Zea mays
Plant Proteins
Plant Root Cap
Plant Roots
Gene Expression Regulation, Plant
Seeds
Plant Leaves
Gravitropism
The directional growth of organisms in response to gravity. In plants, the main root is positively gravitropic (growing downwards) and a main stem is negatively gravitropic (growing upwards), irrespective of the positions in which they are placed. Plant gravitropism is thought to be controlled by auxin (AUXINS), a plant growth substance. (From Concise Dictionary of Biology, 1990)
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Indoleacetic Acids
Pyruvate, Orthophosphate Dikinase
Chromosomes, Plant
Zearalenone
(S-(E))-3,4,5,6,8,10-Hexahydro-14,16-dihydroxy-3-methyl-1H-2-benzoxacyclotetradecin-1,7(8H)-dione. One of a group of compounds known under the general designation of resorcylic acid lactones. Cis, trans, dextro and levo forms have been isolated from the fungus Gibberella zeae (formerly Fusarium graminearum). They have estrogenic activity, cause toxicity in livestock as feed contaminant, and have been used as anabolic or estrogen substitutes.
Endosperm
Nutritive tissue of the seeds of flowering plants that surrounds the EMBRYOS. It is produced by a parallel process of fertilization in which a second male gamete from the pollen grain fuses with two female nuclei within the embryo sac. The endosperm varies in ploidy and contains reserves of starch, oils, and proteins, making it an important source of human nutrition.
RNA, Plant
Plants, Genetically Modified
Plants
Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.
Crops, Agricultural
Plant Growth Regulators
Cotyledon
A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)
Anthocyanins
Gravity Sensing
Soil
Amino Acid Sequence
Oryza sativa
Poaceae
Base Sequence
Abscisic Acid
Starch
Humic Substances
Organic matter in a state of advanced decay, after passing through the stages of COMPOST and PEAT and before becoming lignite (COAL). It is composed of a heterogenous mixture of compounds including phenolic radicals and acids that polymerize and are not easily separated nor analyzed. (E.A. Ghabbour & G. Davies, eds. Humic Substances, 2001).
Gravitation
Chloroplasts
Plant cell inclusion bodies that contain the photosynthetic pigment CHLOROPHYLL, which is associated with the membrane of THYLAKOIDS. Chloroplasts occur in cells of leaves and young stems of plants. They are also found in some forms of PHYTOPLANKTON such as HAPTOPHYTA; DINOFLAGELLATES; DIATOMS; and CRYPTOPHYTA.
DNA Transposable Elements
Discrete segments of DNA which can excise and reintegrate to another site in the genome. Most are inactive, i.e., have not been found to exist outside the integrated state. DNA transposable elements include bacterial IS (insertion sequence) elements, Tn elements, the maize controlling elements Ac and Ds, Drosophila P, gypsy, and pogo elements, the human Tigger elements and the Tc and mariner elements which are found throughout the animal kingdom.
Herbicides
Culdoscopy
Embryo, Mammalian
Organ Culture Techniques
Selection, Genetic
Trustees
Cloning and characterization of a maize cytochrome-b5 reductase with Fe3+-chelate reduction capability. (1/5543)
We previously purified an NADH-dependent Fe3+-chelate reductase (NFR) from maize roots with biochemical features of a cytochrome-b5 reductase (b5R) [Sparla, Bagnaresi, Scagliarini and Trost (1997) FEBS Lett. 414, 571-575]. We have now cloned a maize root cDNA that, on the basis of sequence information, calculated parameters and functional assay, codes for NFR. Maize NFR has 66% and 65% similarity to mammal and yeast b5R respectively. It has a deduced molecular mass of 31.17 kDa and a pI of 8.53. An uncharged region is observed at its N-terminus but no myristoylation consensus site is present. Taken together, these results, coupled with previous biochemical evidence, prove that NFR belongs to the b5R class and document b5R from a plant at the molecular level for the first time. We have also identified a putative Arabidopsis thaliana NFR gene. Its organization (nine exons) closely resembles mammalian b5Rs. Several NFR isoforms are expected to exist in maize. They are probably not produced by alternative translational mechanisms as occur in mammals, because of specific constraints observed in the maize NFR cDNA sequence. In contrast with yeast and mammals, tissue-specific and various subcellular localizations of maize b5R isoforms could result from differential expression of the various members of a multigene family. The first molecular characterization of a plant b5R indicates an overall remarkable evolutionary conservation for these versatile reductase systems. In addition, the well-characterized Fe3+-chelate reduction capabilities of NFR, in addition to known Fe3+-haemoglobin reduction roles for mammal b5R isoforms, suggest further and more generalized roles for the b5R class in endocellular iron reduction. (+info)Gibberellic acid stabilises microtubules in maize suspension cells to cold and stimulates acetylation of alpha-tubulin. (2/5543)
Gibberellic acid is known to stabilise microtubules in plant organs against depolymerisation. We have now devised a simplified cell system for studying this. Pretreatment of a maize cell suspension with gibberellic acid for just 3 h stabilised protoplast microtubules against depolymerisation on ice. In other eukaryotes, acetylation of alpha-tubulin is known to correlate with microtubule stabilisation but this is not established in plants. By isolating the polymeric tubulin fraction from maize cytoskeletons and immunoblotting with the antibody 6-11B-1, we have demonstrated that gibberellic acid stimulates the acetylation of alpha-tubulin. This is the first demonstrated link between microtubule stabilisation and tubulin acetylation in higher plants. (+info)Patterns of evolutionary rate variation among genes of the anthocyanin biosynthetic pathway. (3/5543)
The anthocyanin biosynthetic pathway is responsible for the production of anthocyanin pigments in plant tissues and shares a number of enzymes with other biochemical pathways. The six core structural genes of this pathway have been cloned and characterized in two taxonomically diverse plant species (maize and snapdragon). We have recently cloned these genes for a third species, the common morning glory, Ipomoea purpurea. This additional information provides an opportunity to examine patterns of evolution among genes within a single biochemical pathway. We report here that upstream genes in the anthocyanin pathway have evolved substantially more slowly than downstream genes and suggest that this difference in evolutionary rates may be explained by upstream genes being more constrained because they participate in several different biochemical pathways. In addition, regulatory genes associated with the anthocyanin pathway tend to evolve more rapidly than the structural genes they regulate, suggesting that adaptive evolution of flower color may be mediated more by regulatory than by structural genes. Finally, for individual anthocyanin genes, we found an absence of rate heterogeneity among three major angiosperm lineages. This rate constancy contrasts with an accelerated rate of evolution of three CHS-like genes in the Ipomoea lineage, indicating that these three genes have diverged without coordinated adjustment by other pathway genes. (+info)Inhibition of plant-pathogenic fungi by a corn trypsin inhibitor overexpressed in Escherichia coli. (4/5543)
The cDNA of a 14-kDa trypsin inhibitor (TI) from corn was subcloned into an Escherichia coli overexpression vector. The overexpressed TI was purified based on its insolubility in urea and then refolded into the active form in vitro. This recombinant TI inhibited both conidium germination and hyphal growth of all nine plant pathogenic fungi studied, including Aspergillus flavus, Aspergillus parasiticus, and Fusarium moniliforme. The calculated 50% inhibitory concentration of TI for conidium germination ranged from 70 to more than 300 microgram/ml, and that for fungal growth ranged from 33 to 124 microgram/ml depending on the fungal species. It also inhibited A. flavus and F. moniliforme simultaneously when they were tested together. The results suggest that the corn 14-kDa TI may function in host resistance against a variety of fungal pathogens of crops. (+info)Natural occurrence of the C series of fumonisins in moldy corn. (5/5543)
