Vibrio. Medical search

A genus of VIBRIONACEAE, made up of short, slightly curved, motile, gram-negative rods. Various species produce cholera and other gastrointestinal disorders as well as abortion in sheep and cattle.

The etiologic agent of CHOLERA.

Infections with bacteria of the genus VIBRIO.

A species of bacteria found in the marine environment, sea foods, and the feces of patients with acute enteritis.

A species of halophilic bacteria in the genus VIBRIO, which lives in warm SEAWATER. It can cause infections in those who eat raw contaminated seafood or have open wounds exposed to seawater.

Strains of VIBRIO CHOLERAE containing O ANTIGENS group 1. All are CHOLERA-causing strains (serotypes). There are two biovars (biotypes): cholerae and eltor (El Tor).

A species of gram-negative, halophilic bacteria, in the genus VIBRIO. It is considered part of normal marine flora and commonly associated with ear infections and superficial wounds exposed to contaminated water sources.

An acute diarrheal disease endemic in India and Southeast Asia whose causative agent is VIBRIO CHOLERAE. This condition can lead to severe dehydration in a matter of hours unless quickly treated.

Strains of VIBRIO CHOLERAE containing O ANTIGENS group 139. This strain emerged in India in 1992 and caused a CHOLERA epidemic.

A species of gram-negative bacteria in the genus VIBRIO, isolated from SHELLFISH, as well as from human diarrheal stools and ear infections.

A strain of the VIBRIO CHOLERAE bacteria belonging to serogroup non-O1, infecting humans and other PRIMATES. It is related to VIBRIO CHOLERAE O1, but causes a disease less severe than CHOLERA. Eating raw shellfish contaminated with the bacteria results in GASTROENTERITIS.

A species of gram-negative bacteria in the genus ALIIVIBRIO, which exhibits LUMINESCENCE. A. fischeri is found in a symbiotic relationship with the SQUID Euprymna scolopes.

A family of marine mollusks in the class BIVALVIA, commonly known as oysters. They have a rough irregular shell closed by a single adductor muscle.

An ENTEROTOXIN from VIBRIO CHOLERAE. It consists of two major protomers, the heavy (H) or A subunit and the B protomer which consists of 5 light (L) or B subunits. The catalytic A subunit is proteolytically cleaved into fragments A1 and A2. The A1 fragment is a MONO(ADP-RIBOSE) TRANSFERASE. The B protomer binds cholera toxin to intestinal epithelial cells, and facilitates the uptake of the A1 fragment. The A1 catalyzed transfer of ADP-RIBOSE to the alpha subunits of heterotrimeric G PROTEINS activates the production of CYCLIC AMP. Increased levels of cyclic AMP are thought to modulate release of fluid and electrolytes from intestinal crypt cells.

Aquatic invertebrates belonging to the phylum MOLLUSCA or the subphylum CRUSTACEA, and used as food.

The presence of bacteria, viruses, and fungi in water. This term is not restricted to pathogenic organisms.

Proteins found in any species of bacterium.

The salinated water of OCEANS AND SEAS that provides habitat for marine organisms.

Deoxyribonucleic acid that makes up the genetic material of bacteria.

Proteins from BACTERIA and FUNGI that are soluble enough to be secreted to target ERYTHROCYTES and insert into the membrane to form beta-barrel pores. Biosynthesis may be regulated by HEMOLYSIN FACTORS.

Vaccines or candidate vaccines used to prevent infection with VIBRIO CHOLERAE. The original cholera vaccine consisted of killed bacteria, but other kinds of vaccines now exist.

Any of the processes by which cytoplasmic or intercellular factors influence the differential control of gene action in bacteria.

Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.

The functional hereditary units of BACTERIA.

The degree of pathogenicity within a group or species of microorganisms or viruses as indicated by case fatality rates and/or the ability of the organism to invade the tissues of the host. The pathogenic capacity of an organism is determined by its VIRULENCE FACTORS.

A phenomenon where microorganisms communicate and coordinate their behavior by the accumulation of signaling molecules. A reaction occurs when a substance accumulates to a sufficient concentration. This is most commonly seen in bacteria.

Diseases of freshwater, marine, hatchery or aquarium fish. This term includes diseases of both teleosts (true fish) and elasmobranchs (sharks, rays and skates).

A superorder of CEPHALOPODS comprised of squid, cuttlefish, and their relatives. Their distinguishing feature is the modification of their fourth pair of arms into tentacles, resulting in 10 limbs.

Cultivation of natural faunal resources of water. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)

Common name for an order (Anguilliformes) of voracious, elongate, snakelike teleost fishes.

A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.

Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.

