A plant species of the family POACEAE. It is a tall grass grown for its EDIBLE GRAIN, corn, used as food and animal FODDER.
Proteins found in plants (flowers, herbs, shrubs, trees, etc.). The concept does not include proteins found in vegetables for which VEGETABLE PROTEINS is available.
A cone-shaped structure in plants made up of a mass of meristematic cells that covers and protects the tip of a growing root. It is the putative site of gravity sensing in plant roots.
The functional hereditary units of PLANTS.
The usually underground portions of a plant that serve as support, store food, and through which water and mineral nutrients enter the plant. (From American Heritage Dictionary, 1982; Concise Dictionary of Biology, 1990)
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in plants.
The encapsulated embryos of flowering plants. They are used as is or for animal feed because of the high content of concentrated nutrients like starches, proteins, and fats. Rapeseed, cottonseed, and sunflower seed are also produced for the oils (fats) they yield.
Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)
The directional growth of organisms in response to gravity. In plants, the main root is positively gravitropic (growing downwards) and a main stem is negatively gravitropic (growing upwards), irrespective of the positions in which they are placed. Plant gravitropism is thought to be controlled by auxin (AUXINS), a plant growth substance. (From Concise Dictionary of Biology, 1990)
A group of alcohol-soluble seed storage proteins from the endosperm of corn.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Deoxyribonucleic acid that makes up the genetic material of plants.
New immature growth of a plant including stem, leaves, tips of branches, and SEEDLINGS.
The genetic complement of a plant (PLANTS) as represented in its DNA.
Acetic acid derivatives of the heterocyclic compound indole. (Merck Index, 11th ed)
An enzyme that catalyzes the reaction of ATP, pyruvate, and orthophosphate to form AMP plus phosphoenolpyruvate plus pyrophosphate. EC 2.7.9.1.
Complex nucleoprotein structures which contain the genomic DNA and are part of the CELL NUCLEUS of PLANTS.
(S-(E))-3,4,5,6,8,10-Hexahydro-14,16-dihydroxy-3-methyl-1H-2-benzoxacyclotetradecin-1,7(8H)-dione. One of a group of compounds known under the general designation of resorcylic acid lactones. Cis, trans, dextro and levo forms have been isolated from the fungus Gibberella zeae (formerly Fusarium graminearum). They have estrogenic activity, cause toxicity in livestock as feed contaminant, and have been used as anabolic or estrogen substitutes.
Nutritive tissue of the seeds of flowering plants that surrounds the EMBRYOS. It is produced by a parallel process of fertilization in which a second male gamete from the pollen grain fuses with two female nuclei within the embryo sac. The endosperm varies in ploidy and contains reserves of starch, oils, and proteins, making it an important source of human nutrition.
Ribonucleic acid in plants having regulatory and catalytic roles as well as involvement in protein synthesis.
PLANTS, or their progeny, whose GENOME has been altered by GENETIC ENGINEERING.
Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.
The fertilizing element of plants that contains the male GAMETOPHYTES.
Cultivated plants or agricultural produce such as grain, vegetables, or fruit. (From American Heritage Dictionary, 1982)
Very young plant after GERMINATION of SEEDS.
Any of the hormones produced naturally in plants and active in controlling growth and other functions. There are three primary classes: auxins, cytokinins, and gibberellins.
A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)
A group of FLAVONOIDS derived from FLAVONOLS, which lack the ketone oxygen at the 4-position. They are glycosylated versions of cyanidin, pelargonidin or delphinidin. The conjugated bonds result in blue, red, and purple colors in flowers of plants.
Process whereby a cell, bodily structure, or organism (animal or plant) receives or detects a gravity stimulus. Gravity sensing plays an important role in the directional growth and development of an organism (GRAVITROPISM).
The unconsolidated mineral or organic matter on the surface of the earth that serves as a natural medium for the growth of land plants.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Annual cereal grass of the family POACEAE and its edible starchy grain, rice, which is the staple food of roughly one-half of the world's population.
The mating of plants or non-human animals which are closely related genetically.
A large family of narrow-leaved herbaceous grasses of the order Cyperales, subclass Commelinidae, class Liliopsida (monocotyledons). Food grains (EDIBLE GRAIN) come from members of this family. RHINITIS, ALLERGIC, SEASONAL can be induced by POLLEN of many of the grasses.
The relationships of groups of organisms as reflected by their genetic makeup.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Abscission-accelerating plant growth substance isolated from young cotton fruit, leaves of sycamore, birch, and other plants, and from potatoes, lemons, avocados, and other fruits.
Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.
Organic matter in a state of advanced decay, after passing through the stages of COMPOST and PEAT and before becoming lignite (COAL). It is composed of a heterogenous mixture of compounds including phenolic radicals and acids that polymerize and are not easily separated nor analyzed. (E.A. Ghabbour & G. Davies, eds. Humic Substances, 2001).
The imide of phthalic acids.
Acceleration produced by the mutual attraction of two masses, and of magnitude inversely proportional to the square of the distance between the two centers of mass. It is also the force imparted by the earth, moon, or a planet to an object near its surface. (From NASA Thesaurus, 1988)
Plant cell inclusion bodies that contain the photosynthetic pigment CHLOROPHYLL, which is associated with the membrane of THYLAKOIDS. Chloroplasts occur in cells of leaves and young stems of plants. They are also found in some forms of PHYTOPLANKTON such as HAPTOPHYTA; DINOFLAGELLATES; DIATOMS; and CRYPTOPHYTA.
Discrete segments of DNA which can excise and reintegrate to another site in the genome. Most are inactive, i.e., have not been found to exist outside the integrated state. DNA transposable elements include bacterial IS (insertion sequence) elements, Tn elements, the maize controlling elements Ac and Ds, Drosophila P, gypsy, and pogo elements, the human Tigger elements and the Tc and mariner elements which are found throughout the animal kingdom.
Pesticides used to destroy unwanted vegetation, especially various types of weeds, grasses (POACEAE), and woody plants. Some plants develop HERBICIDE RESISTANCE.
Endoscopic examination, therapy or surgery of the female pelvic viscera by means of an endoscope introduced into the pelvic cavity through the posterior vaginal fornix.
The entity of a developing mammal (MAMMALS), generally from the cleavage of a ZYGOTE to the end of embryonic differentiation of basic structures. For the human embryo, this represents the first two months of intrauterine development preceding the stages of the FETUS.
A technique for maintenance or growth of animal organs in vitro. It refers to three-dimensional cultures of undisaggregated tissue retaining some or all of the histological features of the tissue in vivo. (Freshney, Culture of Animal Cells, 3d ed, p1)
Differential and non-random reproduction of different genotypes, operating to alter the gene frequencies within a population.
Board members of an institution or organization who are entrusted with the administering of funds and the directing of policy.
Aid for consistent recording of data such as tasks completed and observations noted.
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.

Cloning and characterization of a maize cytochrome-b5 reductase with Fe3+-chelate reduction capability. (1/5543)

We previously purified an NADH-dependent Fe3+-chelate reductase (NFR) from maize roots with biochemical features of a cytochrome-b5 reductase (b5R) [Sparla, Bagnaresi, Scagliarini and Trost (1997) FEBS Lett. 414, 571-575]. We have now cloned a maize root cDNA that, on the basis of sequence information, calculated parameters and functional assay, codes for NFR. Maize NFR has 66% and 65% similarity to mammal and yeast b5R respectively. It has a deduced molecular mass of 31.17 kDa and a pI of 8.53. An uncharged region is observed at its N-terminus but no myristoylation consensus site is present. Taken together, these results, coupled with previous biochemical evidence, prove that NFR belongs to the b5R class and document b5R from a plant at the molecular level for the first time. We have also identified a putative Arabidopsis thaliana NFR gene. Its organization (nine exons) closely resembles mammalian b5Rs. Several NFR isoforms are expected to exist in maize. They are probably not produced by alternative translational mechanisms as occur in mammals, because of specific constraints observed in the maize NFR cDNA sequence. In contrast with yeast and mammals, tissue-specific and various subcellular localizations of maize b5R isoforms could result from differential expression of the various members of a multigene family. The first molecular characterization of a plant b5R indicates an overall remarkable evolutionary conservation for these versatile reductase systems. In addition, the well-characterized Fe3+-chelate reduction capabilities of NFR, in addition to known Fe3+-haemoglobin reduction roles for mammal b5R isoforms, suggest further and more generalized roles for the b5R class in endocellular iron reduction.  (+info)

Gibberellic acid stabilises microtubules in maize suspension cells to cold and stimulates acetylation of alpha-tubulin. (2/5543)

Gibberellic acid is known to stabilise microtubules in plant organs against depolymerisation. We have now devised a simplified cell system for studying this. Pretreatment of a maize cell suspension with gibberellic acid for just 3 h stabilised protoplast microtubules against depolymerisation on ice. In other eukaryotes, acetylation of alpha-tubulin is known to correlate with microtubule stabilisation but this is not established in plants. By isolating the polymeric tubulin fraction from maize cytoskeletons and immunoblotting with the antibody 6-11B-1, we have demonstrated that gibberellic acid stimulates the acetylation of alpha-tubulin. This is the first demonstrated link between microtubule stabilisation and tubulin acetylation in higher plants.  (+info)

Patterns of evolutionary rate variation among genes of the anthocyanin biosynthetic pathway. (3/5543)

The anthocyanin biosynthetic pathway is responsible for the production of anthocyanin pigments in plant tissues and shares a number of enzymes with other biochemical pathways. The six core structural genes of this pathway have been cloned and characterized in two taxonomically diverse plant species (maize and snapdragon). We have recently cloned these genes for a third species, the common morning glory, Ipomoea purpurea. This additional information provides an opportunity to examine patterns of evolution among genes within a single biochemical pathway. We report here that upstream genes in the anthocyanin pathway have evolved substantially more slowly than downstream genes and suggest that this difference in evolutionary rates may be explained by upstream genes being more constrained because they participate in several different biochemical pathways. In addition, regulatory genes associated with the anthocyanin pathway tend to evolve more rapidly than the structural genes they regulate, suggesting that adaptive evolution of flower color may be mediated more by regulatory than by structural genes. Finally, for individual anthocyanin genes, we found an absence of rate heterogeneity among three major angiosperm lineages. This rate constancy contrasts with an accelerated rate of evolution of three CHS-like genes in the Ipomoea lineage, indicating that these three genes have diverged without coordinated adjustment by other pathway genes.  (+info)

Inhibition of plant-pathogenic fungi by a corn trypsin inhibitor overexpressed in Escherichia coli. (4/5543)

The cDNA of a 14-kDa trypsin inhibitor (TI) from corn was subcloned into an Escherichia coli overexpression vector. The overexpressed TI was purified based on its insolubility in urea and then refolded into the active form in vitro. This recombinant TI inhibited both conidium germination and hyphal growth of all nine plant pathogenic fungi studied, including Aspergillus flavus, Aspergillus parasiticus, and Fusarium moniliforme. The calculated 50% inhibitory concentration of TI for conidium germination ranged from 70 to more than 300 microgram/ml, and that for fungal growth ranged from 33 to 124 microgram/ml depending on the fungal species. It also inhibited A. flavus and F. moniliforme simultaneously when they were tested together. The results suggest that the corn 14-kDa TI may function in host resistance against a variety of fungal pathogens of crops.  (+info)

Natural occurrence of the C series of fumonisins in moldy corn. (5/5543)