We analyzed 44 moldy corn samples for the B and C series of fumonisins by high-performance liquid chromatography. Of the 44 samples, 32 (73%) were contaminated with both the B and C series of fumonisins and 6 were contaminated with only the B series of fumonisins. The incidence of fumonisin C1 in moldy corn was 71%; the incidence was 11% for fumonisin C3 and 43% for fumonisin C4. Their mean levels ranged from 500 to 1,900 ng/g. This is the first report on the natural occurrence of the C series of fumonisins and fumonisin B4 in moldy corn. (+info)Relationship between ruminal starch degradation and the physical characteristics of corn grain. (6/5543)
The objectives of this study were to determine the range of variation in the rate and extent of in situ ruminal starch degradation of 14 corns differing in vitreousness and to predict ruminal starch degradability by physical characteristics of corn grains. This study was conducted with eight dent and six flint corns. Ruminal starch degradability was determined by an in situ technique on 3-mm ground grains. Physical characteristics of corn grain were measured: hardness by grinding energy and particle size distribution, apparent and true densities, and specific surface area. Ruminal DM and starch degradabilities averaged 50 and 55.1% and varied from 39.7 to 71.5% and from 40.6 to 77.6%, respectively. Ruminal starch degradability averaged 61.9 and 46.2% in dent and flint types, respectively. The proportion of coarse particles (61.9 vs. 69.6% for dent and flint, respectively), the apparent density (1.29 vs. 1.36 g/cm3 for dent and flint, respectively), and the specific surface area (.13 vs. .07 m2/g for dent and flint, respectively) varied with the vitreousness. Ruminal starch degradability could be predicted accurately by vitreousness (r2 = .89) or by the combination of apparent density and 1,000-grain weight (R2 = .91), a measurement faster than the vitreousness determination. (+info)Growth phase-dependent subcellular localization of nitric oxide synthase in maize cells. (7/5543)
A protein band of approximately 166 kDa was detected in the soluble fraction of root tips and young leaves of maize seedlings, based on Western blot analysis using antibodies raised against mouse macrophage nitric oxide synthase (NOS) and rabbit brain NOS. NOS activity was present in these soluble fractions, as determined by L-[U-14C]citrulline synthesis from L[U-14]arginine. Immunofluorescence showed that the maize NOS protein is present in the cytosol of cells in the division zone and is translocated into the nucleus in cells in the elongation zone of maize root tips. These results indicate the existence of a NOS enzyme in maize tissues, with the localization of this protein depending on the phase of cell growth. (+info)Characterization of maize (Zea mays L.) Wee1 and its activity in developing endosperm. (8/5543)
We report the characterization of a maize Wee1 homologue and its expression in developing endosperm. Using a 0.8-kb cDNA from an expressed sequence tag project, we isolated a 1.6-kb cDNA (ZmWee1), which encodes a protein of 403 aa with a calculated molecular size of 45.6 kDa. The deduced amino acid sequence shows 50% identity to the protein kinase domain of human Wee1. Overexpression of ZmWee1 in Schizosaccharomyces pombe inhibited cell division and caused the cells to enlarge significantly. Recombinant ZmWee1 obtained from Escherichia coli is able to inhibit the activity of p13(suc1)-adsorbed cyclin-dependent kinase from maize. ZmWee1 is encoded by a single gene at a locus on the long arm of chromosome 4. RNA gel blots showed the ZmWee1 transcript is about 2.4 kb in length and that its abundance reaches a maximum 15 days after pollination in endosperm tissue. High levels of expression of ZmWee1 at this stage of endosperm development imply that ZmWee1 plays a role in endoreduplication. Our results show that control of cyclin-dependent kinase activity by Wee1 is conserved among eukaryotes, from fungi to animals and plants. (+info)
Inbred corn plant RQAB7 and seeds thereof
Replacement of Normal Maize with Quality Protein Maize on Performance, Immune Response and Carcass Characteristics of Broiler...
Feeding wet distillers grains plus solubles with and without a direct-fed microbial to determine performance, carcass...
Biochemical profile of leaf, silk and grain samples of eight maize landraces (Zea Mays L.) cultivated in two low-input...
Nitrogen Adaptation Strategy of the Wild Teosinte Ancestor of Modern Maize, Zea mays subsp. parviglumis
Biorepress of fumonisin B1 production and their phytotoxicity on growth and ultrastructures of Maize (Zea mays) Seedlings
Growing Sweet Corn in Missouri
Inheritance and expression of chimeric genes in the progeny of transgenic maize plants
Mean Performance of Normal and QPM Maize Genotypes for Yield and Tryptophan Content
Isolation and characterization of membranes from the cells of maize root tips | Journal of Cell Science
Method of removing the hull from corn kernels - Patent # 6592921 - PatentGenius
Sweet Corn, the Rock Star of the Garden | Agweb.com
The rough sheath2 gene negatively regulates homeobox gene expression during maize leaf development | Development
Levels of DNA methylation and transcript accumulation in leaves of transgenic maize varieties | Environmental Sciences Europe |...
Levels of DNA methylation and transcript accumulation in leaves of transgenic maize varieties | Environmental Sciences Europe |...
INBRED SWEET CORN LINE R373D - Patent application
Mycorrhizal impacts on root trait plasticity of six maize varieties along a phosphorus supply gradient<...
Relationship between properties of maize cell walls and in vitro fermentation characteristics<...
CHLOROPHYLL CONTENT OF APHID-INFESTED SEEDLING LEAVES OF FIFTEEN MAIZE GENOTYPES - Acta Biologica Cracoviensia s. Botanica - ...
Varietal Screening of Winter Maize Genotypes in - Diplomarbeiten24.de | Diplomarbeiten24.de
RNase P as a tool for disruption of gene expression in maize cells | Biochemical Journal
Ngoc Chi Dang, Ingrid Aulinger-Leipner, Ham Le Huy, Peter Stamp: Protein Quality Improved Waxy Maize Varieties for South East...
My Corn Plant Is Turning Yellow - Tips On Treating Yellowing Corn Plants
Four mutant alleles elucidate the role of the G2 protein in the development of C(4) and C(3) photosynthesizing maize tissues. -...
Inheritance of ear yield and its components in sweet corn (Zea mays L. saccharat)
Diversity Analysis of Elite Maize Inbred Lines Adapted to West and Cen by V. O. Adetimirin, I. Vroh-Bi et al.
Effect of Source and Processing on Maize Grain Quality and Nutritional Value for Broiler Chickens: 2. Milling Technique and...
Monsantos New Sweet Corn, Another Unregulated, Unlabeled Frankenfood - Greens N Grains Natural Foods Market & CafƩ
Line Ć Tester Analysis of Tropical High Land Maize (Zea mays L.) Inbred Lines Top Crossed with Three East African Maize...
Plants Profile for Zea mays parviglumis (corn)
Sustainability | Free Full-Text | Open-Pollinated vs. Hybrid Maize Cultivars | HTML
Diallelic analysis for lysine and oil contents in maize grains
[email protected]: Agrobacterium mediated transformation of sub tropical maize genotypes for resistance against stem borer...
PLOS Genetics: Maize Unstable factor for orange1 Is Required for Maintaining Silencing Associated with Paramutation at the...
Import and processing of genetically modified maize line 98140
The Physical Structure of a Corn Plant | Garden Guides
Genetic variability in maize and teosinte populations estimated by microsatellites markers
Muhammad Hany A.Tageldin|Publications: Linear and nonlinear-segmented models describing response of maize grain yield to...
Maize inbred PH25M1 - PIONEER HI-BRED INTERNATIONAL, INC.
Tar spot takes root as top corn plant disease - BSPP
Variability of some agronomic parameters of first generation of maize (zea mays l.) obtained by irradiating seeds to different...
The putative transposase of transposable element Ac from Zea mays L. interacts with subterminal sequences of Ac
The Molecular Evolution of terminal ear1, a Regulatory Gene in the Genus Zea | Genetics
Forage quality and composition measurements as predictors of ethanol yield from maize ( Zea mays L.) stover | Biotechnology for...
Sweet Corn IPM Newsletter No. 12 - September 11, 2017 | Cooperative Extension at Highmoor Farm | University of Maine
Homework Due 100410 - I HAVE USED THIS ASSIGNMENT IF YOU USE IT YOU WILL BE CAUGHT 1 Two pure breeding corn plants at 3 loci...
Corn Kernels, Half-Popped, Mr. Popular - Wegmans
Corn Kernels stock image. Image of biofuel, food, animal - 34438643
Feeling corn kernel stuck in throat under tonsil. What could this possibly be?
Ultrastructural characterization of maize (Zea mays L.) kernels exposed to high temperature during endosperm cell division -...
