Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).

hsa:51166 K00825 kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39] , (RefSeq) AADAT, KAT2, KATII, KYAT2; aminoadipate aminotransferase (A) MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL IKESL ...

AADAT Antibody (Cat. No. 48-417) can be used to detect Gibbon, Gorilla, Human, Monkey AADAT Antibody in IHC and other applications.

Search Molecular targets, 3D Structures, Protein families, Compounds, Diseases, Genes, Drugs | the Cancer Drug Discovery Platform | ICR CRUK Cancer Therapeutics Unit | canSAR Black

This review provides a description of the biochemistry and enzymology of the α-aminoadipate pathway for lysine biosynthesis in fungi. The α-aminoadipate pathway is unique to fungi and is thus a potential target for the rational design of antifungal drugs. The present state of knowledge of the mechanisms of the seven enzymes in the pathway is presented, as well as detailed information with respect to structures and mechanisms of homocitrate synthase, saccharopine reductase, and saccharopine dehydrogenase. ...

AADAT Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AADAT protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

Accepted name: lysine-8-amino-7-oxononanoate transaminase. Reaction: L-lysine + 8-amino-7-oxononanoate = (S)-2-amino-6-oxohexanoate + 7,8-diaminononanoate. Glossary: (S)-2-amino-6-oxohexanoate = L-2-aminoadipate 6-semialdehyde = L-allysine. Other name(s): DAPA aminotransferase (ambiguous); bioA (gene name) (ambiguous); bioK (gene name). Systematic name: L-lysine:8-amino-7-oxononanoate aminotransferase. Comments: A pyridoxal 5-phosphate enzyme [2]. Participates in the pathway for biotin biosynthesis. The enzyme from the bacterium Bacillus subtilis cannot use S-adenosyl-L-methionine as amino donor and catalyses an alternative reaction for the conversion of 8-amino-7-oxononanoate to 7,8-diaminononanoate (cf. EC 2.6.1.62, adenosylmethionine-8-amino-7-oxononanoate transaminase).. Links to other databases: BRENDA, EXPASY, KEGG, MetaCyc, CAS registry number:. References:. 1. Van Arsdell, S.W., Perkins, J.B., Yocum, R.R., Luan, L., Howitt, C.L., Chatterjee, N.P. and Pero, J.G. Removing a bottleneck in ...

The Summary of Product Characteristics (SPC or SmPC) is a specific document, the wording of which has been agreed with the regulatory authority as part of the medicine approval process. It is required before any medicine is allowed on the market in Europe. It is designed to assist doctors and pharmacists in prescribing and supplying the product ...

The KOMP Repository is located at the University of California Davis and Childrens Hospital Oakland Research Institute. Question? Comments? For Mice, Cells, and germplasm please contact us at [email protected], US 1-888-KOMP-MICE or International +1-530-752-KOMP, or for vectors [email protected] or +1-510-450-7917 ...

VitaGlo.com - Now Vitamins, Now Foods, EAS, Met-Rx, MuscleTech, and many more Diet, Vitamins, Minerals, Herbal Products. VitaGlo.com is your first choice for nutritional supplements, health, body, and muscle building products

AccuWeather.com provided daily cold and flu weather forecast in Bend, OR. See how the weather will impact the flu and common cold

Rabbit polyclonal antibody raised to a synthetic peptide corresponding to residues 1-22 of Kynurenine Aminotransferase II (KAT II); the epitope for the antibody was derived from human protein sequence that shows homology to mouse protein sequence. ...

Ab Aadat Hogayi Hai Lockdown Ki, says Mehran. Even if I wanted to, I couldnt relate to him. The lockdowns that Mehran and I are used to are quite different. I was forced to stay indoors, to keep myself safe from a deadly virus. I was privileged, safe, with my family. I worked from home using my laptop and high speed-WiFi. I used the same network to conduct virtual Netflix Parties with my friends and video call them for hours. We challenged each other to upload photographs on Instagram and whip the perfect Dalgona Coffee. People like me went on virtual dates and attended paid online events. Once in a while, we drove our cars an extra kilometre, when we stepped out to buy essentials.. Mehran couldnt relate to my version of a lockdown ...

Background/Purpose: The chance of upper gastrointestinal blood loss (UGIB) increases in patients with coronary artery disease (CAD) because of the frequent usage of antiplatelets. had been significantly old, and had more often utilized antiplatelets and warfarin than in non-CAD individuals. Weighed against non-CAD, the CAD individuals had considerably higher GlasgowCBlatchford rating, complete and pre-endoscopic Rockall rating and complete. Peptic ulcer in CAD individuals was identified more regularly than in non-CAD individuals. UGIB individuals with CAD and non-CAD got similar outcomes in regards to to mortality price, re-bleeding, medical procedures, embolization, and loaded erythrocyte transfusion. Nevertheless, CAD individuals had longer length of hospital remains than non-CAD individuals. Two CAD individuals passed away from cardiac arrest after endoscopy, whereas three non-CAD individuals passed away from pneumonia and severe renal failure throughout their hospitalization. Summary: In ...