We analyzed 44 moldy corn samples for the B and C series of fumonisins by high-performance liquid chromatography. Of the 44 samples, 32 (73%) were contaminated with both the B and C series of fumonisins and 6 were contaminated with only the B series of fumonisins. The incidence of fumonisin C1 in moldy corn was 71%; the incidence was 11% for fumonisin C3 and 43% for fumonisin C4. Their mean levels ranged from 500 to 1,900 ng/g. This is the first report on the natural occurrence of the C series of fumonisins and fumonisin B4 in moldy corn.  (+info)

Relationship between ruminal starch degradation and the physical characteristics of corn grain. (6/5543)

The objectives of this study were to determine the range of variation in the rate and extent of in situ ruminal starch degradation of 14 corns differing in vitreousness and to predict ruminal starch degradability by physical characteristics of corn grains. This study was conducted with eight dent and six flint corns. Ruminal starch degradability was determined by an in situ technique on 3-mm ground grains. Physical characteristics of corn grain were measured: hardness by grinding energy and particle size distribution, apparent and true densities, and specific surface area. Ruminal DM and starch degradabilities averaged 50 and 55.1% and varied from 39.7 to 71.5% and from 40.6 to 77.6%, respectively. Ruminal starch degradability averaged 61.9 and 46.2% in dent and flint types, respectively. The proportion of coarse particles (61.9 vs. 69.6% for dent and flint, respectively), the apparent density (1.29 vs. 1.36 g/cm3 for dent and flint, respectively), and the specific surface area (.13 vs. .07 m2/g for dent and flint, respectively) varied with the vitreousness. Ruminal starch degradability could be predicted accurately by vitreousness (r2 = .89) or by the combination of apparent density and 1,000-grain weight (R2 = .91), a measurement faster than the vitreousness determination.  (+info)

Growth phase-dependent subcellular localization of nitric oxide synthase in maize cells. (7/5543)

A protein band of approximately 166 kDa was detected in the soluble fraction of root tips and young leaves of maize seedlings, based on Western blot analysis using antibodies raised against mouse macrophage nitric oxide synthase (NOS) and rabbit brain NOS. NOS activity was present in these soluble fractions, as determined by L-[U-14C]citrulline synthesis from L[U-14]arginine. Immunofluorescence showed that the maize NOS protein is present in the cytosol of cells in the division zone and is translocated into the nucleus in cells in the elongation zone of maize root tips. These results indicate the existence of a NOS enzyme in maize tissues, with the localization of this protein depending on the phase of cell growth.  (+info)

Characterization of maize (Zea mays L.) Wee1 and its activity in developing endosperm. (8/5543)

We report the characterization of a maize Wee1 homologue and its expression in developing endosperm. Using a 0.8-kb cDNA from an expressed sequence tag project, we isolated a 1.6-kb cDNA (ZmWee1), which encodes a protein of 403 aa with a calculated molecular size of 45.6 kDa. The deduced amino acid sequence shows 50% identity to the protein kinase domain of human Wee1. Overexpression of ZmWee1 in Schizosaccharomyces pombe inhibited cell division and caused the cells to enlarge significantly. Recombinant ZmWee1 obtained from Escherichia coli is able to inhibit the activity of p13(suc1)-adsorbed cyclin-dependent kinase from maize. ZmWee1 is encoded by a single gene at a locus on the long arm of chromosome 4. RNA gel blots showed the ZmWee1 transcript is about 2.4 kb in length and that its abundance reaches a maximum 15 days after pollination in endosperm tissue. High levels of expression of ZmWee1 at this stage of endosperm development imply that ZmWee1 plays a role in endoreduplication. Our results show that control of cyclin-dependent kinase activity by Wee1 is conserved among eukaryotes, from fungi to animals and plants.  (+info)