Maize
Zea mays var. saccharata and Zea mays var. rugosa Waxy corn: Zea mays var. ceratina Amylomaize: Zea mays Pod corn: Zea mays var ... Zea mays var. amylacea Popcorn: Zea mays var. everta Dent corn : Zea mays var. indentata Flint corn: Zea mays var. indurata ... Zea mays (maize) and Zea diploperennis, which is a perennial type of teosinte. The annual teosinte variety called Zea mays ... The term "teosinte" describes all species and subspecies in the genus Zea, excluding Zea mays ssp. mays.) It has evolved from a ...
Dent corn
The kernels vary from variety to variety, and what distinguishes Zea mays var. indentata from other varieties of Zea mays is ... Zea mays var. indentata, synonym Zea indentata Sturtev., was identified and published by American agronomist and botanist ... The flowers of Zea mays are monoecious and are born in separate parts of the plant. The female flower, or ear, is an ... The leaves of Zea mays alternate with broad, sword-shaped leaf blades, parallel veins with a prominent mid-rib, and small ...
Life zones of central Europe
Zea mays). Submontane zone, 700 - 1,000 m (East Alps), 300 - 450 m (Central German hills), European Beech (Fagus sylvatica), ...
List of life zones by region
Zea mays). Submontane zone, 700 - 1,000 m (Eastern Alps), 300 - 450 m (Central Uplands), European Beech (Fagus sylvatica), ...
Flour corn
... (Zea mays var. amylacea) is a variety of corn with a soft starchy endosperm and a thin pericarp. It is primarily ...
Southern New England Algonquian cuisine
Zea mays, maize or 'corn.' Traditionally variety grown by the Natives shown here. Cucurbita pepo, was domesticated into several ...
List of food plants native to the Americas
"USDA GRIN Taxonomy: Zea mays". Retrieved 2 January 2017. "USDA GRIN Taxonomy: Chenopodium quinoa". Retrieved 2 January 2017. " ... Corn (Zeaā ) Quinoa (Chenopodium) Several (though not all) species of amaranth (Amaranthus) Some species of wild rice (Zizania) ...
Flint corn
... (Zea mays var. indurata; also known as Indian corn or sometimes calico corn) is a variant of maize, the same species ... Popcorn (Zea mays everta, "corn turned inside out") is considered a variant of this type. It has a hard, slightly translucent ... With less soft starch than dent corn (Zea mays indentata), flint corn does not have the dents in each kernel from which dent ... Like the Linnaeus variant of maize, any kernel may contain the yellow pigment zeaxanthin but at more varying concentrations. ...
Sweet corn
... (Zea mays convar. saccharata var. rugosa; also called sweetcorn, sugar corn and pole corn) is a variety of maize ... If left to dry on the plant, kernels may be taken off the cob and cooked in oil where, unlike popcorn, they expand to about ...
List of U.S. state grasses
Zea mays. 1989[18] Wyoming Western wheatgrass. Agropyron smithii. 2007[19] See also[edit]. *Lists of U.S. state insignia ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Growing degree-day
Zea mays 800 to 2700 GDD to crop maturity Dry beans Phaseolus vulgaris 1100-1300 GDD to maturity depending on cultivar and soil ... GDDs may be calculated in either Celsius or Fahrenheit, though they must be converted appropriately; for every 9 GDDF there are ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
List of organisms by chromosome count
Zea mays) 20 [21] Cannabis. (Cannabis sativa) 20 Western clawed frog. (Xenopus tropicalis) 20 [33] ... Kondo, Katsuhiko (May 1969). "Chromosome Numbers of Carnivorous Plants". Bulletin of the Torrey Botanical Club. 96 (3): 322-328 ... While the cause for the disparate numbers is unknown, it may arise because of an XO sex determination mechanism, where males ( ... This is for common potato Solanum tuberosum (tetraploid, 2n = 4x = 48). Other cultivated potato species may be diploid (2n = 2x ...
Chilo pulverosellus
Adults are on wing from May to September. There are probably two or three generations per year. The larvae feed on Zea mays. ...
Diatraea lineolata
The larvae feed on Zea mays. "GlobIZ search". Global Information System on Pyraloidea. Retrieved 2014-07-15. CS1 maint: ...
Rheintaler Ribelmais
Zea mays L. ssp. mays) assessed with individuals and bulks on agarose gels". Genetic Resources and Crop Evolution. 55 (7): 971- ... Zea mays L. ssp. mays) landraces". Genetic Resources and Crop Evolution. 57 (1): 71-84. doi:10.1007/s10722-009-9452-0. hdl: ... Freitag, N; Schneider, D:, Mir, C; Stamp, P; Hund, A; Messmer, R (2012). "Swiss maize (Zea mays L) landraces. Their genetic ... Zea mays L.) in contrasting environments". Doectoral Dissertation, ETH Zurich. Schilperoord, Peer (2014). "Le maïs". Verein für ...
Gene density
... mays/latest_assembly_versions/GCF_902167145.1_Zm-B73-REFERENCE-NAM-5.0". ftp.ncbi.nih.gov. Retrieved 2020-12-01. "Zea mays (ID ...
Pseudobissetia terrestrellus
The larvae feed on Zea mays. Nuss, M.; et al. (2003-2017). "GlobIZ search". Global Information System on Pyraloidea. Retrieved ...
Category:Cuisine of the Northeastern United States
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... Zea mays saccharata. Retrieved from "https://en.wikipedia.org/w/index.php?title=Category:Cuisine_of_the_Northeastern_United_ ...
Popcorn
Some strains of corn (taxonomized as Zea mays) are cultivated specifically as popping corns. The Zea mays variety everta, a ... Though the kernels of some wild types will pop, the cultivated strain is Zea mays everta, which is a special kind of flint corn ... While the kernels may come in a variety of colors, the popped corn is always off-yellow or white as it is only the hull (or ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Stenocarpella maydis
and D. zeae (Schwein.) LƩv.) is a plant pathogenic fungus and causal organism of diplodia ear and stalk rot. Corn (Zea mays) ... Earworm (Helicoverpa zea) damage at the ear shank is often associated with the disease. Diplodia rot is most severe for mono ... Some isolates may cause premature germination of the corn kernels. In stalk infections, injury to the vascular system disrupts ... Further, some animals may reject contaminated corn-based feed. Stenocarpella rot has the potential to affect distillers dried ...
Alpenus pardalina
The larvae feed on Zea mays (corn). Savela, Markku. "Alpenus pardalina (Rothschild, 1910)". Lepidoptera and Some Other Life ...
Ailanthus altissima
Sugar Snap) and maize (Zea mays cv. Silver Queen). It proved able to kill nearly 100% of seedlings with the exception of ... The plant may be mildly toxic. The noxious odours have been associated with nausea and headaches, and with contact dermatitis ... The fruits grow in clusters; a fruit cluster may contain hundreds of seeds. The seeds borne on the female trees are 5 mm in ... Heisy, Rod M. (May 1990). "Allelopathic and Herbicidal Effects of Extracts from Tree of Heaven". American Journal of Botany. 77 ...
Rottboellia cochinchinensis
Interference between Rottboellia cochinchinensis and Zea mays. Weed Science Society of America. 48(2), 205-211. Spaunhorst, D. ... The eliastome (callus knob) which is disseminated with the caryopsis, contains oils which may attract ants and aid dispersal. ... Zea), upland rice (Oryza), cotton (Gossypium), soy (Glycine), Sorghum and peanuts (Arachis). Asian countries such as India do ... with Rottboellia forming a sister clade to Zea. Clayton and Renvoize also recognised a subtribe Rottboelliinae which included ...
List of plants of Burkina Faso
Timler Zea mays L. Zehneria capillacea (Schumach.) C.Jeffrey Zehneria hallii C.Jeffrey Zehneria scabra (L.f.) Sond. Zehneria ...
Corn cyst nematode
The corn cyst nematode (CCN) Heterodera zeae is a plant parasitic nematode that feeds on corn Zea mays. The CCN has a limited ... Krusberg, L. R.; S. Sardanelli; A. P. Grybauskas (1997). "Damage potential of Heterodera zeae to Zea mays as affected by ... Hashmi, S.; L. R. Krusberg; R. N. Huettel (1993). "Resistance in Zea mays to Heterodera zeae". Journal of Nematology. 25: 820- ... It has been reported that temperature may influence the susceptibility of poor host plants to infection by H.zeae. At 15 and 23 ...
