
Hsp70 - Wikipedia
The Hsp70 system interacts with extended peptide segments of proteins as well as partially folded proteins to prevent aggregation, remodel folding pathways, and regulate activity[7] When not interacting with a substrate peptide, Hsp70 is usually in an ATP bound state. Hsp70 by itself is characterized by a very weak ATPase activity, such that spontaneous hydrolysis will not occur for many minutes. As newly synthesized proteins emerge from the ribosomes, the substrate binding domain of Hsp70 recognizes sequences of hydrophobic amino acid residues, and interacts with them. This spontaneous interaction is reversible, and in the ATP bound state Hsp70 may relatively freely bind and release peptides. However, the presence of a peptide in the binding domain stimulates the ATPase activity of Hsp70, increasing its normally slow rate of ATP hydrolysis. When ATP is hydrolyzed to ADP the binding pocket of Hsp70 closes, tightly binding the now-trapped peptide chain. Further speeding ATP hydrolysis are the ...
Circadian rhythm of adenosine triphosphatase activity and 32P content in Pliss lymphosarcoma
Abstract: Within a daily period maximal activity of ATPases and content of 32P in Pliss lymphosarcoma tissue was found in the samples taken at 15 or 21 p.m. and 3 a.m. The radioactivity in the tumor was minimal between 9 and 12 a.m. and 18 or 24 p.m. The alterations in Mg2+-ATPase activity in their magnitude and circadian rhythm coincided completely with the daily variations in content of radiophosphorus. Activities of Na+, K+- and HCO(3-)-ATPases exhibited maximal values at 15 p.m. and, especially between 3 and 6 a.m., i.e. these alterations were of two-peak shape without the peak at 21 p.m ...
PLOS ONE: Spastins Microtubule-Binding Properties and Comparison to Katanin
Spastin and katanin are ring-shaped hexameric AAA ATPases that sever microtubules, and thus crucially depend on a physical interaction with microtubules. For the first time, we report here the microtubule binding properties of spastin at the single-molecule level, and compare them to katanin. Microscopic fluorescence assays showed that human spastin bound to microtubules by ionic interactions, and diffused along microtubules with a diffusion coefficient comparable to katanin. The microscopic measurement of landing and dissociation rates demonstrated the ionic character of the interaction, which could be mapped to a patch of three lysine residues outside of the catalytic domain of human spastin. This motif is not conserved in Drosophila spastin or katanin, which also bound by non-catalytic parts of the protein. The binding affinities of spastin and katanin were nucleotide-sensitive, with the lowest affinities under ADP,, the highest under ATP-γS conditions. These changes correlated with the formation of
ATPase-dependent cooperative binding of ORC and Cdc6 to origin DNA
Binding of Cdc6 to the origin recognition complex (ORC) is a key step in the assembly of a pre-replication complex (pre-RC) at origins of DNA replication. ORC recognizes specific origin DNA sequences in an ATP-dependent manner. Here we demonstrate cooperative binding of Saccharomyces cerevisiae Cdc6 …
Effects of Chelators and Calcium Ions on the Response of Renal Adenosine Triphosphatase Activity to Hormones and Concanavalin A...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
RCSB PDB - 2IHY: Structure of the Staphylococcus aureus putative ATPase subunit of an ATP-binding cassette (ABC) transporter
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Actl6a - Actin-like protein 6A - Mus musculus (Mouse) - Actl6a gene & protein
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Required for maximal ATPase activity of SMARCA4/BRG1/BAF190A and for association of the SMARCA4/BRG1/BAF190A containing remodeling complex BAF with chromatin/nuclear matrix. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural
Medizinische Universität Graz Austria/Österreich - Forschungsportal - Medical University of Graz
Hsp90 couples ATP hydrolysis to large conformational changes essential for activation of client proteins. The structural transitions involve dimerization of the N-terminal domains and formation of closed states involving the N-terminal and middle domains. Here, we used Hsp90 mutants that modulate ATPase activity and biological function as probes to address the importance of conformational cycling for Hsp90 activity. We found no correlation between the speed of ATP turnover and the in vivo activity of Hsp90: some mutants with almost normal ATPase activity were lethal, and some mutants with lower or undetectable ATPase activity were viable. Our analysis showed that it is crucial for Hsp90 to attain and spend time in certain conformational states: a certain dwell time in open states is required for optimal processing of client proteins, whereas a prolonged population of closed states has negative effects. Thus, the timing of conformational transitions is crucial for Hsp90 function and not cycle ...