Abstract: According to the invention, there is provided an inbred corn plant designated RQAB7. This invention thus relates to the plants, seeds and tissue cultures of the inbred corn plant RQAB7, and to methods for producing a corn plant produced by crossing the inbred plant RQAB7 with itself or with another corn plant, such as another inbred. This invention further relates to corn seeds and plants produced by crossing the inbred plant RQAB7 with another corn plant, such as another inbred, and to crosses with related species. This invention further relates to the inbred and hybrid genetic complements of the inbred corn plant RQAB7, and also to the RFLP and genetic isozyme typing profiles of inbred corn plant RQAB7 ...
Replacement of Normal Maize with Quality Protein Maize on Performance, Immune Response and Carcass Characteristics of Broiler Chickens - Normal Maize;Quality Protein Maize;Performance;Immune Response;Carcass Characteristics;Broiler Chickens;
The inclusion of wet distillers grains plus solubles (WDGS) in feedlot diets has become a common practice in many regions of the United States due to the expanded production of byproducts and fluctuating corn prices related to ethanol production and other factors. In addition, societal concerns over the continued use of antimicrobials in agriculture production combined with an enhanced interest in disease and pathogen prevention in the food supply have led to an increased interest in use of direct-fed microbials (DFM) in growing and finishing cattle. Direct-fed microbials have been shown to improve ADG and feed efficiency, alter ruminal fermentation, and decrease fecal shedding of potential harmful pathogens in feedlot cattle in some experiments. The objective of this experiment was to evaluate the effects of WDGS inclusion with or without a DFM containing Lactobacillus acidophilus (1 x 10(6) cfu . heifer(-1) . d(-1)) combined with Propionibacterium freudenreichii (1 x 10(9) cfu , heifer(-1) . ...
TY - JOUR. T1 - Biochemical profile of leaf, silk and grain samples of eight maize landraces (Zea Mays L.) cultivated in two low-input agricultural systems. AU - UARROTA , VIRGILIO GAVICHO. AU - Severino, Ricardo Brasil. AU - Malinowsky, Carina. AU - de Oliveira, Simone Kobe. AU - Kuhnen, Shirley. AU - Yunes, Rosendo Augusto. AU - Maraschin, Marcelo. PY - 2014/12/1. Y1 - 2014/12/1. N2 - This research aimed to determine the biochemical profile of leaf, silk and grain samples of eight maize landraces (Zea maysL.) cultivated in southern Brazil. To accomplish this, reverse-phase high performance liquid chromatography-UV-visible (RP-HPLC-UV-vis), UV-vis spectrophotometry, matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) and chemometrics were used to examine carotenoids and their isomers, anthocyanin and phenolic acids. Leaf tissue samples showed higher amounts of carotenoids (838.6μg/g - Língua de Papagaio variety), anthocyanins (405.8μg/g - Palha Roxa ...
Examination of wild ancestors can identify which traits have been altered by selection as possible targets for genetic improvement. We investigated the whole plant response to low nitrogen (LN), especially below ground, by the wild ancestor of modern maize (Zea mays L.), Balsas teosinte (Zea mays subsp. parviglumis H. H. Iltis & Doebley). Teosinte responded to LN by reducing the shoot N concentration and increasing the root:shoot biomass ratio. The lengths of individual crown roots and the total lateral root length increased, compensated by reduced crown root number. Low N caused a decrease in total root hair (RH) length and increased expression of high affinity nitrate transporters. To facilitate future mapping studies, these results were compared to a modern inbred (W22) used as the parent in a modern maize × teosinte population and extensively employed in maize domestication studies. The adaptations to LN in teosinte and W22 were surprisingly conserved, but the strategies employed were ...
The results clearly indicated that the seed germinibility in the presence of FB1 was decreased with increasing their concentration, whereas the germinibility was uncompletely ceased at high concentrations, a slight initial lag in germination observed at lowest concentration 28.57 µg /ml and highest concentration 64.11 µg /ml, respectively compared with the control. At concentration of FB1 (28.57 µg /ml), elongation of the hypocotyls and epicotyls in seedlings slightly inhibited compared with the control. Chlorophyll a and b content of seedlings of Zea mays decreased with increasing concentrations of Fumonisin B1. Chlorophyll a content was 6.23, 3.88 and 3.91 (mg/ g fresh weight) at concentrations 28.57, 40.54 and 64.11 (µg /ml) of Fumonisin B1 compared with the control 8.55 mg/ g fresh weight. The ultrastructural studies indicate that there were dramatic differences between the treated and untreated tissues of Zea mays seedlings with the toxin FB1. The treated cells with FB1 are highly
Sweet corn (Zea mays L. var. rugosa) is one of the most popular summer vegetable crops grown in Missouri. Like peppers, pumpkins, squash and beans, sweet corn is native to the New World where it has been cultivated for more than 4,000 years. Sweet corn is a monecious plant, which means it has a separate male and female flower on each stalk. The tassel is the male flower, which produces the pollen, and the ear is the female flower (Figure 1). For kernels to form on each ear, pollen from the tassel must be deposited on the silk of the ear. Sweet corn is wind pollinated, although bees are often seen collecting nectar and pollen from the tassels. For small plantings of sweet corn, a series of short rows rather than a single, long row will improve the chances for efficient pollination. Sweet corn typically produces one or two ears per plant.. Sweet corn is sensitive to cool weather and should be seeded when soil temperatures reach at least 60 degrees Fahrenheit (2 inch depth) or about 7 to 10 days ...
We obtained transgenic maize plants by using high-velocity microprojectiles to transfer genes into embryongenic cells. Two selectable genes were used to confer resistance to either chlorsulfuron or phosphinothricin, and genes encoding either E. coli beta-glucuronidase or firefly luciferase were used …
An investigation was taken up at Maize Research Station, Agricultural Research Institute, PJTSAU, Hyderabad during 2013-14. F1 material was generated by making crosses between BML 6 × CML 181 and BML 7 × CML 181for introgression of opaque 2 gene from Mexican donor CML181 through molecular breeding approach. The converted quality protein maize BML 6 and BML 7 lines (designated as CB6 and CB7) with increased levels of lysine and tryptophan were crossed in various combinations to select a hybrid with increased lysine, tryptophan and high yield. The performance of elite maize genotypes, donor and derived QPM inbreds and their hybrid combinations were analysed for yield and yield attributing characters. The experiment was designed with three replication following Randomized Block Design. Observations were recorded on twelve quantitative and qualitative traits. Hybrids recorded superior performance to parents with respect to plant height (cm), ear height (cm), number of kernel rows per ear, 100 kernel
A discontinuous sucrose density gradient was used to separate membrane fractions from a homogenate of maize root tips. Endoplasmic reticulum-, Golgi apparatus-, plasma membrane- and mitochondria-rich fractions were identified by their enzymic characteristics and by their appearance under the electron microscope. Maize roots were incubated in vivo with D-[U-14C]glucose, [Me-14C]choline chloride and diazotized [U-3H]sulphanilic acid. The pattern of incorporation of radioactivity into the various membrane fractions was investigated. Analyses of the polypeptide chains of the membrane fractions by SDS-polyacrylamide gel electrophoresis showed that the mitochondria-rich fraction had a different pattern of polypeptides from that of the other membrane fractions. The results are discussed in relation to the hypothesis of endomembrane flow and differentiation. ...
A method of removing the hull from corn kernels wherein the method involves exposing the corn kernels to ammonia (e.g., gas-phase anhydrous) under conditions effective to remove the hull from corn kernels.
As family farming in Central Illinois, our fields are filled with cash crops of yellow dent corn [field Corn] and soybeans. However, we always save room for the sweet corn patch. Similar to farmers in our area, our sweet corn is planted in a corner of the field side by side to our field corn. Since, sweet corn is the cream of our crop not financially but a Bonus Nutritional Crop for our dining pleasure all year long, we take great care in raising it. Our family was exciting at the chance to try for free the new Performance Series™ sweet corn Obsession II Variety provide by the Monsanto Company. If you do not partake in the art of growing your own vegetables, you may be asking why our family is stoked about trying a new type of sweet corn. Obsession II is a biotech sweet corn. Yes, I said the BIOTECH word- a term that has been characterized as evil or bad. However, Biotechnology or genetic engineering, simply put, is the process of inserting a desired gene (naturally occurring) from one ...
Leaves of higher plants are produced in a sequential manner through the differentiation of cells that are derived from the shoot apical meristem. Current evidence suggests that this transition from meristematic to leaf cell fate requires the down-regulation of knotted1-like homeobox (knox) gene expression. If knox gene expression is not repressed, overall leaf shape and cellular differentiation within the leaf are perturbed. In order to identify genes that are required for the aquisition of leaf cell fates, we have genetically screened for recessive mutations that confer phenotypes similar to dominant mutations (e.g. Knotted1 and Rough sheath1) that result in the ectopic expression of class I knox genes. Independently derived mutations at the rough sheath2 (rs2) locus condition a range of pleiotropic leaf, node and internode phenotypes that are sensitive to genetic background and environment. Phenotypes include dwarfism, leaf twisting, disorganized differentiation of the blade-sheath boundary, ...
Prior to their release in the environment, transgenic crops are examined for their health and environmental safety. In addition, transgene expression needs to be consistent in order to express the introduced trait (e.g. insecticidal and/or herbicide tolerance). Moreover, data on expression levels for GM events are usually required for approval, but these are rarely disclosed or they are considered insufficient. On the other hand, biosafety regulators do not consider epigenetic regulation (e.g. DNA methylation, ncRNAs and histone modifications), which are broadly known to affect gene expression, within their risk assessment analyses. Here we report the results of a DNA methylation (bisulfite sequencing) and transgene transcript accumulation (RT-qPCR) analysis of four Bt-expressing single transgenic maize hybrids, under different genetic backgrounds, and a stacked transgenic hybrid expressing both insecticidal and herbicide tolerance traits. Our results showed differences in cytosine methylation levels in
Prior to their release in the environment, transgenic crops are examined for their health and environmental safety. In addition, transgene expression needs to be consistent in order to express the introduced trait (e.g. insecticidal and/or herbicide tolerance). Moreover, data on expression levels for GM events are usually required for approval, but these are rarely disclosed or they are considered insufficient. On the other hand, biosafety regulators do not consider epigenetic regulation (e.g. DNA methylation, ncRNAs and histone modifications), which are broadly known to affect gene expression, within their risk assessment analyses. Here we report the results of a DNA methylation (bisulfite sequencing) and transgene transcript accumulation (RT-qPCR) analysis of four Bt-expressing single transgenic maize hybrids, under different genetic backgrounds, and a stacked transgenic hybrid expressing both insecticidal and herbicide tolerance traits. Our results showed differences in cytosine methylation levels in
0040]In one embodiment, a transgene whose expression results or contributes to a desired trait to be transferred to sweet corn inbred line R373D comprises a virus resistance trait such as, for example, a MDMV strain B coat protein gene whose expression confers resistance to mixed infections of maize dwarf mosaic virus and maize chlorotic mottle virus in transgenic maize plants (Murry et al. Biotechnology (1993) 11:1559-64, incorporated herein by reference). In another embodiment, a transgene comprises a gene encoding an insecticidal protein, such as, for example, a crystal protein of Bacillus thuringiensis or a vegetative insecticidal protein from Bacillus cereus, such as VIP3 (see for example Estruch et al. Nat Biotechnol (1997) 15:137-41, incorporated herein by reference). In one embodiment, an insecticidal gene introduced into inbred sweet corn line R373D is a Cry1Ab gene or a portion thereof, for example introgressed into sweet corn inbred line R373D from a maize line comprising a Bt-11 ...