Gene mapping
"Genetic Mapping Fact Sheet". Gallvetti, Andrea; Whipple, Clinton J. (2015). "Positional cloning in maize (Zea mays subsp. mays ...
Paul Weatherwax (botanist)
He married Anna May Stanton in June 1916. They had several children. "Morphology of the flowers of Zea mays". Bulletin of the ... "The endosperm of Zea and Coix". American Journal of Botany. 17 (5): 371-380. May 1930. doi:10.2307/2435927. "Presidential ... "The development of the spikelets of Zea mays". Bulletin of the Torrey Botanical Club. 44 (10): 483-496. 1917. "The popping of ... Anna May Stanton Weatherwax at Find a Grave "Book Review of The Story of the Maize Plant". Nature. 112 (2817): 616-617. 1923. ...
Pyridine
Tarr, J. B.; Arditti, J. (1982). "Niacin Biosynthesis in Seedlings of Zea mays". Plant Physiology. 69 (3): 553-556. doi:10.1104 ... They may progress into abdominal pain, pulmonary congestion and unconsciousness. One person died after accidental ingestion of ... For comparison, indoor air contaminated with tobacco smoke may contain up to 16 µgĀ·mā3 of pyridine, and one cigarette contains ... 11 May 2010. Archived from the original on 20 September 2018. Retrieved 7 January 2011. "About Vertellus". vertellus.com. ...
Hyperaccumulateur - WikipƩdia
Zea Mays. Maïs doux. Cs. accumule le Césium dans les racines.. [16] ... 15] Mark P. de Souza, Dara Chu, May Zhao, Adel M. Zayed, Steven E. Ruzin, Denise Schichnes, et Norman Terry,": Rhizosphere ...
Genetically modified tomato
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... Heliothis zea), the tomato pinworm (Keiferia lycopersicella) and the tomato fruit borer (Helicoverpa armigera).[23][24] A 91- ... Other projects aim to enrich tomatoes with substances that may offer health benefits or be more nutritious. As well as aiming ... the researchers hope genetic engineering of the tomato may decrease wastage.[14] ...
GenBank
Zea mays 5.062731057Ć10. ^. 9 Sus scrofa 4.88786186Ć10. ^. 9 Danio rerio 3.120857462Ć10. ^. 9 ... However, some submitters may claim patent, copyright, or other intellectual property rights in all or a portion of the data ... Public databases which may be searched using the National Center for Biotechnology Information Basic Local Alignment Search ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Archaea
Chelius MK; Triplett EW (April 2001). "The Diversity of Archaea and Bacteria in Association with the Roots of Zea mays L". ... Zimmer, Carl (May 6, 2015). "Under the Sea, a Missing Link in the Evolution of Complex Cells". New York Times. Retrieved May 6, ... Plasmids may be transferred between cells by physical contact, in a process that may be similar to bacterial conjugation.[132][ ... These compounds differ in structure from bacterial antibiotics, so they may have novel modes of action. In addition, they may ...
Arqueas, a enciclopedia libre
Chelius MK, Triplett EW (2001). "The Diversity of Archaea and Bacteria in Association with the Roots of Zea mays L". Microb. ...
Cultigen
Examples are Cucurbita maxima, Phaseolus vulgaris, Zea mays.. Recent usage in horticulture has, however, maintained a ... having affinities with) or may remain unnamed. Its cultigenic origin may or may not be recognised by the allocation of a ... Zea mays) and banana (Musa acuminata), are so named. Although it is perfectly in order to give a cultigen a botanical name, in ... The genetic material of a cultigen may become part of the gene pool of a population where, over time, it may be largely or ...
Zea mays - Vicipaedia
Zea mays (binomen a Linnaeo anno 1753 statutum), Latinitate communi zea[1] seu maizium[2] (Hispanice maĆz, a lingua Taino mahiz ... Yongxian Lu et al., "A pistil-expressed pectin methylesterase confers cross-incompatibility between strains of Zea mays" in ... D. R. Piperno, K. V. Flannery, "The earliest archaeological maize (Zea mays L.) from highland Mexico: New accelerator mass ... "Zea mays" apud Plants for a Future ⢠Plantes d'Afrique ⢠Flora of China ⢠INPN France ⢠USDA Plants Database ...
Maiz
Ar maiz (Zea mays) a zo un ed, an hini gounezet ar muiaƱ er bed. Gounezet e vez evit bevaƱ an dud met ivez evel boued chatal. ...
Maize
... (Zea mays), kent as (Indian) corn an aw, is a herbaceous plant domesticatit in Mesoamericae that syne spreid athort the ...
Teosinte - Simple English Wikipedia, the free encyclopedia
There are five recognized species of teosinte: Zea diploperennis, Zea perennis, Zea luxurians, Zea nicaraguensis and Zea mays. ... Z. mays ssp. huehuetenangensis. Z. mays ssp. mays (maize). Z. mays ssp. mexicana. Z. mays ssp. parviglumis. Z. nicaraguensis. Z ... The teosintes are a group of large grasses of the genus Zea found in Mexico, Guatemala and Nicaragua. ... Text is available under the Creative Commons Attribution/Share-Alike License and the GFDL; additional terms may apply. See ...
Estorial - Güiquipeya
22 May 2012. *. TjBot. r2.7.2) (Robó Añiiu: zea:Jeruzalem. c. 17:17 ...
Category:User zea-3
Pages in category "User zea-3". The following 3 pages are in this category, out of 3 total. This list may not reflect recent ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... Retrieved from "https://en.wikipedia.org/w/index.php?title=Category:User_zea-3&oldid=548099645" ...
ą“§ą“¾ą“Øąµą“Æą“µą“æą“³ą“ąµ¾ - ą“µą“æą“ąµą“ą“æą“Ŗąµą“”ą“æą“Æ
ą“øą“æą“Æą“¾ ą“®ąµą“Æąµą“øąµ (Zea mays) ą“ą“Øąµą“Ø ą“¶ą“¾ą“øąµą“¤ąµą“°ą“Øą“¾ą“®ą“¤ąµą“¤ą“æąµ½ ą“
ą“±ą“æą“Æą“Ŗąµą“Ŗąµą“ąµą“Øąµą“Øąµ. ą“ą“Øąµą“¤ąµą“Æą“Æą“æąµ½ ą“ą“¤ąµą“¤ąµ¼ą“Ŗąµą“°ą“¦ąµą“¶ąµ, ą“°ą“¾ą“ą“øąµą“„ą“¾ąµ», ą“Ŗą“ąµą“ą“¾ą“¬ąµ, ą“¬ą“æą“¹ą“¾ąµ¼ ą“¤ąµą“ą“ąµą“ą“æą“Æ ... ą“®ą“£ą“æą“ąµą“ąµą“³ą“ (Andropogon sorgum), ą“®ą“ąµą“ą“ąµą“ąµą“³ą“ (Zea maize), ą“¬ą“ąµą“± (Pennisettum typhoideum), ą“¤ą“æą“Ø (Setaria italica), ą“Ŗą“Øą“æą“µą“°ą“ąµ (Panicum ...
Listaan dagiti botaniko babaen ti pangyababaan ti mannurat (W-Z), ti nawaya nga ensiklopedia
Zea - Francisco Antonio Zea (1770-1822). *Zeile - Elsie May Zeile (1870-1940) ...
Misri
... apo Kallamoci (Zea mays L), ƫshtƫ njƫ drith i zbutur nga njerƫzit vendas nƫ Mesoamerica nƫ kohƫt parahistorike.Misri ...
Historial d'a pachina - Biquipedia, a enciclopedia libre
19 may 2015. *. Dexbot. Removing Link FA template (handled by wikidata). m. 17:49 ...
Botero
If an internal link intending to refer to a specific person led you to this page, you may wish to change that link by adding ... Fernando Botero Zea (born 1956), Colombian politician. *Giovanni Botero (c. 1544-1617), Italian thinker, priest, poet, and ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Panathenaic Stadium
Papadimitriou, Lena (24 May 1998). "10 Ļοκ ĻĻ
ναĻ
Ī»ĪÆĪµĻ ĻĪæĻ
Γεν θα ξεĻάĻĪæĻ
με [10 rock concerts that we will not forget]". To Vima ... 17 May 2012. The Olympic flame is due to be handed over from Greece to London this afternoon at the Panathenaic Stadium in ... It may thus be argued that the Panathenaic Stadium of Herodes Atticus, who was both Athens' leading son and a Roman consul, ... staged their first Intercalated Games, held once again at the Panathenaic Stadium in Athens, from April 22 to May 2, 1906.. ...