Regulation of Cytoplasmic Dynein ATPase by Lis1 | Journal of Neuroscience
This work establishes Lis1 as a dynein regulatory protein and links its function to dynein enzymatic activity. The simplest interpretation of our data is that Lis1 acts specifically and directly on dynein. Although the increase in ATPase activity is modest at first glance, our determination that only one-third of the dynein molecules interacted with Lis1 suggests that there were two populations of motors present in the ATPase assay. The major population did not stably bind Lis1 and is not expected to have had any change in ATPase activity, whereas a smaller population binds Lis1, resulting in a boost in ATPase activity. In this scenario, the enzymatic activity of the dynein as a whole would have increased by only 40%, but the activity of Lis1-associated motors may have increased by ∼100%.. The finding that Lis1 can stimulate dynein in vitro supports our model that Lis1 has an activating influence on dynein in cells (Smith et al., 2000). In our previous work, we found that raising Lis1 ...
Study of energy consumption by Na+/K+ ATPase using PercevalHR
Adenosine triphosphate (ATP) is an important macro molecule that is the prime supplier of energy to run cell metabolism and to regulate several physiological processes in a cell. Despite its central role, the number of non-invasive methods to study ATP on a single cell level in real time are limited. ATPases use energy derived from ATP hydrolysis to maintain cell membrane potential by regulating ion gradients across the plasma membrane. It is generally believed that the Na+/K+-ATPase (NKA) which belongs to the P-type ATPase superfamily represent the main energy consumer among the ATPases. In this study, we set out to quantify ATP consumption by NKA on a single cell level in human embryonic kidney cells (HEK293a) using PercevalHR, a genetically encoded fluorescent biosensor that reports changes in the ATP:ADP during live cell imaging. We demonstrate that ATP hydrolysis by NKA is faster at physiological temperatures (35 -37°C) compared to room temperature. K+ free KREBS pre-treatment increased ...
KTN80 confers precision to microtubule severing by specific targeting of katanin complexes in plant cells | The EMBO Journal
The microtubule (MT)‐severing enzyme katanin triggers dynamic reorientation of cortical MT arrays that play crucial functions during plant cell morphogenesis, such as cell elongation, cell wall biosynthesis, and hormonal signaling. MT severing specifically occurs at crossover or branching nucleation sites in living Arabidopsis cells. This differs from the random severing observed along the entire length of single MTs in vitro and strongly suggests that a precise control mechanism must exist in vivo. However, how katanin senses and cleaves at MT crossover and branching nucleation sites in vivo has remained unknown. Here, we show that the katanin p80 subunit KTN80 confers precision to MT severing by specific targeting of the katanin p60 subunit KTN1 to MT cleavage sites and that KTN1 is required for oligomerization of functional KTN80-KTN1 complexes that catalyze severing. Moreover, our findings suggest that the katanin complex in Arabidopsis is composed of a hexamer of KTN1-KTN80 heterodimers ...
Difference between revisions of Biomolecular Breadboards:Preliminary Data - OpenWetWare
Implementing protein degradation is integral to enabling the function of many dynamical circuits, such as oscillators or feed-forward loops. We have been exploring the overexpression of AAA ATPases ClpXP to selectively target proteins with degradation tags. Initial experiments indicate that ClpXP, when overexpressed, can accelerate degradation of purified eGFP-ssrA (Fig. 1). We will further characterize this AAA ATPase family, as well as try to demonstrate its use through an incoherent feed-forward loop. We have not been able to replicate the results by adding purified ClpXP protein. However, we intend to express ClpXP off of plasmids or to create custom extract with ClpXP already overexpressed to enable rapid protein degradation. ...