TY - JOUR. T1 - Mycorrhizal impacts on root trait plasticity of six maize varieties along a phosphorus supply gradient. AU - Wang, Xin-Xin. AU - Li, Hongbo. AU - Chu, Qun. AU - Feng, Gu. AU - Kuyper, Thomas W.. AU - Rengel, Zed. PY - 2020/1/9. Y1 - 2020/1/9. N2 - Background and aims: Plasticity of plants refers to their ability to produce different phenotypes in different environments. Plants show plasticity aboveground as well as belowground. The influence of the arbuscular mycorrhizal fungal (AMF) symbiosis on root plasticity is poorly known. This study aimed to quantify plasticity of root-system related, morphological, physiological or mycorrhizal traits along a soil phosphorus (P) supply gradient. Methods: Six varieties of maize (Zea mays L.) were grown in pots with or without AMF at five rates of P supply. Fifteen root traits were measured and calculated after seven weeks of growth. Results: Root system traits (biomass and length) and physiological traits (phosphatase activity at the root ...
TY - CHAP. T1 - Relationship between properties of maize cell walls and in vitro fermentation characteristics. AU - He, Y.. AU - Dijkstra, J.. AU - Mouthier, T.M.B.. AU - Kabel, M.A.. AU - Cone, J.W.. PY - 2015. Y1 - 2015. M3 - Abstract. SP - 33. EP - 34. BT - Proceedings of the 40th Animal Nutrition Research Forum. PB - Ghent University - Faculty of Veterinary Medicine. CY - Merelbeke. ER - ...
PAN Czytelnia Czasopism, CHLOROPHYLL CONTENT OF APHID-INFESTED SEEDLING LEAVES OF FIFTEEN MAIZE GENOTYPES - Acta Biologica Cracoviensia s. Botanica
Varietal Screening of Winter Maize Genotypes in Terai Region of Nepal - Agrarwissenschaften - Bachelorarbeit 2019 - ebook 16,99 € - Diplomarbeiten24.de
RNase P, a ribonucleoprotein responsible for the 5´ maturation of precursor tRNAs (ptRNAs) in all organisms, can be enticed to cleave any target mRNA that forms a ptRNA-like structure and sequence-specific complex when bound to an RNA, termed the EGS (external guide sequence). In the present study, F3H (flavanone 3-hydroxylase), a key enzyme in the flavonoid biosynthetic pathway that participates in the formation of red-coloured anthocyanins, was used as a target for RNase P-mediated gene disruption in maize cells. Transient expression of an EGS complementary to the F3H mRNA resulted in suppression of F3H to 29% of the control, as indicated by a reduced number of anthocyanin-accumulating cells. This decrease was not observed in experiments where a disabled mutant EGS was expressed. Our results demonstrate the potential of employing plant RNase P, in the presence of an appropriate gene-specific EGS, as a tool for targeted degradation of mRNAs.. ...
Ngoc Chi Dang, Ingrid Aulinger-Leipner, Ham Le Huy, Peter Stamp: Protein Quality Improved Waxy Maize Varieties for South East Asia
Corn is one of the most popular crops to grow in the home garden. Not only is it delicious, but it is impressive when all goes well. But what happens if your corn plants have yellowing leaves? And how do you go about treating them? Find out here.
Maize leaf blades differentiate dimorphic photosynthetic cell types, the bundle sheath and mesophyll, between which the reactions of C(4) photosynthesis are partitioned. Leaf-like organs of maize such as husk leaves, however, develop a C(3) pattern of differentiation whereby ribulose bisphosphate carboxylase (RuBPCase) accumulates in all photosynthetic cell types. The Golden2 (G2) gene has previously been shown to play a role in bundle sheath cell differentiation in C(4) leaf blades and to play a less well-defined role in C(3) maize tissues. To further analyze G2 gene function in maize, four g2 mutations have been characterized. Three of these mutations were induced by the transposable element Spm. In g2-bsd1-m1 and g2-bsd1-s1, the element is inserted in the second intron and in g2-pg14 the element is inserted in the promoter. In the fourth case, g2-R, four amino acid changes and premature polyadenylation of the G2 transcript are observed. The phenotypes conditioned by these four mutations demonstrate
TY - JOUR AU - Srdić, Jelena AU - Pajić, Zorica AU - Filipović, Milomir AU - Babić, Milosav AU - Sečanski, Mile PY - 2011 UR - http://rik.mrizp.rs/handle/123456789/372 AB - Sweet corn is mutation of field corn in which greater accumulation of sugars and water soluble polysaccharides provide specific taste and texture. It is consumed in the milky stage of the endosperm, so the products quality and its appearance are important as well as ear yield. That is why breeders pay the same attention to these traits in breeding process. In this paper we analyzed combining ability and mode of inheritance of ear yield and yield components in sweet corn, such as kernel-row number, and ear length, by the use of diallel crosses of six sweet corn inbred lines. ANOVA showed that estimates of general (GCA) and specific (SCA) combining abilities were highly significant (p lt 0.01) for all observed traits. Nonaditive gene effects were more significant in the expression of ear yield and ear length, while ...
Seventeen elite maize inbred lines of West and Central Africa adaptation with tropical and temperate x tropical origin were investigated for diversity at 18 SSR loci in non-coding regions of the maize genome, alongside two temperate inbred lines (B73 and Mo17), perennial teosinte (Zea diploperennis) and gamagrass (Tripsacum dactyloides). A total of 174 alleles were detected with a range of 5 to 15 alleles per maker and an average of 9.7 alleles per locus. Polymorphic information content (PIC) ranged from 0.29 in umc1226 to 0.92 in bnlg2122 with an average of 0.75. Relationships between heterotic groups and groups based on SSR data were quite varied for the lines studied. Primarily, the SSR markers grouped the lines on the basis of their origin, with three instances of a pair of heterotic lines clustering together; one pair of temperate origin and the other two tropical vs temperate x tropical. Four inbred lines (CMR 19, CMR 20, CMR 21, and CMR 26), belonging to three heterotic groups were, however,
Abstract: In a 2x2x3 factorial study, the effect of milling technique (hammer vs. roller) with differing particle sizes (fine or coarse) of maize from three sources (Downs, Emerald or Moree) on growth performance, ileal digestibility and intestinal microbial profiles of broiler chickens (from 1-21 days post-hatch) was investigated. A total of 420 day-old male Cobb chicks were randomly allocated to 12 treatments of 5 replicates (seven birds per replicate) in brooder cages set up in an environmentally controlled room. The maize grain was finely ground using a hammer mill or roller mill with a 2 mm screen or coarsely ground through a 4 mm screen. Feed intake up to 7 days of age was higher (p,0.003) on the diet containing finely roller-milled grain than on the coarsely milled grain but no effect found on d21. Live weight was affected by the source of maize (p,0.04). The FCR to d21 was improved (p,0.042) on the Moree maize that was finely roller milled. The relative weight of proventriculus plus ...
Government regulation of genetically engineered crops, already weak, is increasingly non-existent. The latest example of this new hands-off policy is the commercialization of Monsantos first flagship product for the produce aisle: genetically engineered sweet corn, containing the Bt toxin and herbicide-resistant genes.. Monsantos new sweet corn produces Bt toxin, a genetically modified version of an insecticide from the soil bacterium Bacillus thuringiensis. Until now, Monsantos Bt corn and cotton crops have mostly been used in animal feed and highly processed ingredients. Even with this limited exposure, Bt toxin has already been found in the blood of pregnant women and fetuses. No one knows what will happen to people who eat Monsantos new Bt sweet corn, but Bt crops have proven deadly for grazing animals from livestock to monarch butterflies.. Monsantos new sweet corn is also RoundUp Ready, meaning it can tolerate unlimited amounts of Monsantos herbicide RoundUp. Roundup causes ...
Maize breeding efforts to generate high yielding and adaptive cultivars have recently been given emphasis by national maize breeding program. In Ethiopia, the maize production system is mainly dominated by subsistence farmers where their production is below average. The objectives of this study were to determine the combining ability between lines and testers, and to evaluate the performance of crosses (hybrids) and parents for grain yield and yield component traits. Twenty-seven inbred lines were generated by crossing nine female lines (L1-L9) and three male testers (T1-T3) using line × tester mating system at International Maize and Wheat Improvement Center (CIMMYT), East African high land maize improvement program. The inbred lines along with parents were evaluated in randomized complete block design with two replications at three locations (Ambo, Kulumsa and Haramaya). Significant differences were observed among genotypes for all ten traits considered. Eight crosses (L1 × T2, L1 × T3, L3 × T3,
The Plants Database includes the following 1 variety of Zea mays ssp. parviglumis . Click below on a thumbnail map or name for variety profiles ...
The history of maize breeding methods in the USA is reviewed to examine the question of types of maize cultivars in sustainable agriculture. The yield potential of OP cultivars was much higher than national average yields prior to 1930, but hybrid cultivars today often out-yield OP cultivars by 50-100% or more. However, rates of gain for yield using recurrent selection on populations appear equal to that recorded for commercial hybrid breeding. The inbred-hybrid method, while successful, was not
INTRODUCTION. Cereal grains contribute to over 60% of the total world food production. In spite of being among the most important species cultivated in the world and serving as a source of dietary calories and protein, maize grains are poor in both oil content (OQuinn et al., 2000; Romanelli & Milan, 2005) and quality protein (Varisi et al., 2007), since their predominant grain storage proteins, the zeins, are deficient in lysine and tryptophan (Azevedo et al., 1997; Ferreira et al., 2006; Landry & Delhaye, 2007) The study of nitrogen (N) metabolism has been a major factor to help understanding amino acids metabolism (Medici et al., 2004, 2005; Lea & Azevedo, 2006, 2007; Samborski et al., 2008). Different strategies have been used to improve these traits by either independent or concomitant approaches. Maize has been improved for high oil content alone (Adams & Jensen, 1987; Thomison et al., 2003), or both high oil and high lysine contents (OQuinn et al., 2000), using traditional plant ...
The [email protected] Centre provides a platform for research students to deposit their Ph.D. theses and make it available to the entire scholarly community in open access ...
Author Summary Natural allelic variability is crucial for genetic improvement. While the genetic mechanisms leading to such variation have been studied in depth, relatively less is known about the role of epigenetic mechanisms in generation of allelic diversity. Paramutation is a phenomenon in which one allele can silence another allele in trans and, once established, such epigenetic silencing is heritable. To further understand the molecular components of paramutation, we characterized two epialleles of the pericarp color1 (p1) gene of maize, which originated from a common progenitor; however, only one of these alleles is paramutagenic. Results show that, while both alleles have high levels of symmetric (CG and CHG) methylation in a distal enhancer element, only the paramutagenic allele has higher levels of asymmetric (CHH) methylation. Since CHH methylation is imposed and maintained through RNA-mediated mechanisms, these results indicate that paramutation at the p1 locus involves RNA-mediated
During its long domestication process, maize has lost its ability to survive in the wild. In the Netherlands, the appearance of maize volunteers is rare and establishment of volunteers in the wild has never been reported. There are no reasons to assume that the introduced traits will increase the potential of maize to establish feral populations. The introduced genes cannot spread to closely related species since wild relatives of maize are not present in Europe. Therefore, COGEM is of the opinion that incidental spillage of maize line 98140 will probably not pose a risk to the environment.. However, COGEM points out that the molecular analysis of maize line 98140 does not meet the criteria of COGEM as the applicant restricted the analysis of putative open reading frames at the junction between maize genomic DNA and the T-DNA fragment to amino acid sequences that start with a methionine residue ...
Native to various parts of Central America, the corn plant (Zea mays) has been grown and bred by humans for centuries, confounding botanists as to their precise native region or genetic identities. Overall, there are four species of wild corn. Corn grows quickly as an annual, completing its entire life cycle in one ...