Mycotoxicology
Fumonisin B (1)-nonproducing strains of Fusarium verticillioides cause maize (Zea mays) ear infection and ear rot. J. Agric. ... Unsourced material may be challenged and removed. (September 2012) (Learn how and when to remove this template message) ... teleomorph Gibberella zeae) was given the trivial name zearalenone as a combination of G. zeae, resorcylic acid lactone, -ene ( ...
Cochliobolus miyabeanus
... and Zea mays (maize).[2][3]. Cochliobolus miyabeanus may cause a wide range of symptoms. General symptoms occurring on the ... 3. Nutrition level[5] - Nutrition of the host plant may also influence level of disease development. For example, soil ...
Genetics
"A Correlation of Cytological and Genetical Crossing-Over in Zea Mays". Proc Natl Acad Sci USA. 17.. ... Archived from the original on 16 May 2008.. *^ Bateson W (1907). "The Progress of Genetic Research". In Wilks, W (ed.). Report ... May 2015). "CRISPR/Cas9-mediated gene editing in human tripronuclear zygotes". Protein & Cell. 6 (5): 363-372. doi:10.1007/ ... Pearson H (May 2006). "Genetics: what is a gene?". Nature. 441 (7092): 398-401. Bibcode:2006Natur.441..398P. doi:10.1038/ ...
Insect
Retrieved 12 May 2009.. *^ a b c d e f g h i j k l m n o p q r s t u v w x y z Gullan, P.J.; Cranston, P.S. (2005). The Insects ... Heliothis zea". Journal of Insect Physiology. 15 (6): 989-1001. doi:10.1016/0022-1910(69)90139-5.. ... Retrieved 3 May 2009.. *^ a b c d e f Resh, Vincent H.; Ring T. Carde (2009). Encyclopedia of Insects (2 ed.). U. S. A.: ... Maierbrugger, Arno (14 May 2013). "UN: Insects are 'food of the future' (video)". Inside Investor. Retrieved 17 May 2013.. ...
ą¦¹ą§ą¦®ą§ą¦²ą§ą¦ą¦¾ą¦ø ą¦°ą¦æą¦ą¦®ą§ą¦¬ą¦æą¦Øą§ą¦¶ą¦Ø - ą¦ą¦ą¦ą¦æą¦Ŗą¦æą¦”িয়া
"A Correlation of Cytological and Genetical Crossing-Over in Zea Mays"ą„¤ Proceedings of the National Academy of Sciences of the ...
Oscar za najbolju scenografiju
Kristi Zea, Debra Schutt - Put osloboÄenja 2009. Rick Carter, Robert Stromberg, Kim Sinclair - Avatar Dave Warren, Anastasia ... Eugenio Zanetti; Cindy Carr - What Dreams May Come 1999. Rick Heinrichs, Peter Young. - Sanjiva dolina Luciana Arrighi, Ian ...
Pipe organ
If the regulation is wrongly set, the keys may be at different heights, some pipes may sound when the keys are not pressed (a " ... Adlung, Jacob (1768). Musica mechanica organoedi. English translation, Q. Faulkner, trans (2011). Lincoln, NE: Zea E-Books. ... The smallest portable pipe organs may have only one or two dozen pipes and one manual; the largest may have over 33,000 pipes ... For example, without unification, three stops may use 183 pipes. With unification three stops may borrow one extended rank of ...
Live: In Paradise
Unsourced material may be challenged and removed.. Find sources: "Live: In Paradise" - news Ā· newspapers Ā· books Ā· scholar Ā· ... Zea Barker - co-editor. *Christopher Lydon - Master of Ceremonies. *Noah Blumenson-Cook - Production Coordinator ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ...
Anthocoridae
Orius insidiosus, the "insidious flower bug", for example, feeds on the eggs of the corn earworm (Helicoverpa zea). Orius ... Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, ... This page was last edited on 28 May 2021, at 22:34 (UTC). ...
Popcorn
Some strains of corn (taxonomized as Zea mays) are cultivated specifically as popping corns. The Zea mays variety everta, a ... Though the kernels of some wild types will pop, the cultivated strain is Zea mays everta, which is a special kind of flint corn ... Grimes, William (1 May 1994). "How About Some Popcorn With Your Fat". The New York Times. Retrieved 20 January 2010.. ... Retrieved 8 May 2019. As it turns out, the corn that we typically eat is different than the kernels that become popcorn.. ...
Pollination bags
Polyethylene versus glassine shoot bags in pollination of corn (Zea mays L.). Crop Sci., 8(1): 126-128. doi:10.2135/ ... Pollination bags may be 2D or 3D. The 3D bags have a gusset for expansion to avoid contact between the plant and the bag. ... Such bags may not suit to the needs of plant breeders of different crops. Some companies such as PBS International UK, Del Star ... It may have transparent hard plastic or bread type soft bags. Polyethylene nylon type when flash spun is strong and used as ...
TPA: Zea mays chromosome 2 - Nucleotide - NCBI
ZEA MAYS (CORN) || Skin DeepĀ® Cosmetics Database | EWG
Embryos of Maize (Zea mays) | SpringerLink
Peroxidase - Zea mays (Maize)
Zea mays (Maize)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a ... tr,B4G1S4,B4G1S4_MAIZE Peroxidase OS=Zea mays OX=4577 PE=2 SV=1 MATSSGSCLIISLLVVVVAAALSASTASAQLSSTFYDTSCPSAMSTISSGVNSAVAQQAR ... You are using a version of browser that may not display all the features of this website. Please consider upgrading your ... However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is ...
Polygalacturonase - Zea mays (Maize)
tr,Q41837,Q41837_MAIZE Polygalacturonase (Fragment) OS=Zea mays OX=4577 PE=3 SV=1 ... You are using a version of browser that may not display all the features of this website. Please consider upgrading your ... Entry version 80 (08 May 2019). Sequence version 1 (01 Nov 1996). Previous versions , rss ... However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is ...
Zea mays L. ssp. parviglumis Iltis & Doebley corn - Redorbit
Zea mays - Wikispecies
... mays Zea mays. Published on the internet. Accessed 2013 Dec. 2.. *Tropicos.org 2013. Zea mays . Missouri Botanical Garden. ... Genus: Zea Species: Z. mays Subspecies: Z. m. subsp. mays - Z. m. subsp. huehuetenangensis - Z. m. subsp. parviglumis ... Mays zea Gaertn., Fruct. Sem. Pl. 1: 6 (1788), nom. superfl.. *Zea segetalis Salisb., Prodr. Stirp. Chap. Allerton: 28 (1796), ... Zea mays in World Checklist of Selected Plant Families. The Board of Trustees of the Royal Botanic Gardens, Kew. Published on ...
ZEA MAYS (CORN) KERNEL MEAL || Skin DeepĀ® Cosmetics Database | EWG
About ZEA MAYS (CORN) KERNEL MEAL: Zea Mays (Corn) Kernel Meal is a coarse flour prepared by milling the kernels of Zea mays.. ... Synonym(s): CORN GLUTENS; CORN KERNEL MEAL; CORN MEAL; GLUTENS, CORN; ZEA MAYS KERNEL MEAL ... Show all 30 recent products that contain ZEA MAYS (CORN) KERNEL MEAL.. ... 22,413 studies in PubMed science library may include information on the toxicity of this chemical see search results -,. NLM ...
Zea mays subsp. mexicana cultivar:TEO (ID 299874) - BioProject - NCBI
Zea mays subsp. mexicana cultivar:TEO Zea mays subsp. mexicana cultivar:TEO. Zea mays subsp. mexicana cultivar:TEO Genome ... Zea mays subsp. mexicana cultivar:TEO. Zea mays subsp. mexicana cultivar:TEO Genome sequencing. ... Zea; Zea mays; Zea mays subsp. mexicana ... Yang N et al., "Contributions of Zea mays subspecies mexicana ... Zea mays subsp. mexicana[Taxonomy ID: 4579]. Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; ...
Corn (Zea Mays L.)