Condensin complex subunit 1 (zebrafish) | Protein Target - PubChem
Protein target information for Condensin complex subunit 1 (zebrafish). Find diseases associated with this biological target and compounds tested against it in bioassay experiments.
Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
RPN12 (YFR052W) Result Summary | BioGRID
Subunit Of The 19S Regulatory Particle Of The 26S Proteasome Lid; Synthetically Lethal With RPT1, Which Is An ATPase Component Of The 19S Regulatory Particle; Physically Interacts With Nob1p And Rpn3p; Protein Abundance Increases In Response To DNA Replication Stress
Gene Ontology Classifications
Predicted to have DNA clamp unloader activity. Involved in several processes, including B cell activation; intracellular signal transduction; and positive regulation of B cell activation. Localizes to nucleus. Is expressed in liver; metanephros; midbrain ventricular layer; renal cortex; and telencephalon ventricular layer. Orthologous to human ATAD5 (ATPase family AAA domain containing 5 ...
Sodium/potassium-transporting ATPase subunit alpha-3
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012 ...
Sydney Research Online: Browsing Sydney Research Online
Altered intracellular localization and valosin-containing protein (p97 VCP) interaction underlie ATP7A-related distal motor neuropathy, Human Molecular Genetics, vol.21, 8, 2012,pp 1794-1807 ...
PDB 1gaj structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBI
1gaj: Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
Histoenzymological study of myocardial ATPase activity in experimental infarction in the rat.
Histoenzymological techniques were used to examine ATPase activity in rat heart muscle fibres after experimental infarction. 25 hours after coronary ligation, ATPase activity in all ventricular section fibres was high, homogeneous at pH 9.4, sections
Studies of E. coli Min proteins - Lawrence Rothfield
The long-range goal of this project is to determine the mechanism used by bacteria to select the proper cell division site at midcell. The three Min proteins, M...
The erythrocyte ATPase activities taken from normal rat | Open-i
The erythrocyte ATPase activities taken from normal rats when incubated in supernates of boiled plasma from control normotensive and experimental hypertensive r
ATAD2 Antibody (PCRP-ATAD2-1F12) - DSHB
Monoclonal antibody against ATPase family AAA domaining containg 2 expressed by ATAD2 for use in Immunoprecipitation, Microarray, Western Blot against Human
TCDB » SEARCH
TadABC complex; the Flp pilus assembly complex, consisting of one ATPase component, TadA or CpaF, and two membrane components, TadB (218 aas and 3 - 5 TMSs) and TadC (200 aas and 2 N- and C-terminal TMSs) (Bottacini et al. 2017 ...
Seca 374 Baby Scale with BMIF
Seca 374 Baby Scale with BMIF - $479 No Tax - Buy Seca Baby Scale with Wireless Transmission to EMR Sytems. Easy online ordering from Cascade HealthCare Products Inc
CAF16 (YFL028C) Result Summary | BioGRID
Part Of Evolutionarily-conserved CCR4-NOT Regulatory Complex; Contains Single ABC-type ATPase Domain But No Transmembrane Domain; Interacts With Several Subunits Of Mediator
Addgene: pCMV-Tag 3B/myc-M87L195V
Plasmid pCMV-Tag 3B/myc-M87L195V from Dr. Peter Baass lab contains the insert SPAST and is published in Hum Mol Genet. 2010 Jul 15;19(14):2767-79. doi: 10.1093/hmg/ddq177. Epub 2010 Apr 29. This plasmid is available through Addgene.
ISW1-N抗体|Abcam中国|Anti-ISW1-N抗体
ISW1-N小鼠多克隆抗体(ab43434)可与酿酒酵母样本反应并经WB, IP, ICC/IF实验严格验证。中国75%以上现货,所有产品提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。