TERRA, Tatiana de Freitas et al. Genetic variability in maize and teosinte populations estimated by microsatellites markers. Cienc. Rural [online]. 2011, vol.41, n.2, pp.205-211. Epub Feb 11, 2011. ISSN 0103-8478. http://dx.doi.org/10.1590/S0103-84782011005000005.. Wild species are important sources of genetic variability and may be exploited by breeding programs. Crosses between teosinte and maize occur freely and teosinte serves as genetic source of agronomic traits for introduction in maize. The objective of this study was to estimate genetic variability among and within maize and teosinte populations (Zea mays mexicana). Two sweet maize populations (BR400 and BR402), two common maize populations (Suwan and Pampa) and one teosinte population were analyzed using microsatellites markers. Results indicated that 64,5% of the variation was detected within the populations, suggesting the possibility of obtaining genetic progress by selection within each population. The analysis with 25 ...
Paper: Linear and nonlinear-segmented models describing response of maize grain yield to nitrogen fertilization. The 11th Agronomy Conf., Assiut Univ., 15-16 November, Egypt , Author:Tageldin, M.H., and N.K.B. El-Gizawy , Year:2005 , Faculty of Agriculture ,Department of Agronomy ,Benha University
A novel maize variety designated PH25M1 and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH25M1 with another maize plant. Methods for
FOND DU LAC - With tar spot apparently having established itself as a permanent late season disease threat to corn in Wisconsin, Extension Service plant pathologist Damon Smith wants to update his data for where it has appeared in the state.. Speaking at the 2019 pest management update meetings, Smith asked growers and crop consultants from the counties bordering Lake Michigan to share samples of corn plant residue for testing if there was any suspicion of the disease in the field. This would augment the documented outbreaks of various severity in multiple counties in the southern half of the state in the past few years, he noted.. During 2019, tar spot was also found in all but the far western counties in Iowa, far southern Minnesota, the northern half of Illinois, much of Indiana, southern Michigan, and one county in Ohio. The disease thrives on wet corn foliage, as was illustrated in the photo of an irrigated Michigan field even though the field was treated with a fungicide as the corn was ...
Maize (Zea mays L.) is a cereal that has grown in all agricultural regions of the world. It is a cereal grown in a wide variety of growing conditions ranging from tropical to temperate climates. However, climate change, which is causing more intense drought followed by severe soil degradation, will lead to a reduction in the development and production of maize plants in northern Côte dIvoire. The aim of this study was to develop high-performance cultivars adapted to environmental conditions within a short period of time; Gamma radiation-induced mutation techniques were initiated. Three different gamma radiation doses (100; 200; 300 Grays) were applied to maize seeds of the variety EV8728. These seeds had grown and the technique of controlled self-fertilization was carried out as soon as the first flowers appeared. Data collected were analyzed with Statistic software. The impact of gamma irradiation at different doses on the growth and yield of first generation maize mutants was evaluated. ...
The Ac-specific ORFa protein, overexpressed in a baculovirus system, specifically binds to several subterminal fragments of Ac. The 11 bp long inverted repeats of the transposable element are not bound by the ORFa protein. Major ORFa protein-binding sites were delineated on 60 and 70 bp long sequenc …
for te1 in maize are 57 and 44% of these values for ssp. parviglumis. In addition, there are only three maize haplotypes among 12 maize individuals compared to five haplotypes among 5 ssp. parviglumis individuals, suggesting that haplotypic diversity is reduced more severely than nucleotide diversity. Simulations of the bottleneck process have shown that the reduction in maize genetic diversity can be explained by a short bottleneck involving only a few individuals (Eyre-Walkeret al. 1998). The low number of te1 haplotypes in maize may therefore be due to a narrow bottleneck from which only a few haplotypes emerged.. Time of historical events: Since te1 appears to be evolving in a neutral manner, te1 sequences should be useful in estimating the time of historical events. To do this requires that the rate of sequence evolution at synonymous sites be known. Gaut and colleagues (Gautet al. 1996; Eyre-Walkeret al. 1998; Hilton and Gaut 1998) have used a rate of 6.5 × 10−9 substitutions per ...
Improvement of biofeedstock quality for cellulosic ethanol production will be facilitated by inexpensive and rapid methods of evaluation, such as those already employed in the field of ruminant nutrition. Our objective was to evaluate whether forage quality and compositional measurements could be used to estimate ethanol yield of maize stover as measured by a simplified pretreatment and simultaneous saccharification and fermentation assay. Twelve maize varieties selected to be diverse for stover digestibility and composition were evaluated. Variation in ethanol yield was driven by glucan convertibility rather than by glucan content. Convertibility was highly correlated with ruminal digestibility and lignin content. There was no relationship between structural carbohydrate content (glucan and neutral detergent fiber) and ethanol yield. However, when these variables were included in multiple regression equations including convertibility or neutral detergent fiber digestibility, their partial regression
Cool nights and some rainy days appear to be holding corn pests at moderate levels for this time of year, as the sweet corn season winds down. However, we may still have the remnants of tropical storms to deal with over the next couple of weeks which could cause an increase in corn earworm and/or fall armyworm populations. Next week will be the last scheduled issue of the Sweet Corn IPM Newsletter for the 2017 season.. European corn borer: No moth captures this week, suggesting the threat of corn borer may be over for this season. Larval feeding injury on younger corn was also very low, and did not exceed threshold at any location.. Corn earworm: Overall, moth counts remain fairly low this week, but high enough to keep some sites on a tight spray schedule for any fresh silking corn remaining. A 5-day spray schedule was recommended in Auburn, New Gloucester, North Berwick, and Wells. A 4-day spray interval was recommended in Biddeford, Cape Elizabeth, one Dayton location, Lewiston, Monmouth and ...
View Notes - Homework Due 100410 from BIOL 202 at UNC. I HAVE USED THIS ASSIGNMENT! IF YOU USE IT YOU WILL BE CAUGHT! 1. Two pure breeding corn plants at 3 loci are crossed, one homozygous WT, the
190 calores; 4 g fiber. Non GMO. Gluten free. Open with joy. Eat Happy: We barely popped these addictive corn kernels for a crispy crunch that comes packaged with 4 grams of fiber. No wonder theyre so darn popular. - Joy Bauer. Certified: Gluten-free. Try all of our delicious varieties. nourishsnack.com.. ...
Photo about Harvested corn kernels sit ready to be processed for various uses that range from ethanol to farm animal feed. - 34438643
Question - Feeling corn kernel stuck in throat under tonsil. What could this possibly be?. Ask a Doctor about Palate, Ask an ENT Specialist
Fingerprint Dive into the research topics of Ultrastructural characterization of maize (Zea mays L.) kernels exposed to high temperature during endosperm cell division. Together they form a unique fingerprint. ...
Zea mays var. saccharata and Zea mays var. rugosa Waxy corn: Zea mays var. ceratina Amylomaize: Zea mays Pod corn: Zea mays var ... Zea mays var. amylacea Popcorn: Zea mays var. everta Dent corn : Zea mays var. indentata Flint corn: Zea mays var. indurata ... Zea mays (maize) and Zea diploperennis, which is a perennial type of teosinte. The annual teosinte variety called Zea mays ... The term "teosinte" describes all species and subspecies in the genus Zea, excluding Zea mays ssp. mays.) It has evolved from a ...
The kernels vary from variety to variety, and what distinguishes Zea mays var. indentata from other varieties of Zea mays is ... Zea mays var. indentata, synonym Zea indentata Sturtev., was identified and published by American agronomist and botanist ... The flowers of Zea mays are monoecious and are born in separate parts of the plant. The female flower, or ear, is an ... The leaves of Zea mays alternate with broad, sword-shaped leaf blades, parallel veins with a prominent mid-rib, and small ...
Zea mays). Submontane zone, 700 - 1,000 m (East Alps), 300 - 450 m (Central German hills), European Beech (Fagus sylvatica), ...
Zea mays). Submontane zone, 700 - 1,000 m (Eastern Alps), 300 - 450 m (Central Uplands), European Beech (Fagus sylvatica), ...
... (Zea mays var. amylacea) is a variety of corn with a soft starchy endosperm and a thin pericarp. It is primarily ...
Zea mays, maize or 'corn.' Traditionally variety grown by the Natives shown here. Cucurbita pepo, was domesticated into several ...
"USDA GRIN Taxonomy: Zea mays". Retrieved 2 January 2017. "USDA GRIN Taxonomy: Chenopodium quinoa". Retrieved 2 January 2017. " ... Corn (Zea†) Quinoa (Chenopodium) Several (though not all) species of amaranth (Amaranthus) Some species of wild rice (Zizania) ...
... (Zea mays var. indurata; also known as Indian corn or sometimes calico corn) is a variant of maize, the same species ... Popcorn (Zea mays everta, "corn turned inside out") is considered a variant of this type. It has a hard, slightly translucent ... With less soft starch than dent corn (Zea mays indentata), flint corn does not have the dents in each kernel from which dent ... Like the Linnaeus variant of maize, any kernel may contain the yellow pigment zeaxanthin but at more varying concentrations. ...
... (Zea mays convar. saccharata var. rugosa; also called sweetcorn, sugar corn and pole corn) is a variety of maize ... If left to dry on the plant, kernels may be taken off the cob and cooked in oil where, unlike popcorn, they expand to about ...
Zea mays. 1989[18] Wyoming Western wheatgrass. Agropyron smithii. 2007[19] See also[edit]. *Lists of U.S. state insignia ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Zea mays 800 to 2700 GDD to crop maturity Dry beans Phaseolus vulgaris 1100-1300 GDD to maturity depending on cultivar and soil ... GDDs may be calculated in either Celsius or Fahrenheit, though they must be converted appropriately; for every 9 GDDF there are ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Zea mays) 20 [21] Cannabis. (Cannabis sativa) 20 Western clawed frog. (Xenopus tropicalis) 20 [33] ... Kondo, Katsuhiko (May 1969). "Chromosome Numbers of Carnivorous Plants". Bulletin of the Torrey Botanical Club. 96 (3): 322-328 ... While the cause for the disparate numbers is unknown, it may arise because of an XO sex determination mechanism, where males ( ... This is for common potato Solanum tuberosum (tetraploid, 2n = 4x = 48). Other cultivated potato species may be diploid (2n = 2x ...
Adults are on wing from May to September. There are probably two or three generations per year. The larvae feed on Zea mays. ...
The larvae feed on Zea mays. "GlobIZ search". Global Information System on Pyraloidea. Retrieved 2014-07-15. CS1 maint: ...
Zea mays L. ssp. mays) assessed with individuals and bulks on agarose gels". Genetic Resources and Crop Evolution. 55 (7): 971- ... Zea mays L. ssp. mays) landraces". Genetic Resources and Crop Evolution. 57 (1): 71-84. doi:10.1007/s10722-009-9452-0. hdl: ... Freitag, N; Schneider, D:, Mir, C; Stamp, P; Hund, A; Messmer, R (2012). "Swiss maize (Zea mays L) landraces. Their genetic ... Zea mays L.) in contrasting environments". Doectoral Dissertation, ETH Zurich. Schilperoord, Peer (2014). "Le maïs". Verein für ...
... mays/latest_assembly_versions/GCF_902167145.1_Zm-B73-REFERENCE-NAM-5.0". ftp.ncbi.nih.gov. Retrieved 2020-12-01. "Zea mays (ID ...
The larvae feed on Zea mays. Nuss, M.; et al. (2003-2017). "GlobIZ search". Global Information System on Pyraloidea. Retrieved ...
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... Zea mays saccharata. Retrieved from "https://en.wikipedia.org/w/index.php?title=Category:Cuisine_of_the_Northeastern_United_ ...
Some strains of corn (taxonomized as Zea mays) are cultivated specifically as popping corns. The Zea mays variety everta, a ... Though the kernels of some wild types will pop, the cultivated strain is Zea mays everta, which is a special kind of flint corn ... While the kernels may come in a variety of colors, the popped corn is always off-yellow or white as it is only the hull (or ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
and D. zeae (Schwein.) Lév.) is a plant pathogenic fungus and causal organism of diplodia ear and stalk rot. Corn (Zea mays) ... Earworm (Helicoverpa zea) damage at the ear shank is often associated with the disease. Diplodia rot is most severe for mono ... Some isolates may cause premature germination of the corn kernels. In stalk infections, injury to the vascular system disrupts ... Further, some animals may reject contaminated corn-based feed. Stenocarpella rot has the potential to affect distillers dried ...