... Other English names: Indian Corn, Maize.. Botanical description: Corn is one of the tallest and most ... This might either mean that wild corn was extinct before botanists could make a record of it, or that it is a plant so ... Though this is not conclusive proof, it is evidence that corn may have developed from Teosinte, for in all other known cases ... Possibly the husks surrounding the kernels are abnormal and might be found in any of the main groups. This opinion is supported ...
Zea mays - Vicipaedia
Zea mays. L. Zea mays (binomen a Linnaeo anno 1753 statutum), Latinitate communi zea[1] seu maizium[2] (Hispanice maĆz, a ... E granis Zeae mays varietatis evertae maizium inflatum praeparatur. Notae[recensere , fontem recensere]. *ā "Unicum zeae granum ... Yongxian Lu et al., "A pistil-expressed pectin methylesterase confers cross-incompatibility between strains of Zea mays" in ... D. R. Piperno, K. V. Flannery, "The earliest archaeological maize (Zea mays L.) from highland Mexico: New accelerator mass ...
Zea mays Sweet Corn, Corn PFAF Plant Database
Zea mays is a ANNUAL growing to 2 m (6ft 7in) at a fast rate. It is hardy to zone (UK) 3 and is frost tender. It is in flower ... Zea mays is a ANNUAL growing to 2 m (6ft 7in) at a fast rate.. It is hardy to zone (UK) 3 and is frost tender. It is in flower ... Please note that a plant may be invasive in one area but may not in your area so its worth checking. ... Sun May 31 2009 Nature Abhors a Garden Nature abhors a Garden for 11/30/08 discusses how Native Americans and Spaniards ...
Sweet Corn Zea mays 'Red Midget'
Popcorn Zea mays 'Robust Ruby Red'
Zea mays Genome DB
Zea mays clone ZMMBBc_448F14, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces. 4689483. AC007410. N7F12. 30650. Zea mays clone ... Zea mays clone ZMMBBc0387C14, *** SEQUENCING IN PROGRESS ***. 48374983. AY542798. Z477F24. 209336. 1. Zea mays chromosome 1 ... Zea mays clone ZMMBBc0088M21, *** SEQUENCING IN PROGRESS ***. 58531566. AC149476. ZMMBBb0316C08. 121514. Zea mays clone ... Zea mays clone ZMMBBb0355N05, *** SEQUENCING IN PROGRESS ***. 51315580. AC146975. ZMMBBb0357I20. 139209. Zea mays clone ...
KEGG PATHWAY: Glycolysis / Gluconeogenesis - Zea mays (maize)
Tropicos | Name - Zea mays L.
Zea mays var. saccharata (Sturtev.) L.H. Bailey * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of ... Zea mays var. pennsylvanica Bonaf. * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of Agriculture, ... Zea mays var. precox Torr. * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of Agriculture, ... Zea mays var. virginica Bonaf. * Hitchcock, A. S. 1951. Man. Grasses U.S. (ed. 2) 1-1051. U.S. Department of Agriculture, ...
Reply To: Zea Mays - Blue Jade sold out?
Were you able to grow out additional zea mays seed stock in the 2015 growing season? ... Zea Mays - Blue Jade sold out?. Created by Jantz-Koprivnik, Kathleen on November 29, 2015 at 11:13 am ... Garden Supply , Organic Fertilizer , Composting , Indoor Gardening āŗ Forums āŗ Ask A Gardener āŗ Zea Mays - Blue Jade sold out? ... Were you able to grow out additional zea mays seed stock in the 2015 growing season? ...
KEGG PATHWAY: Photosynthesis - antenna proteins - Zea mays (maize)
Zea mays in Flora of Pakistan @ efloras.org
Zea mays in Dinghushan Plant Checklist1 @ efloras.org
The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays | Genetics
The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays. Tadas Panavas, Jessica Weir and Elsbeth L. Walker ... The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays. Tadas Panavas, Jessica Weir and Elsbeth L. Walker ... The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays. Tadas Panavas, Jessica Weir and Elsbeth L. Walker ... The Structure and Paramutagenicity of the R-marbled Haplotype of Zea mays ...
Zea mays ( Mohave Corn ) | Backyard Gardener
For organic fertilizers such as fish emulsion, follow label directions as they may vary per product. Light. Conditions : Light ... The western side of a house may even be shady due to shadows cast by large trees or a structure from an adjacent property. If ... If a shade loving plant is exposed to direct sun, it may wilt and/or cause leaves to be sunburned or otherwise damaged. ... Right plant, right place! Plants which do not receive sufficient light may become pale in color, have fewer leaves and a "leggy ...
Radar - {MP3 ZIP} Download Harrobian by Zea mays - Wattpad
Download Harrobian by Zea mays from the story Radar by babroot1980 with 2 reads. man, pendulum, money. Simple Way to Listen / ... Tags: Harrobian by Zea mays mp3, Harrobian by Zea mays album, Harrobian by Zea mays flac, Harrobian by Zea mays torrent, listen ... Harrobian by Zea mays album.. zip Harrobian by Zea mays album.. BEST! Harrobian by Zea mays Rar.. Best Harrobian by Zea mays ... get Harrobian by Zea mays zip, download Harrobian by Zea mays, Harrobian by Zea mays album mp3, zip album Harrobian by Zea mays ...
Visiting | Zea Mays Printmaking
Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.) | PNAS
Zea mays ssp. mays L.) and Its Wild Ancestor (Zea mays ssp. parviglumis) ... Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.). Maud I. Tenaillon, Mark C. Sawkins, ... We measured sequence diversity in 21 loci distributed along chromosome 1 of maize (Zea mays ssp. mays L.). For each locus, we ... Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.) ...
Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction | Genetics
2013 Genetic diversity analysis of elite European maize (Zea mays L.) inbred lines using AFLP, SSR, and SNP markers reveals ... Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction. Christina Lehermeier, Nicole KrƤmer ... Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction. Christina Lehermeier, Nicole KrƤmer ... Usefulness of Multiparental Populations of Maize (Zea mays L.) for Genome-Based Prediction. Christina Lehermeier, Nicole KrƤmer ...
Plants Profile for Zea mays parviglumis (corn)
Zea mays legal definition of Zea mays
What is Zea mays? Meaning of Zea mays as a legal term. What does Zea mays mean in law? ... Definition of Zea mays in the Legal Dictionary - by Free online English dictionary and encyclopedia. ... Zea mays legal definition of Zea mays https://legal-dictionary.thefreedictionary.com/Zea+mays ... tubular handling; Natriuresis; Glomerular function; Proximal tubule function; Zea mays Linne. Zea mays L. extracts modify ...