Data Availability StatementThe data used to support the results of the research are included within this article. wound healing, and transwell assays, indicating that miR-486-5p is an HCC suppressor. We employed four miRNA databases to predict the target genes of miR-486-5p and verified retrieved genes using qPCR and western blotting. The E3 ubiquitin ligase CBL was significantly downregulated by miR-486-5p overexpression in HCC cell lines at both mRNA and protein level, and overexpression of CBL counteracted the inhibitory effects of miR-486-5p on HCC cell proliferation and migration. Moreover, CBL expression was negatively correlated with miR-486-5p expression in HCC tissues. Collectively, our results suggest that miR-486-5p may S/GSK1349572 cell signaling act as a tumor suppressor gene in HCC by downregulating CBL expression. 1. Introduction Hepatocellular carcinoma (HCC) is the sixth most common cancer worldwide and the third leading cause of cancer-related mortality [1]. Although ...

PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.

TY - JOUR. T1 - Lysine metabolism in mammalian brain. T2 - An update on the importance of recent discoveries. AU - Hallen, André. AU - Jamie, Joanne F.. AU - Cooper, Arthur J L. PY - 2013/12. Y1 - 2013/12. N2 - The lysine catabolism pathway differs in adult mammalian brain from that in extracerebral tissues. The saccharopine pathway is the predominant lysine degradative pathway in extracerebral tissues, whereas the pipecolate pathway predominates in adult brain. The two pathways converge at the level of δ1-piperideine-6-carboxylate (P6C), which is in equilibrium with its open-chain aldehyde form, namely, α-aminoadipate δ-semialdehyde (AAS). A unique feature of the pipecolate pathway is the formation of the cyclic ketimine intermediate δ1-piperideine-2- carboxylate (P2C) and its reduced metabolite l-pipecolate. A cerebral ketimine reductase (KR) has recently been identified that catalyzes the reduction of P2C to l-pipecolate. The discovery that this KR, which is capable of reducing not only ...

0026]1. Okuno E, Nishikawa T, M Nakamura, (1996) Kynurenine aminotransferases in the rat. Localization and Characterization. Recent Advances in Tryptophan Research, edited by Graziella Allegri Filipini et al., Plenum Press, New Your, 1996.2. B. Kepplinger, H. Baran, A. Kainz, H. Ferraz-Leite, J. Newcombe and P. Kalina (2005) Age-related increase of kynurenic acid in human cerebrospinal fluid: Positive corratio with IgG and Sa-microglobulin changes. Neurosignals, 14(3), 126-135.3. Kepplinger B, Baran H, Kainz A, Zeiner D, Wallner J (2006) Cerebrospinal Fluid of Multiple Sclerosis patients exert significantly weaker inhibition of Kynurenine Aminotransferase I activity in rat liver homogenate. Multiple Sclerosis 2006; 12:S1-S228, P4964. H. Baran, B. Kepplinger, M. Draxler and H. Ferraz-Leite (2004) Kynurenic acid metabolism in rat, piglet and human tissues. In European Society for Clinical Neuropharmacology by ed L. Battistin, International Proceedings MEDIMOND S.r.1. E505R9004, 227-231.5. H. ...

TEXTBOOKS. Goodman SI, Frerman FE. Organic acidemias due to defects in lysine oxidation: 2-ketoadipic acidemia and glutaric acidemia. In: Scriver CR, Beaudet AL, Sly WS, et al. Eds. The Metabolic Molecular Basis of Inherited Disease. 7th ed. McGraw-Hill Companies. New York, NY; 1995:1451-60.. JOURNAL ARTICLES. Bahr O, Mader I, Zschocke J, et al. Adult onset glutaric aciduria type I presenting with leukoencephalopathy. Neurology. 2002;59:1802-04.. Kolker S, Ramaekers VT, Zschocke J, et al. Acute encephalopathy despite early therapy in a patient with homozygosity for E365K in the glutaryl-coenzyme A dehydrogenase gene. J Pediatr 2001;138:277-79.. Zafeiriou DI, Zschocke J, Augustidou-Savvopoulou P, et al. Atypical and variable clinical presentation of glutaric aciduria type I. Neuropediatrics. 2000;31:303-06.. Kafil-Hussain NA, Monavari A, Bowell R, et al. Ocular findings in glutaric aciduria type I. J Pediatr Ophthalmol Strabismus. 2000;37:289-93.. Busquets C, Coll MJ, Merinero B, et al. Prenatal ...