The larvae feed on Zea mays (corn). Savela, Markku. "Alpenus pardalina (Rothschild, 1910)". Lepidoptera and Some Other Life ...
Sugar Snap) and maize (Zea mays cv. Silver Queen). It proved able to kill nearly 100% of seedlings with the exception of ... The plant may be mildly toxic. The noxious odours have been associated with nausea and headaches, and with contact dermatitis ... The fruits grow in clusters; a fruit cluster may contain hundreds of seeds. The seeds borne on the female trees are 5 mm in ... Heisy, Rod M. (May 1990). "Allelopathic and Herbicidal Effects of Extracts from Tree of Heaven". American Journal of Botany. 77 ...
Interference between Rottboellia cochinchinensis and Zea mays. Weed Science Society of America. 48(2), 205-211. Spaunhorst, D. ... The eliastome (callus knob) which is disseminated with the caryopsis, contains oils which may attract ants and aid dispersal. ... Zea), upland rice (Oryza), cotton (Gossypium), soy (Glycine), Sorghum and peanuts (Arachis). Asian countries such as India do ... with Rottboellia forming a sister clade to Zea. Clayton and Renvoize also recognised a subtribe Rottboelliinae which included ...
Timler Zea mays L. Zehneria capillacea (Schumach.) C.Jeffrey Zehneria hallii C.Jeffrey Zehneria scabra (L.f.) Sond. Zehneria ...
The corn cyst nematode (CCN) Heterodera zeae is a plant parasitic nematode that feeds on corn Zea mays. The CCN has a limited ... Krusberg, L. R.; S. Sardanelli; A. P. Grybauskas (1997). "Damage potential of Heterodera zeae to Zea mays as affected by ... Hashmi, S.; L. R. Krusberg; R. N. Huettel (1993). "Resistance in Zea mays to Heterodera zeae". Journal of Nematology. 25: 820- ... It has been reported that temperature may influence the susceptibility of poor host plants to infection by H.zeae. At 15 and 23 ...
"Genetic Mapping Fact Sheet". Gallvetti, Andrea; Whipple, Clinton J. (2015). "Positional cloning in maize (Zea mays subsp. mays ...
He married Anna May Stanton in June 1916. They had several children. "Morphology of the flowers of Zea mays". Bulletin of the ... "The endosperm of Zea and Coix". American Journal of Botany. 17 (5): 371-380. May 1930. doi:10.2307/2435927. "Presidential ... "The development of the spikelets of Zea mays". Bulletin of the Torrey Botanical Club. 44 (10): 483-496. 1917. "The popping of ... Anna May Stanton Weatherwax at Find a Grave "Book Review of The Story of the Maize Plant". Nature. 112 (2817): 616-617. 1923. ...
Tarr, J. B.; Arditti, J. (1982). "Niacin Biosynthesis in Seedlings of Zea mays". Plant Physiology. 69 (3): 553-556. doi:10.1104 ... They may progress into abdominal pain, pulmonary congestion and unconsciousness. One person died after accidental ingestion of ... For comparison, indoor air contaminated with tobacco smoke may contain up to 16 µg·m−3 of pyridine, and one cigarette contains ... 11 May 2010. Archived from the original on 20 September 2018. Retrieved 7 January 2011. "About Vertellus". vertellus.com. ...
Zea Mays. Maïs doux. Cs. accumule le Césium dans les racines.. [16] ... 15] Mark P. de Souza, Dara Chu, May Zhao, Adel M. Zayed, Steven E. Ruzin, Denise Schichnes, et Norman Terry,": Rhizosphere ...
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... Heliothis zea), the tomato pinworm (Keiferia lycopersicella) and the tomato fruit borer (Helicoverpa armigera).[23][24] A 91- ... Other projects aim to enrich tomatoes with substances that may offer health benefits or be more nutritious. As well as aiming ... the researchers hope genetic engineering of the tomato may decrease wastage.[14] ...
Zea mays 5.062731057×10. ^. 9 Sus scrofa 4.88786186×10. ^. 9 Danio rerio 3.120857462×10. ^. 9 ... However, some submitters may claim patent, copyright, or other intellectual property rights in all or a portion of the data ... Public databases which may be searched using the National Center for Biotechnology Information Basic Local Alignment Search ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Chelius MK; Triplett EW (April 2001). "The Diversity of Archaea and Bacteria in Association with the Roots of Zea mays L". ... Zimmer, Carl (May 6, 2015). "Under the Sea, a Missing Link in the Evolution of Complex Cells". New York Times. Retrieved May 6, ... Plasmids may be transferred between cells by physical contact, in a process that may be similar to bacterial conjugation.[132][ ... These compounds differ in structure from bacterial antibiotics, so they may have novel modes of action. In addition, they may ...
Chelius MK, Triplett EW (2001). "The Diversity of Archaea and Bacteria in Association with the Roots of Zea mays L". Microb. ...
Examples are Cucurbita maxima, Phaseolus vulgaris, Zea mays.. Recent usage in horticulture has, however, maintained a ... having affinities with) or may remain unnamed. Its cultigenic origin may or may not be recognised by the allocation of a ... Zea mays) and banana (Musa acuminata), are so named. Although it is perfectly in order to give a cultigen a botanical name, in ... The genetic material of a cultigen may become part of the gene pool of a population where, over time, it may be largely or ...
Zea mays (binomen a Linnaeo anno 1753 statutum), Latinitate communi zea[1] seu maizium[2] (Hispanice maíz, a lingua Taino mahiz ... Yongxian Lu et al., "A pistil-expressed pectin methylesterase confers cross-incompatibility between strains of Zea mays" in ... D. R. Piperno, K. V. Flannery, "The earliest archaeological maize (Zea mays L.) from highland Mexico: New accelerator mass ... "Zea mays" apud Plants for a Future • Plantes d'Afrique • Flora of China • INPN France • USDA Plants Database ...
Ar maiz (Zea mays) a zo un ed, an hini gounezet ar muiañ er bed. Gounezet e vez evit bevañ an dud met ivez evel boued chatal. ...
... (Zea mays), kent as (Indian) corn an aw, is a herbaceous plant domesticatit in Mesoamericae that syne spreid athort the ...
There are five recognized species of teosinte: Zea diploperennis, Zea perennis, Zea luxurians, Zea nicaraguensis and Zea mays. ... Z. mays ssp. huehuetenangensis. Z. mays ssp. mays (maize). Z. mays ssp. mexicana. Z. mays ssp. parviglumis. Z. nicaraguensis. Z ... The teosintes are a group of large grasses of the genus Zea found in Mexico, Guatemala and Nicaragua. ... Text is available under the Creative Commons Attribution/Share-Alike License and the GFDL; additional terms may apply. See ...
22 May 2012. *. TjBot. r2.7.2) (Robó Añiiu: zea:Jeruzalem. c. 17:17 ...
Pages in category "User zea-3". The following 3 pages are in this category, out of 3 total. This list may not reflect recent ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... Retrieved from "https://en.wikipedia.org/w/index.php?title=Category:User_zea-3&oldid=548099645" ...
സിയാ മെയ്സ് (Zea mays) എന്ന ശാസ്ത്രനാമത്തിൽ അറിയപ്പെടുന്നു. ഇന്ത്യയിൽ ഉത്തർപ്രദേശ്, രാജസ്ഥാൻ, പഞ്ചാബ്, ബിഹാർ തുടങ്ങിയ ... മണിച്ചോളം (Andropogon sorgum), മക്കച്ചോളം (Zea maize), ബജ്റ (Pennisettum typhoideum), തിന (Setaria italica), പനിവരക് (Panicum ...
Zea - Francisco Antonio Zea (1770-1822). *Zeile - Elsie May Zeile (1870-1940) ...
... apo Kallamoci (Zea mays L), është një drith i zbutur nga njerëzit vendas në Mesoamerica në kohët parahistorike.Misri ...
19 may 2015. *. Dexbot. Removing Link FA template (handled by wikidata). m. 17:49 ...
If an internal link intending to refer to a specific person led you to this page, you may wish to change that link by adding ... Fernando Botero Zea (born 1956), Colombian politician. *Giovanni Botero (c. 1544-1617), Italian thinker, priest, poet, and ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Papadimitriou, Lena (24 May 1998). "10 ροκ συναυλίες που δεν θα ξεχάσουμε [10 rock concerts that we will not forget]". To Vima ... 17 May 2012. The Olympic flame is due to be handed over from Greece to London this afternoon at the Panathenaic Stadium in ... It may thus be argued that the Panathenaic Stadium of Herodes Atticus, who was both Athens' leading son and a Roman consul, ... staged their first Intercalated Games, held once again at the Panathenaic Stadium in Athens, from April 22 to May 2, 1906.. ...
Fumonisin B (1)-nonproducing strains of Fusarium verticillioides cause maize (Zea mays) ear infection and ear rot. J. Agric. ... Unsourced material may be challenged and removed. (September 2012) (Learn how and when to remove this template message) ... teleomorph Gibberella zeae) was given the trivial name zearalenone as a combination of G. zeae, resorcylic acid lactone, -ene ( ...
... and Zea mays (maize).[2][3]. Cochliobolus miyabeanus may cause a wide range of symptoms. General symptoms occurring on the ... 3. Nutrition level[5] - Nutrition of the host plant may also influence level of disease development. For example, soil ...
"A Correlation of Cytological and Genetical Crossing-Over in Zea Mays". Proc Natl Acad Sci USA. 17.. ... Archived from the original on 16 May 2008.. *^ Bateson W (1907). "The Progress of Genetic Research". In Wilks, W (ed.). Report ... May 2015). "CRISPR/Cas9-mediated gene editing in human tripronuclear zygotes". Protein & Cell. 6 (5): 363-372. doi:10.1007/ ... Pearson H (May 2006). "Genetics: what is a gene?". Nature. 441 (7092): 398-401. Bibcode:2006Natur.441..398P. doi:10.1038/ ...
Retrieved 12 May 2009.. *^ a b c d e f g h i j k l m n o p q r s t u v w x y z Gullan, P.J.; Cranston, P.S. (2005). The Insects ... Heliothis zea". Journal of Insect Physiology. 15 (6): 989-1001. doi:10.1016/0022-1910(69)90139-5.. ... Retrieved 3 May 2009.. *^ a b c d e f Resh, Vincent H.; Ring T. Carde (2009). Encyclopedia of Insects (2 ed.). U. S. A.: ... Maierbrugger, Arno (14 May 2013). "UN: Insects are 'food of the future' (video)". Inside Investor. Retrieved 17 May 2013.. ...
"A Correlation of Cytological and Genetical Crossing-Over in Zea Mays"। Proceedings of the National Academy of Sciences of the ...
Kristi Zea, Debra Schutt - Put oslobođenja 2009. Rick Carter, Robert Stromberg, Kim Sinclair - Avatar Dave Warren, Anastasia ... Eugenio Zanetti; Cindy Carr - What Dreams May Come 1999. Rick Heinrichs, Peter Young. - Sanjiva dolina Luciana Arrighi, Ian ...
If the regulation is wrongly set, the keys may be at different heights, some pipes may sound when the keys are not pressed (a " ... Adlung, Jacob (1768). Musica mechanica organoedi. English translation, Q. Faulkner, trans (2011). Lincoln, NE: Zea E-Books. ... The smallest portable pipe organs may have only one or two dozen pipes and one manual; the largest may have over 33,000 pipes ... For example, without unification, three stops may use 183 pipes. With unification three stops may borrow one extended rank of ...
Unsourced material may be challenged and removed.. Find sources: "Live: In Paradise" - news · newspapers · books · scholar · ... Zea Barker - co-editor. *Christopher Lydon - Master of Ceremonies. *Noah Blumenson-Cook - Production Coordinator ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Orius insidiosus, the "insidious flower bug", for example, feeds on the eggs of the corn earworm (Helicoverpa zea). Orius ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... This page was last edited on 28 May 2021, at 22:34 (UTC). ...
Some strains of corn (taxonomized as Zea mays) are cultivated specifically as popping corns. The Zea mays variety everta, a ... Though the kernels of some wild types will pop, the cultivated strain is Zea mays everta, which is a special kind of flint corn ... Grimes, William (1 May 1994). "How About Some Popcorn With Your Fat". The New York Times. Retrieved 20 January 2010.. ... Retrieved 8 May 2019. As it turns out, the corn that we typically eat is different than the kernels that become popcorn.. ...
Polyethylene versus glassine shoot bags in pollination of corn (Zea mays L.). Crop Sci., 8(1): 126-128. doi:10.2135/ ... Pollination bags may be 2D or 3D. The 3D bags have a gusset for expansion to avoid contact between the plant and the bag. ... Such bags may not suit to the needs of plant breeders of different crops. Some companies such as PBS International UK, Del Star ... It may have transparent hard plastic or bread type soft bags. Polyethylene nylon type when flash spun is strong and used as ...
TPA: Zea mays chromosome 2 TPA: Zea mays chromosome 2. gi,414584696,tpg,GK000032.2,,gnl,AS _000005015,chr2.tpa ...
Fruit is a fruit of Zea mays.. Function(s): Not Reported. Synonym(s): ZEA MAYS (CORN) FRUIT, CORN; CORN FRUIT; ZEA MAYS; ZEA ... About ZEA MAYS (CORN): Zea Mays (Corn) ... 25,541 studies in PubMed science library may include ...
Reinert J., Yeoman M.M. (1982) Embryos of Maize (Zea mays). In: Plant Cell and Tissue Culture. Springer, Berlin, Heidelberg. * ... which may in particular cases prevent or modify the development of the plant. This is particularly true, for instance, in the ...
Zea mays (Maize)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a ... tr,B4G1S4,B4G1S4_MAIZE Peroxidase OS=Zea mays OX=4577 PE=2 SV=1 MATSSGSCLIISLLVVVVAAALSASTASAQLSSTFYDTSCPSAMSTISSGVNSAVAQQAR ... You are using a version of browser that may not display all the features of this website. Please consider upgrading your ... However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is ...
tr,Q41837,Q41837_MAIZE Polygalacturonase (Fragment) OS=Zea mays OX=4577 PE=3 SV=1 ... You are using a version of browser that may not display all the features of this website. Please consider upgrading your ... Entry version 80 (08 May 2019). Sequence version 1 (01 Nov 1996). Previous versions , rss ... However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is ...