MaizeSWEET CORNSpeciesGenesGeneticallyGenomeGenotype1753CropGrownAbstractExtractSeedlingsPrintmakingProteinsPlantsBinomenDroughtMaiziumCorn silkYieldGerminationAnthocyaninsSoilGardenerSynonymGramineaeBiosynthesisGeneGlufosinateGlycinePhysiologicalVarietiesGenomesCharacterizationGrowthTriticumAmericanaPopulationsTainoCommonlyAlternate
Maize39
- Reinert J., Yeoman M.M. (1982) Embryos of Maize (Zea mays) . (springer.com)
- Paramutation generates heritable changes affecting regulation of specific alleles found at several Zea mays (maize) loci that encode transcriptional regulators of anthocyanin biosynthetic genes. (genetics.org)
- Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. (pnas.org)
- We measured sequence diversity in 21 loci distributed along chromosome 1 of maize ( Zea mays ssp. (pnas.org)
- Here's a one-point source to tap to find everything there is to know about maize--that is, Zea mays ssp. (thefreedictionary.com)
- Under these condition, yields of staplecrop plants like bread wheat (Triticum aestivum), rice (Oriza sativa), and maize (Zea mays), which provide over 50% of human calories, are predicted to decrease [4]. (scirp.org)
- Transcriptome Analysis of Cadmium-Treated Roots in Maize (Zea mays L. (frontiersin.org)
- Electrophoretic profiles of storage proteins in selected maize (Zea mays L.) genotypes', Journal of Central European Agriculture , 20(3), pp. 911-918. (srce.hr)
- A. Å palekova, E. Gregova and Z. Galova, "Electrophoretic profiles of storage proteins in selected maize (Zea mays L.) genotypes", Journal of Central European Agriculture , vol.20, no. 3, pp. 911-918, 2019. (srce.hr)
- Maize (Zea mays L.) is important cereal and its diversity research is essential from the point of breeding strategy. (srce.hr)
- Accelerator mass spectrometry age determinations of maize cobs ( Zea mays L.) from GuilĆ” Naquitz Cave in Oaxaca, Mexico, produced dates of 5,400 carbon-14 years before the present (about 6,250 calendar years ago), making those cobs the oldest in the Americas. (pnas.org)
- Maize ( Zea mays L.) is the New World's preeminent grain crop, was widely grown at the time of the European contact in both hemispheres, and was a staple food of many prehistoric societies. (pnas.org)
- Many investigators are convinced by the considerable amount of molecular, cytological, and isozyme data accumulated on the ancestry of maize, which indicates that maize is probably descended from an annual species of teosinte ( Zea mays ssp. (pnas.org)
- It is still unknown when the first efforts to cultivate a wild Zea leading to the domestication of maize occurred. (pnas.org)
- Maize ( zea mays )-commonly known as corn-often evokes nostalgic visions of pastoral landscapes. (harvard.edu)
- This Decision Document has been prepared to explain the regulatory decision reached under the guidelines Dir94-08 Assessment Criteria for Determining Environmental Safety of Plants with Novel Traits and its companion document Dir94-11 The Biology of Zea mays L. (Corn/Maize) and the guidelines Dir95-03 Guidelines for the Assessment of Livestock Feed from Plants with Novel Traits. (gc.ca)
- Linkage map construction and quantitative trait loci (QTL) mapping using intermated vs. selfed recombinant inbred maize line (Zea mays L. (bioone.org)
- These represent new genes involved in iron acquisition by maize, and future cloning of these genes may reveal novel aspects of the grass iron acquisition mechanism. (frontiersin.org)
- and identification of additional components of the maize iron homeostatic apparatus may help to elucidate the genes underlying such QTL. (frontiersin.org)
- To investigate the roles of different Ca genes in maize ( Zea mays ), we examined stomatal responses in ca1 and ca2 single mutants as well as a ca1ca2 double mutant. (plantphysiol.org)
- Efficacy of natural aluminosilicates in moderating drought effects on the morphological and physiological parameters of maize plants (Zea mays L. (scielo.cl)
- M.J. (2009) Maize (Zea mays) A Model Organism for Basic and Applied Research in Plant Biology. (scirp.org)
- Effect of Potassium Deficiency on Root Growth and Nutrient Uptake in Maize (Zea mays L. (scirp.org)
- Influence of Air Temperature on the Stability of Cytoplasmic Male Sterility (CMS) in Maize (Zea mays L. (agbioforum.org)
- Maize (Zea mays) is a globally produced crop with broad genetic and phenotypic variation. (nih.gov)
- We show how MAGIC maize may find strong candidate genes by incorporating genome sequencing and transcriptomics data. (nih.gov)
- Power simulations show that subsets of MAGIC maize might achieve high-power and high-definition QTL mapping. (nih.gov)
- Regulation of flower development in cultured ears of maize ( Zea mays L. (springer.com)
- Bommineni VR (1988) Regulation of flower development in cultured inflorescences of maize ( Zea mays L.). PhD thesis, The University of Western Ontario, London, Ontario, Canada. (springer.com)
- Cultivars included the genetically modified maize ( Zea mays ), with the pat -gene conferring resistance to the herbicide glufosinate (synonym: L-phosphinothricin), and the hybrid, conventional maize. (scielo.org.ar)
- A green house study was conducted between July and August, 2009 to test and determine the drought tolerance levels of ten maize ( Zea mays L.) genotypes. (academicjournals.org)
- A large fraction of the transcripts of the Bronze-2 ( Bz2 ) gene of maize ( Zea mays L.) are unspliced in purple husk tissues. (plantphysiol.org)
- Genome wide association study and genomic prediction for stover quality traits in tropical maize (Zea mays L. (cgiar.org)
- In the tribe Maydeae (family Gramineae), maize ( Zea mays ssp. (g3journal.org)
- Maize can be crossed with all teosinte species, including Z . mays ssp. (g3journal.org)
- Genotype by tillage interactions in maize (Zea mays L. (iastate.edu)
- However, no studies have been reported in which large numbers of unselected genotypes were grown in no-till and conventional tillage to examine the effect of tillage systems upon selection of maize (Zea mays L.) genotypes;In this study, three sources of maize genotypes were evaluated in two tillage systems. (iastate.edu)
- Monitoring Maize ( Zea mays L.) Phenology with Remote Sensing" by AndrƩs ViƱa, Anatoly A. Gitelson et al. (unl.edu)
- The objective of this paper is to remotely evaluate the phenological development of maize ( Zea mays L.) in terms of both biomass accumulation and reproductive organ appearance. (unl.edu)
SWEET CORN3
- ABSTRACT: The study was conducted to evaluate the growth and yield performance of sweet corn (Zea mays L.) intercropped with sweet potato (Ipomoea batatas L.) and applied with mushroom spent, rice ash as organic fertilizer, and inorganic or commercial fertilizer. (thefreelibrary.com)
- Sweet corn may be divided into three distinct types according to genetic background: normal sugary (SU), sugary enhancer (SE) and supersweet (Sh2). (illinois.edu)
- A glasshouse study was conducted to investigate the growth response of sweet corn ( Zea mays ) to mycorrhizal fungi inoculation over different plant ages (2, 4, 6, 8 and 10 weeks) and to determine the interaction between the host and mycorrhizal fungus on mycorrhizal development, using soil substrate as inoculum for Glomus mosseae . (scialert.net)
Species1
- Though this is not conclusive proof, it is evidence that corn may have developed from Teosinte, for in all other known cases hybrids between distinct grass species are sterile. (chestofbooks.com)
Genes1
- EST generation and analyses towards identifying female gametophyte-specific genes in Zea mays L. (springer.com)
Genetically2
- DeKalb Genetics Corporation (DeKalb, IL) has patented a method for the production of stable, genetically transformed, Zea mays plants that comprise an exogenous DNA expressing phosphinothricin acetyl transferase to impart resistance to phosphinothricin in said plants. (thefreedictionary.com)
- The varieties may also be called genetically modified organisms (GMO). (cosmeticsinfo.org)
Genome2
- Help annotate the Zea mays genome using our yrGATE gene structure annotation tool ( see Overview ), aided by GAEVAL tables that flag problematic gene models. (plantgdb.org)
- A trispecific hybrid, MTP (hereafter called tripsazea), was developed from intergeneric crosses involving tetraploid Zea mays (2 n = 4 x = 40, genome: MMMM), tetraploid Tripsacum dactyloides (2 n = 4 x = 72, TTTT), and tetraploid Z . perennis (2 n = 4 x = 40, PPPP). (g3journal.org)
Genotype1
- Protoplasts which regenerate reproducibly in a short time to normal, fertile plants can be regenerated from an auxin-autotrophic genotype of Zea mays (L.). Starting from immature embryos on hormone-free media, an auxin-autotrophic, embryogenic callus is formed on the shoot basis of the seedlings, which. (google.com)
17531
- Zea mays ( binomen a Linnaeo anno 1753 statutum), Latinitate communi zea [1] seu maizium [2] ( Hispanice maĆz, a lingua Taino mahiz ), est gramen familiae Poacearum , frumentum ab Indis in Mexico australi temporibus praehistoricis , abhinc annorum 10 000 fere, primum excultum. (wikipedia.org)
Crop2