Infectious Disease Advisor is used by specialists and other medical professionals to help understand and treat infectious diseases. Latest news, research and treatment articles.

We offer clinical cancer updates, treatment guidance, and research news to the oncology nursing community. Visit us often for drug therapy testing results, patient care information and more. Download our FREE app today.

OVERVIEW: What every practitioner needs to know Are you sure your patient has glutaric aciduria type I? What are the typical findings for this disease? Glutaric aciduria type I (GA-I) should be considered in any patient who has a history of dystonia/dyskinesia with macrocephaly. Prior to these overt chronic neurologic symptoms, there is usually a…. ...

Penicillins (Penams) and cephalosporins (cephems) are beta-lactam antibiotics containing 6-aminopenicillanate (6-APA) and 7-aminocephalosporanate (7-ACA) nuclei, respectively. 6-APA and 7-ACA are key intermediates for a variety of semisynthetic penicillin and cephalosporin derivatives. Penicillins are produced only by fungi, while cephalosporins (including cephamycins) are produced by fungi and bacteria. Both antibiotics are synthesized from L-2-aminoadipate, L-cysteine and L-valine through a common pathway. It starts with the condensation of these three amino acids by the non-ribosomal peptide synthetase to form the tripeptide delta-(L-2-aminoadipyl)-L-cysteinyl-D-valine (ACV). The linear ACV tripeptide is then converted to bicyclic isopenicillin N by isopenicillin N synthase, in which the beta-lactam ring is formed. Isopenicillin N is the branch point of penicillin [MD:M00672] and cephalosporin [MD:M00673] pathways ...

Aminoadipic acid (2-aminoadipate) is a metabolite in the principal biochemical pathway of lysine. It is an intermediate in the metabolism (i.e. breakdown or degradation) of lysine and saccharopine.(Wikipedia). It antagonizes neuroexcitatory activity modulated by the glutamate receptor, N-methyl-D-aspartate; (NMDA). Aminoadipic has also been shown to inhibit the production of kynurenic acid in brain tissue slices (PMID: 8566117 ). Kynurenic acid is a broad spectrum excitatory amino acid receptor antagonist. Recent studies have shown that aminoadipic acid is elevated in prostate biopsy tissues from prostate cancer patients (PMID: 23737455 ). Mutations in DHTKD1 (dehydrogenase E1 and transketolase domain-containing protein 1) have been shown to cause human 2-aminoadipic and 2-oxoadipic aciduria via impaired turnover of decarboxylation 2-oxoadipate to glutaryl-CoA, which is the last step in the lysine degradation pathway (PMID: 23141293 ). Aging, diabetes, sepsis and renal failure are known to ...

Genetic testing for the GCDH gene, which is associated with glutaric aciduria type I (GA1) and elevated C5-DC on newborn screening (NBS) or acylcarnitine analysis.

1E5Q: Crystal Structure of Saccharopine Reductase from Magnaporthe Grisea, an Enzyme of the Alpha-Aminoadipate Pathway of Lysine Biosynthesis

3-methylglutaconic aciduria type 1 (3MGA1) is a genetic disorder in which the body cannot get energy from a substance called leucine. Leucine is one of the amino acids, which are the building blocks of proteins in our bodies. Because people with 3MGA1 cant break down leucine for energy to support muscle function and growth, they have a variety of symptoms that are present at birth. These symptoms may include developmental delays, seizures, muscle twitches (dystonia), and muscle weakness.. 3MGA1 is caused by a mutation (change) to the AUH gene, which produces a protein to break down leucine. When there is a mutation to the AUH gene, this protein either isnt produced or isnt functional, so the body cant get energy from leucine. Under normal conditions, the protein is present in the part of the cell that produces energy (the mitochondria), so 3MGA1 is a type of mitochondrial disease. 3MGA1 is also an organic acid condition because it causes harmful 3-methylglutaconic acid build up in the ...

Looking for online definition of Glutaric aciduria type 1 in the Medical Dictionary? Glutaric aciduria type 1 explanation free. What is Glutaric aciduria type 1? Meaning of Glutaric aciduria type 1 medical term. What does Glutaric aciduria type 1 mean?

Free, official coding info for 2018 ICD-10-CM E71.313 - includes detailed rules, notes, synonyms, ICD-9-CM conversion, index and annotation crosswalks, DRG grouping and more.