Introduced Information: This plant is introduced to some part of the PLANTS Floristic Area, though it may be native in other ... Zea mays L. - corn. Subspecies. Zea mays L. ssp. parviglumis Iltis & Doebley - corn. ...
... mays Zea mays. Published on the internet. Accessed 2013 Dec. 2.. *Tropicos.org 2013. Zea mays . Missouri Botanical Garden. ... Genus: Zea Species: Z. mays Subspecies: Z. m. subsp. mays - Z. m. subsp. huehuetenangensis - Z. m. subsp. parviglumis ... Mays zea Gaertn., Fruct. Sem. Pl. 1: 6 (1788), nom. superfl.. *Zea segetalis Salisb., Prodr. Stirp. Chap. Allerton: 28 (1796), ... Zea mays in World Checklist of Selected Plant Families. The Board of Trustees of the Royal Botanic Gardens, Kew. Published on ...
About ZEA MAYS (CORN) KERNEL MEAL: Zea Mays (Corn) Kernel Meal is a coarse flour prepared by milling the kernels of Zea mays.. ... Synonym(s): CORN GLUTENS; CORN KERNEL MEAL; CORN MEAL; GLUTENS, CORN; ZEA MAYS KERNEL MEAL ... Show all 30 recent products that contain ZEA MAYS (CORN) KERNEL MEAL.. ... 22,413 studies in PubMed science library may include information on the toxicity of this chemical see search results -,. NLM ...
Zea mays subsp. mexicana cultivar:TEO Zea mays subsp. mexicana cultivar:TEO. Zea mays subsp. mexicana cultivar:TEO Genome ... Zea mays subsp. mexicana cultivar:TEO. Zea mays subsp. mexicana cultivar:TEO Genome sequencing. ... Zea; Zea mays; Zea mays subsp. mexicana ... Yang N et al., "Contributions of Zea mays subspecies mexicana ... Zea mays subsp. mexicana[Taxonomy ID: 4579]. Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; ...
... Other English names: Indian Corn, Maize.. Botanical description: Corn is one of the tallest and most ... This might either mean that wild corn was extinct before botanists could make a record of it, or that it is a plant so ... Though this is not conclusive proof, it is evidence that corn may have developed from Teosinte, for in all other known cases ... Possibly the husks surrounding the kernels are abnormal and might be found in any of the main groups. This opinion is supported ...
Zea mays. L. Zea mays (binomen a Linnaeo anno 1753 statutum), Latinitate communi zea[1] seu maizium[2] (Hispanice maíz, a ... E granis Zeae mays varietatis evertae maizium inflatum praeparatur. Notae[recensere , fontem recensere]. *↑ "Unicum zeae granum ... Yongxian Lu et al., "A pistil-expressed pectin methylesterase confers cross-incompatibility between strains of Zea mays" in ... D. R. Piperno, K. V. Flannery, "The earliest archaeological maize (Zea mays L.) from highland Mexico: New accelerator mass ...
Zea mays is a ANNUAL growing to 2 m (6ft 7in) at a fast rate. It is hardy to zone (UK) 3 and is frost tender. It is in flower ... Zea mays is a ANNUAL growing to 2 m (6ft 7in) at a fast rate.. It is hardy to zone (UK) 3 and is frost tender. It is in flower ... Please note that a plant may be invasive in one area but may not in your area so its worth checking. ... Sun May 31 2009 Nature Abhors a Garden Nature abhors a Garden for 11/30/08 discusses how Native Americans and Spaniards ...
Zea mays) Red Midget supplied by member gardeners in the PlantFiles database at Daves Garden. ...
Zea mays) Robust Ruby Red supplied by member gardeners in the PlantFiles database at Daves Garden. ...
Zea mays clone ZMMBBc_448F14, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces. 4689483. AC007410. N7F12. 30650. Zea mays clone ... Zea mays clone ZMMBBc0387C14, *** SEQUENCING IN PROGRESS ***. 48374983. AY542798. Z477F24. 209336. 1. Zea mays chromosome 1 ... Zea mays clone ZMMBBc0088M21, *** SEQUENCING IN PROGRESS ***. 58531566. AC149476. ZMMBBb0316C08. 121514. Zea mays clone ... Zea mays clone ZMMBBb0355N05, *** SEQUENCING IN PROGRESS ***. 51315580. AC146975. ZMMBBb0357I20. 139209. Zea mays clone ...
Glycolysis / Gluconeogenesis - Zea mays (maize) [ Pathway menu , Organism menu , Pathway entry , Download KGML , Show ...
Zea mays var. saccharata (Sturtev.) L.H. Bailey * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of ... Zea mays var. pennsylvanica Bonaf. * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of Agriculture, ... Zea mays var. precox Torr. * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of Agriculture, ... Zea mays var. virginica Bonaf. * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of Agriculture, ...
Were you able to grow out additional zea mays seed stock in the 2015 growing season? ... Zea Mays - Blue Jade sold out?. Created by Jantz-Koprivnik, Kathleen on November 29, 2015 at 11:13 am ... Garden Supply , Organic Fertilizer , Composting , Indoor Gardening › Forums › Ask A Gardener › Zea Mays - Blue Jade sold out? ... Were you able to grow out additional zea mays seed stock in the 2015 growing season? ...
Photosynthesis - antenna proteins - Zea mays (maize) [ Pathway menu , Organism menu , Pathway entry , Download KGML , Show ...
Zea mays Linn., Sp. Pl. 2: 971. 1753. is the familiar Maize or Indian Corn introduced to the Old World from tropical America ...
Zea mays L. 玉蜀黍 Description from Flora of China. Culms erect, 1-4 m tall. Leaf sheaths with transverse veinlets; leaf blades 50 ...
The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays. Tadas Panavas, Jessica Weir and Elsbeth L. Walker ... The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays. Tadas Panavas, Jessica Weir and Elsbeth L. Walker ... The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays. Tadas Panavas, Jessica Weir and Elsbeth L. Walker ... The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays ...
For organic fertilizers such as fish emulsion, follow label directions as they may vary per product. Light. Conditions : Light ... The western side of a house may even be shady due to shadows cast by large trees or a structure from an adjacent property. If ... If a shade loving plant is exposed to direct sun, it may wilt and/or cause leaves to be sunburned or otherwise damaged. ... Right plant, right place! Plants which do not receive sufficient light may become pale in color, have fewer leaves and a "leggy ...
Download Harrobian by Zea mays from the story Radar by babroot1980 with 2 reads. man, pendulum, money. Simple Way to Listen / ... Tags: Harrobian by Zea mays mp3, Harrobian by Zea mays album, Harrobian by Zea mays flac, Harrobian by Zea mays torrent, listen ... Harrobian by Zea mays album.. zip Harrobian by Zea mays album.. BEST! Harrobian by Zea mays Rar.. Best Harrobian by Zea mays ... get Harrobian by Zea mays zip, download Harrobian by Zea mays, Harrobian by Zea mays album mp3, zip album Harrobian by Zea mays ...
Zea Mays is situated in the picturesque Pioneer Valley in Western Massachusetts. We are a mere two-hour drive to Boston and ... Zea Mays Printmaking is located at 320 Riverside Drive, Florence (Northampton), Massachusetts. Were in the Baystate ...
Zea mays ssp. mays L.) and Its Wild Ancestor (Zea mays ssp. parviglumis) ... Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.). Maud I. Tenaillon, Mark C. Sawkins, ... We measured sequence diversity in 21 loci distributed along chromosome 1 of maize (Zea mays ssp. mays L.). For each locus, we ... Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.) ...
2013 Genetic diversity analysis of elite European maize (Zea mays L.) inbred lines using AFLP, SSR, and SNP markers reveals ... Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction. Christina Lehermeier, Nicole Krämer ... Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction. Christina Lehermeier, Nicole Krämer ... Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction. Christina Lehermeier, Nicole Krämer ...
The Plants Database includes the following 1 variety of Zea mays ssp. parviglumis . Click below on a thumbnail map or name for ... Zea mays L. ssp. parviglumis Iltis & Doebley Show All. Show Tabs. corn ... Zea mays L. - corn Subspecies. Zea mays L. ssp. parviglumis Iltis & Doebley - corn ...
What is Zea mays? Meaning of Zea mays as a legal term. What does Zea mays mean in law? ... Definition of Zea mays in the Legal Dictionary - by Free online English dictionary and encyclopedia. ... Zea mays legal definition of Zea mays https://legal-dictionary.thefreedictionary.com/Zea+mays ... tubular handling; Natriuresis; Glomerular function; Proximal tubule function; Zea mays Linne. Zea mays L. extracts modify ...
Conservation of agricultural genetic diversity is necessary as a source of variation for breeding and selection efforts. Traditionally, conservation efforts focus on the maintenance of diversity both in genebanks (ex-situ ...
  • Reinert J., Yeoman M.M. (1982) Embryos of Maize (Zea mays) . (springer.com)
  • Paramutation generates heritable changes affecting regulation of specific alleles found at several Zea mays (maize) loci that encode transcriptional regulators of anthocyanin biosynthetic genes. (genetics.org)
  • Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. (pnas.org)
  • We measured sequence diversity in 21 loci distributed along chromosome 1 of maize ( Zea mays ssp. (pnas.org)
  • Here's a one-point source to tap to find everything there is to know about maize--that is, Zea mays ssp. (thefreedictionary.com)
  • Under these condition, yields of staplecrop plants like bread wheat (Triticum aestivum), rice (Oriza sativa), and maize (Zea mays), which provide over 50% of human calories, are predicted to decrease [4]. (scirp.org)
  • Transcriptome Analysis of Cadmium-Treated Roots in Maize (Zea mays L. (frontiersin.org)
  • Electrophoretic profiles of storage proteins in selected maize (Zea mays L.) genotypes', Journal of Central European Agriculture , 20(3), pp. 911-918. (srce.hr)
  • A. Špalekova, E. Gregova and Z. Galova, "Electrophoretic profiles of storage proteins in selected maize (Zea mays L.) genotypes", Journal of Central European Agriculture , vol.20, no. 3, pp. 911-918, 2019. (srce.hr)
  • Maize (Zea mays L.) is important cereal and its diversity research is essential from the point of breeding strategy. (srce.hr)
  • Accelerator mass spectrometry age determinations of maize cobs ( Zea mays L.) from Guilá Naquitz Cave in Oaxaca, Mexico, produced dates of 5,400 carbon-14 years before the present (about 6,250 calendar years ago), making those cobs the oldest in the Americas. (pnas.org)
  • Maize ( Zea mays L.) is the New World's preeminent grain crop, was widely grown at the time of the European contact in both hemispheres, and was a staple food of many prehistoric societies. (pnas.org)
  • Many investigators are convinced by the considerable amount of molecular, cytological, and isozyme data accumulated on the ancestry of maize, which indicates that maize is probably descended from an annual species of teosinte ( Zea mays ssp. (pnas.org)
  • It is still unknown when the first efforts to cultivate a wild Zea leading to the domestication of maize occurred. (pnas.org)
  • Maize ( zea mays )-commonly known as corn-often evokes nostalgic visions of pastoral landscapes. (harvard.edu)
  • This Decision Document has been prepared to explain the regulatory decision reached under the guidelines Dir94-08 Assessment Criteria for Determining Environmental Safety of Plants with Novel Traits and its companion document Dir94-11 The Biology of Zea mays L. (Corn/Maize) and the guidelines Dir95-03 Guidelines for the Assessment of Livestock Feed from Plants with Novel Traits. (gc.ca)
  • Linkage map construction and quantitative trait loci (QTL) mapping using intermated vs. selfed recombinant inbred maize line (Zea mays L. (bioone.org)
  • These represent new genes involved in iron acquisition by maize, and future cloning of these genes may reveal novel aspects of the grass iron acquisition mechanism. (frontiersin.org)
  • and identification of additional components of the maize iron homeostatic apparatus may help to elucidate the genes underlying such QTL. (frontiersin.org)
  • To investigate the roles of different Ca genes in maize ( Zea mays ), we examined stomatal responses in ca1 and ca2 single mutants as well as a ca1ca2 double mutant. (plantphysiol.org)
  • Efficacy of natural aluminosilicates in moderating drought effects on the morphological and physiological parameters of maize plants (Zea mays L. (scielo.cl)
  • M.J. (2009) Maize (Zea mays) A Model Organism for Basic and Applied Research in Plant Biology. (scirp.org)
  • Effect of Potassium Deficiency on Root Growth and Nutrient Uptake in Maize (Zea mays L. (scirp.org)
  • Influence of Air Temperature on the Stability of Cytoplasmic Male Sterility (CMS) in Maize (Zea mays L. (agbioforum.org)
  • Maize (Zea mays) is a globally produced crop with broad genetic and phenotypic variation. (nih.gov)
  • We show how MAGIC maize may find strong candidate genes by incorporating genome sequencing and transcriptomics data. (nih.gov)
  • Power simulations show that subsets of MAGIC maize might achieve high-power and high-definition QTL mapping. (nih.gov)
  • Regulation of flower development in cultured ears of maize ( Zea mays L. (springer.com)
  • Bommineni VR (1988) Regulation of flower development in cultured inflorescences of maize ( Zea mays L.). PhD thesis, The University of Western Ontario, London, Ontario, Canada. (springer.com)