- While corn might have had its genesis as a versatile crop, the last few centuries reveal a more influential agent. (harvard.edu)
- For example, you may wish to select Sundance (69 days) for the first early variety, Tuxedo (75 days) for the second early variety and Incredible (83 days) for the main-crop variety. (illinois.edu)
Grown3
- Effect of water stress on gas exchange of field grown zea mays l. (thefreedictionary.com)
- Zea mays L. is one of the world's most important and widely grown crops and is susceptible to a wide range of plant pathogens. (umsystem.edu)
- More commonly grown to a height of 2-3 meters (6-9 feet), Zea mays typically grows with a single, hollow main stem often called a stalk (or culm) which exhibits internodes that are cylindrical in the upper part and alternately grooved in the lower part with a bud in the groove. (wikipedia.org)
Abstract1
- Abstract: Natural herbicides may be more sustainable than their chemical homologues, but they are still toxic substances that can affect humans and animals. (ad-astra.ro)
Extract3
- Zea Mays (Corn) Silk Extract, Hydrolyzed Corn Starch, Hydrolyzed Corn Protein, Corn Acid, Corn Glycerides and Potassium Cornate. (cosmeticsinfo.org)
- and Zea Mays (Corn) Silk Extract were not dermal irritants or sensitizers. (cosmeticsinfo.org)
- Optimization of obtaining an aqueous extract of purple corn (Zea mays L.) rich in anthocyanins and degradation profile. (usp.br)
Seedlings1
- Zea mays seedlings. (scielo.org.ar)
Printmaking2
- Zea Mays Printmaking is located at 320 Riverside Drive, Florence (Northampton), Massachusetts. (zeamaysprintmaking.com)
- The scholarship fund was named after founder Liz Chalfin's mother who was an avid supporter of Zea Mays Printmaking and believed strongly in helping those in need. (zeamaysprintmaking.com)
Proteins2
- BLAST-able datasets include Zea mays genomic DNA, splice-aligned transcripts and proteins, gene models, and other aligned sequences. (plantgdb.org)
- This gain, we speculate, might derive from the ability of the mutant proteins to sequester WT1 into unproductive oligomers, or to erroneously bind to variant target sequences. (osti.gov)
Plants10
- This plant is introduced to some part of the PLANTS Floristic Area, though it may be native in other parts. (redorbit.com)
- 1. A Zea mays (L.) cell line which is auxin-autotrophic and from which protoplasts, which can reproducibly and stably regenerate into fertile plants, can be produced. (google.com)
- 8. An auxin-autotrophic Zea mays (L.) cell line from which fertile Zea mays (L.) plants can be obtained. (google.com)
- Plants which do not receive sufficient light may become pale in color, have fewer leaves and a "leggy" stretched-out appearance. (backyardgardener.com)
- Allelopathic management of noxious weeds in Helianthus annuus, Zea mays and Triticum aestivum by selected plants. (cabi.org)
- Drought experiments with ca1ca2 mutant plants suggest a role for CA in water-use efficiency and reveal that Z. mays is not optimized for water-use efficiency under well-watered conditions. (plantphysiol.org)
- The aim of this study was to evaluate metabolic response in both shoot and roots of two plants: Zea mays var. (scirp.org)
- In the current study, we examined root and shoot metabolites in two types of plants, Zea mays var. (scirp.org)
- Response and adaptation of Zea mays plants under optimal conditions are assured by the existence of a complex system of adjustment at different levels of organization. (ad-astra.ro)
- In this context, the purpose of the present study consists in assessing the role of antioxidant enzymes in the formation and development tolerance of Zea mays plants throughout their development. (ad-astra.ro)
Binomen1
- Possumus eligere nomen botanicum speciei ( Mays ) aut binomen ( Zea mays ). (wikipedia.org)
Drought2
Maizium1
- E granis Zeae mays varietatis evertae maizium inflatum praeparatur. (wikipedia.org)
Corn silk1
- Zea mays (corn silk), Althea officianalis (marshmallow), and Barosma betulina (buchu). (thefreedictionary.com)
Yield2
- Agronomic characteristics such as yield, plant height, overwintering capacity, flowering period, and disease susceptibility were compared to those of unmodified Z. mays counterparts. (gc.ca)
- Influence of Herbicides as Growth Regulators on Growth and Yield of Baby Corn (Zea mays L. (scialert.net)
Germination3
- A Pilot Research study to establish the effect on corn (Zea mays) seed germination when immersed in homeopathically potentised 15X essential mineral nutrient solutions. (hpathy.com)
- to identify whether seed immersion in 13 homeopathically potentised 15X essential mineral nutrient solutions increases Corn ( Zea mays ) seed germination when compared with a water control. (hpathy.com)
- This research was undertaken to identify whether seed immersion in homeopathically potentised 15X essential mineral nutrient solutions would increase corn ( Zea mays ) seed germination. (hpathy.com)
Anthocyanins1
- Purple corn ( Zea mays L.), traditional culture of the Andean region, is known for its high content of anthocyanins. (usp.br)
Soil3
- echinatus, Echinochloa crus-galli, Eleusine indica, Lolium multiflorum and Zea mays grew better in the fumigated soil (Table 1). (thefreedictionary.com)
- This study investigates the effects of sewage sludge and compost usage on soil chemical properties and Zea mays nutrition in comparison with those of iron and manganese sulfate solution. (environmental-expert.com)
- These corn lines will permit the use of Liberty⢠as a post-emergence herbicide, thus providing an additional means of weed control in corn production, which may reduce reliance on soil-incorporated herbicides. (gc.ca)
Gardener1
- Forums āŗ Ask A Gardener āŗ Zea Mays - Blue Jade sold out? (planetnatural.com)
Synonym1
- indentata, synonym Zea indentata Sturtev. (wikipedia.org)
Gramineae1
- Corn (Zea mays L.) is a member of family Gramineae. (thefreelibrary.com)
Biosynthesis2
Gene2
- Lines T14 and T25 were produced using recombinant DNA technology which permitted the introduction of a bacterial based synthetic gene into a line of Z. mays . (gc.ca)
- Bronze-2 Gene Expression and Intron Splicing Patterns in Cells and Tissues of Zea mays L. (plantphysiol.org)
Glufosinate1
- Stress adaptation was evaluated, including susceptibilities to various Z. mays pests and pathogens and to herbicides, other than glufosinate ammonium, that are normally used to control corn or weeds in corn crops. (gc.ca)
Glycine1
- To address this challenge, we considered two alternative systems for introducing cover crops into corn (Zea mays L.)- soybean (Glycine max L.) cropping systems. (unl.edu)
Physiological1
- Our initial studies suggested that both genetic and physiological factors may influence the degree of splicing failure. (plantphysiol.org)
Varieties3
- According to Dr. E. L. Sturtevant, the varieties may be classified into the following seven principal groups. (chestofbooks.com)
- indentata) is a fast-growing, vertically erect, short-lived annual plant and similar to many other varieties of Zea mays. (wikipedia.org)
- indentata from other varieties of Zea mays is the small indentation ("dent") that develops at the crown of each kernel. (wikipedia.org)
Genomes1
- Parallels noted among diverse examples of non-Mendelian inheritance patterns suggest that paramutation may be a general feature of many eukaryotic genomes ( C handler and S tam 2004 ). (genetics.org)
Characterization1
- Therefore, a detailed characterization of each isoform of CA may provide evidence of specialization and functional redundancies. (plantphysiol.org)
Growth2
- In the present field study, we considered the relationship between specific sphingolipids and oxylipins of different hybrids of Zea mays and fumonisin by F. verticillioides , sampling ears at different growth stages from early dough to fully ripe. (mdpi.com)
- Plant Growth-Prompting Bacteria Influenced Metabolites of Zea mays var. (scirp.org)
Triticum1
- Bioassays were performed to study the allelopathic effect of dried leaf powder of Carica papaya , Parthenium hysterophorus , Euphorbia helioscopia and Rumex dentatus on intact and pre-germinated seeds of R. dentatus , Avena fatua , Helianthus annuus (K.S.E 7777), Zea mays (Islamabad Gold 2010) and Triticum aestivum (Wafaq 2001). (cabi.org)
Americana1
- Zea americana Mill. (tropicos.org)
Populations2
- Map of Mexico showing the location of GuilƔ Naquitz Cave and the TehuacƔn Valley, together with the modern distribution of the populations of Zea mays ssp. (pnas.org)
- Both, IRIL and RIL, populations were developed from Zea mays inbred lines CG60 and CG102. (bioone.org)
Taino1
- mays, from Spanish: maĆz after Taino: mahiz), also known as corn (North American and Australian English), is a cereal grain first domesticated by indigenous peoples in southern Mexico about 10,000 years ago. (wikipedia.org)
Commonly1
- The CIR Expert Panel noted that Zea Mays (Corn) Oil is commonly used as a vehicle and as a control in toxicity studies. (cosmeticsinfo.org)
Alternate1
- The leaves of Zea mays alternate with broad, sword-shaped leaf blades, parallel veins with a prominent mid-rib, and small ligules. (wikipedia.org)