  • Cultivars included the genetically modified maize ( Zea mays ), with the pat -gene conferring resistance to the herbicide glufosinate (synonym: L-phosphinothricin), and the hybrid, conventional maize. (scielo.org.ar)
  • A green house study was conducted between July and August, 2009 to test and determine the drought tolerance levels of ten maize ( Zea mays L.) genotypes. (academicjournals.org)
  • A large fraction of the transcripts of the Bronze-2 ( Bz2 ) gene of maize ( Zea mays L.) are unspliced in purple husk tissues. (plantphysiol.org)
  • Genome wide association study and genomic prediction for stover quality traits in tropical maize (Zea mays L. (cgiar.org)
  • In the tribe Maydeae (family Gramineae), maize ( Zea mays ssp. (g3journal.org)
  • Maize can be crossed with all teosinte species, including Z . mays ssp. (g3journal.org)
  • Genotype by tillage interactions in maize (Zea mays L. (iastate.edu)
  • However, no studies have been reported in which large numbers of unselected genotypes were grown in no-till and conventional tillage to examine the effect of tillage systems upon selection of maize (Zea mays L.) genotypes;In this study, three sources of maize genotypes were evaluated in two tillage systems. (iastate.edu)
  • Monitoring Maize ( Zea mays L.) Phenology with Remote Sensing" by Andrés Viña, Anatoly A. Gitelson et al. (unl.edu)
  • The objective of this paper is to remotely evaluate the phenological development of maize ( Zea mays L.) in terms of both biomass accumulation and reproductive organ appearance. (unl.edu)
  • ABSTRACT: The study was conducted to evaluate the growth and yield performance of sweet corn (Zea mays L.) intercropped with sweet potato (Ipomoea batatas L.) and applied with mushroom spent, rice ash as organic fertilizer, and inorganic or commercial fertilizer. (thefreelibrary.com)
  • Sweet corn may be divided into three distinct types according to genetic background: normal sugary (SU), sugary enhancer (SE) and supersweet (Sh2). (illinois.edu)
  • A glasshouse study was conducted to investigate the growth response of sweet corn ( Zea mays ) to mycorrhizal fungi inoculation over different plant ages (2, 4, 6, 8 and 10 weeks) and to determine the interaction between the host and mycorrhizal fungus on mycorrhizal development, using soil substrate as inoculum for Glomus mosseae . (scialert.net)
  • Though this is not conclusive proof, it is evidence that corn may have developed from Teosinte, for in all other known cases hybrids between distinct grass species are sterile. (chestofbooks.com)
  • EST generation and analyses towards identifying female gametophyte-specific genes in Zea mays L. (springer.com)
  • DeKalb Genetics Corporation (DeKalb, IL) has patented a method for the production of stable, genetically transformed, Zea mays plants that comprise an exogenous DNA expressing phosphinothricin acetyl transferase to impart resistance to phosphinothricin in said plants. (thefreedictionary.com)
  • The varieties may also be called genetically modified organisms (GMO). (cosmeticsinfo.org)
  • Help annotate the Zea mays genome using our yrGATE gene structure annotation tool ( see Overview ), aided by GAEVAL tables that flag problematic gene models. (plantgdb.org)
  • A trispecific hybrid, MTP (hereafter called tripsazea), was developed from intergeneric crosses involving tetraploid Zea mays (2 n = 4 x = 40, genome: MMMM), tetraploid Tripsacum dactyloides (2 n = 4 x = 72, TTTT), and tetraploid Z . perennis (2 n = 4 x = 40, PPPP). (g3journal.org)
  • Protoplasts which regenerate reproducibly in a short time to normal, fertile plants can be regenerated from an auxin-autotrophic genotype of Zea mays (L.). Starting from immature embryos on hormone-free media, an auxin-autotrophic, embryogenic callus is formed on the shoot basis of the seedlings, which. (google.com)
  • Zea mays ( binomen a Linnaeo anno 1753 statutum), Latinitate communi zea [1] seu maizium [2] ( Hispanice maíz, a lingua Taino mahiz ), est gramen familiae Poacearum , frumentum ab Indis in Mexico australi temporibus praehistoricis , abhinc annorum 10 000 fere, primum excultum. (wikipedia.org)
  • While corn might have had its genesis as a versatile crop, the last few centuries reveal a more influential agent. (harvard.edu)
  • For example, you may wish to select Sundance (69 days) for the first early variety, Tuxedo (75 days) for the second early variety and Incredible (83 days) for the main-crop variety. (illinois.edu)
  • Effect of water stress on gas exchange of field grown zea mays l. (thefreedictionary.com)
  • Zea mays L. is one of the world's most important and widely grown crops and is susceptible to a wide range of plant pathogens. (umsystem.edu)
  • More commonly grown to a height of 2-3 meters (6-9 feet), Zea mays typically grows with a single, hollow main stem often called a stalk (or culm) which exhibits internodes that are cylindrical in the upper part and alternately grooved in the lower part with a bud in the groove. (wikipedia.org)
  • Abstract: Natural herbicides may be more sustainable than their chemical homologues, but they are still toxic substances that can affect humans and animals. (ad-astra.ro)
  • Zea Mays (Corn) Silk Extract, Hydrolyzed Corn Starch, Hydrolyzed Corn Protein, Corn Acid, Corn Glycerides and Potassium Cornate. (cosmeticsinfo.org)
  • and Zea Mays (Corn) Silk Extract were not dermal irritants or sensitizers. (cosmeticsinfo.org)
  • Optimization of obtaining an aqueous extract of purple corn (Zea mays L.) rich in anthocyanins and degradation profile. (usp.br)
  • Zea Mays Printmaking is located at 320 Riverside Drive, Florence (Northampton), Massachusetts. (zeamaysprintmaking.com)
  • The scholarship fund was named after founder Liz Chalfin's mother who was an avid supporter of Zea Mays Printmaking and believed strongly in helping those in need. (zeamaysprintmaking.com)
  • BLAST-able datasets include Zea mays genomic DNA, splice-aligned transcripts and proteins, gene models, and other aligned sequences. (plantgdb.org)
  • This gain, we speculate, might derive from the ability of the mutant proteins to sequester WT1 into unproductive oligomers, or to erroneously bind to variant target sequences. (osti.gov)
  • This plant is introduced to some part of the PLANTS Floristic Area, though it may be native in other parts. (redorbit.com)
  • 1. A Zea mays (L.) cell line which is auxin-autotrophic and from which protoplasts, which can reproducibly and stably regenerate into fertile plants, can be produced. (google.com)
  • 8. An auxin-autotrophic Zea mays (L.) cell line from which fertile Zea mays (L.) plants can be obtained. (google.com)
  • Plants which do not receive sufficient light may become pale in color, have fewer leaves and a "leggy" stretched-out appearance. (backyardgardener.com)
  • Allelopathic management of noxious weeds in Helianthus annuus, Zea mays and Triticum aestivum by selected plants. (cabi.org)
  • Drought experiments with ca1ca2 mutant plants suggest a role for CA in water-use efficiency and reveal that Z. mays is not optimized for water-use efficiency under well-watered conditions. (plantphysiol.org)
  • The aim of this study was to evaluate metabolic response in both shoot and roots of two plants: Zea mays var. (scirp.org)
  • In the current study, we examined root and shoot metabolites in two types of plants, Zea mays var. (scirp.org)
  • Response and adaptation of Zea mays plants under optimal conditions are assured by the existence of a complex system of adjustment at different levels of organization. (ad-astra.ro)
  • In this context, the purpose of the present study consists in assessing the role of antioxidant enzymes in the formation and development tolerance of Zea mays plants throughout their development. (ad-astra.ro)
  • Possumus eligere nomen botanicum speciei ( Mays ) aut binomen ( Zea mays ). (wikipedia.org)
  • It is expected that the higher expression of considered traits might be obligate for better yield under drought stress. (scirp.org)
  • This study was conducted to evaluate the effects of simulated drought on the malondialdehyde (MDA) and antioxidant enzymes activity in Zea mays . (ajol.info)
  • E granis Zeae mays varietatis evertae maizium inflatum praeparatur. (wikipedia.org)
  • Zea mays (corn silk), Althea officianalis (marshmallow), and Barosma betulina (buchu). (thefreedictionary.com)
  • Agronomic characteristics such as yield, plant height, overwintering capacity, flowering period, and disease susceptibility were compared to those of unmodified Z. mays counterparts. (gc.ca)
  • Influence of Herbicides as Growth Regulators on Growth and Yield of Baby Corn (Zea mays L. (scialert.net)
  • A Pilot Research study to establish the effect on corn (Zea mays) seed germination when immersed in homeopathically potentised 15X essential mineral nutrient solutions. (hpathy.com)
  • to identify whether seed immersion in 13 homeopathically potentised 15X essential mineral nutrient solutions increases Corn ( Zea mays ) seed germination when compared with a water control. (hpathy.com)
  • This research was undertaken to identify whether seed immersion in homeopathically potentised 15X essential mineral nutrient solutions would increase corn ( Zea mays ) seed germination. (hpathy.com)
  • Purple corn ( Zea mays L.), traditional culture of the Andean region, is known for its high content of anthocyanins. (usp.br)
  • echinatus, Echinochloa crus-galli, Eleusine indica, Lolium multiflorum and Zea mays grew better in the fumigated soil (Table 1). (thefreedictionary.com)
  • This study investigates the effects of sewage sludge and compost usage on soil chemical properties and Zea mays nutrition in comparison with those of iron and manganese sulfate solution. (environmental-expert.com)
  • These corn lines will permit the use of Liberty™ as a post-emergence herbicide, thus providing an additional means of weed control in corn production, which may reduce reliance on soil-incorporated herbicides. (gc.ca)
  • The c locus of Zea mays, involved in the regulation of anthocyanin biosynthesis, has been cloned by transposon tagging. (nih.gov)
  • The metabolic induction was associated with Aminoacyl-tRNA biosynthesis in Zea mays var. (scirp.org)
  • Lines T14 and T25 were produced using recombinant DNA technology which permitted the introduction of a bacterial based synthetic gene into a line of Z. mays . (gc.ca)
  • Bronze-2 Gene Expression and Intron Splicing Patterns in Cells and Tissues of Zea mays L. (plantphysiol.org)
  • Stress adaptation was evaluated, including susceptibilities to various Z. mays pests and pathogens and to herbicides, other than glufosinate ammonium, that are normally used to control corn or weeds in corn crops. (gc.ca)
  • To address this challenge, we considered two alternative systems for introducing cover crops into corn (Zea mays L.)- soybean (Glycine max L.) cropping systems. (unl.edu)
  • Our initial studies suggested that both genetic and physiological factors may influence the degree of splicing failure. (plantphysiol.org)
  • According to Dr. E. L. Sturtevant, the varieties may be classified into the following seven principal groups. (chestofbooks.com)
  • indentata) is a fast-growing, vertically erect, short-lived annual plant and similar to many other varieties of Zea mays. (wikipedia.org)
  • indentata from other varieties of Zea mays is the small indentation ("dent") that develops at the crown of each kernel. (wikipedia.org)
  • Parallels noted among diverse examples of non-Mendelian inheritance patterns suggest that paramutation may be a general feature of many eukaryotic genomes ( C handler and S tam 2004 ). (genetics.org)
  • Therefore, a detailed characterization of each isoform of CA may provide evidence of specialization and functional redundancies. (plantphysiol.org)
  • In the present field study, we considered the relationship between specific sphingolipids and oxylipins of different hybrids of Zea mays and fumonisin by F. verticillioides , sampling ears at different growth stages from early dough to fully ripe. (mdpi.com)
  • Plant Growth-Prompting Bacteria Influenced Metabolites of Zea mays var. (scirp.org)
  • Bioassays were performed to study the allelopathic effect of dried leaf powder of Carica papaya , Parthenium hysterophorus , Euphorbia helioscopia and Rumex dentatus on intact and pre-germinated seeds of R. dentatus , Avena fatua , Helianthus annuus (K.S.E 7777), Zea mays (Islamabad Gold 2010) and Triticum aestivum (Wafaq 2001). (cabi.org)
  • Map of Mexico showing the location of Guilá Naquitz Cave and the Tehuacán Valley, together with the modern distribution of the populations of Zea mays ssp. (pnas.org)
  • Both, IRIL and RIL, populations were developed from Zea mays inbred lines CG60 and CG102. (bioone.org)
  • mays, from Spanish: maíz after Taino: mahiz), also known as corn (North American and Australian English), is a cereal grain first domesticated by indigenous peoples in southern Mexico about 10,000 years ago. (wikipedia.org)
  • The CIR Expert Panel noted that Zea Mays (Corn) Oil is commonly used as a vehicle and as a control in toxicity studies. (cosmeticsinfo.org)
  • The leaves of Zea mays alternate with broad, sword-shaped leaf blades, parallel veins with a prominent mid-rib, and small ligules. (wikipedia.org)