A whiplike motility appendage present on the surface cells. Prokaryote flagella are composed of a protein called FLAGELLIN. Bacteria can have a single flagellum, a tuft at one pole, or multiple flagella covering the entire surface. In eukaryotes, flagella are threadlike protoplasmic extensions used to propel flagellates and sperm. Flagella have the same basic structure as CILIA but are longer in proportion to the cell bearing them and present in much smaller numbers. (From King & Stansfield, A Dictionary of Genetics, 4th ed)

Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.

The study of microorganisms living in a variety of environments (air, soil, water, etc.) and their pathogenic relationship to other organisms including man.

Emission of LIGHT when ELECTRONS return to the electronic ground state from an excited state and lose the energy as PHOTONS. It is sometimes called cool light in contrast to INCANDESCENCE. LUMINESCENT MEASUREMENTS take advantage of this type of light emitted from LUMINESCENT AGENTS.

Those components of an organism that determine its capacity to cause disease but are not required for its viability per se. Two classes have been characterized: TOXINS, BIOLOGICAL and surface adhesion molecules that effect the ability of the microorganism to invade and colonize a host. (From Davis et al., Microbiology, 4th ed. p486)

The relationships of groups of organisms as reflected by their genetic makeup.

The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.

The largest order of CRUSTACEA, comprising over 10,000 species. They are characterized by three pairs of thoracic appendages modified as maxillipeds, and five pairs of thoracic legs. The order includes the familiar shrimps, crayfish (ASTACOIDEA), true crabs (BRACHYURA), and lobsters (NEPHROPIDAE and PALINURIDAE), among others.

Low-molecular-weight compounds produced by microorganisms that aid in the transport and sequestration of ferric iron. (The Encyclopedia of Molecular Biology, 1994)

Proteins isolated from the outer membrane of Gram-negative bacteria.

The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.

The lipopolysaccharide-protein somatic antigens, usually from gram-negative bacteria, important in the serological classification of enteric bacilli. The O-specific chains determine the specificity of the O antigens of a given serotype. O antigens are the immunodominant part of the lipopolysaccharide molecule in the intact bacterial cell. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)

Viruses whose hosts are bacterial cells.

Proteins that are structural components of bacterial fimbriae (FIMBRIAE, BACTERIAL) or sex pili (PILI, SEX).

A genus of gram-negative, facultatively anaerobic, rod-shaped bacteria that are common in the marine environment and on the surfaces and in the intestinal contents of marine animals. Some species are bioluminescent and are found as symbionts in specialized luminous organs of fish.

Techniques used for determining the values of photometric parameters of light resulting from LUMINESCENCE.

The presence of bacteria, viruses, and fungi in food and food products. This term is not restricted to pathogenic organisms: the presence of various non-pathogenic bacteria and fungi in cheeses and wines, for example, is included in this concept.

Marine fish and shellfish used as food or suitable for food. (Webster, 3d ed) SHELLFISH and FISH PRODUCTS are more specific types of SEAFOOD.

Enumeration by direct count of viable, isolated bacterial, archaeal, or fungal CELLS or SPORES capable of growth on solid CULTURE MEDIA. The method is used routinely by environmental microbiologists for quantifying organisms in AIR; FOOD; and WATER; by clinicians for measuring patients' microbial load; and in antimicrobial drug testing.

A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.

Process of determining and distinguishing species of bacteria or viruses based on antigens they share.

A family of CRUSTACEA, order DECAPODA, comprising the penaeid shrimp. Species of the genus Penaeus are the most important commercial shrimp throughout the world.

An increased liquidity or decreased consistency of FECES, such as running stool. Fecal consistency is related to the ratio of water-holding capacity of insoluble solids to total water, rather than the amount of water present. Diarrhea is not hyperdefecation or increased fecal weight.

Reassessment of the taxonomic position of Vibrio iliopiscarius (Onarheim et al. 1994) and proposal for Photobacterium iliopiscarium comb. nov. (1/1761)

The phylogenetic position of Vibrio iliopiscarius was inferred by the maximum-likelihood, maximum-parsimony and neighbour-joining methods on the basis of almost complete 16S rRNA gene sequences. The results showed that this species falls into the same cluster as Photobacterium species and is clearly distinct from other Vibrio species. Its nearest phylogenetic neighbour is Photobacterium phosphoreum. From these results, it is concluded that V. iliopiscarius should be reclassified as Photobacterium iliopiscarium comb. nov., the type strain of which is PS1T (= ATCC 51760T). (+info)

Inhibition of vibrio anguillarum by Pseudomonas fluorescens AH2, a possible probiotic treatment of fish. (2/1761)

To study the possible use of probiotics in fish farming, we evaluated the in vitro and in vivo antagonism of antibacterial strain Pseudomonas fluorescens strain AH2 against the fish-pathogenic bacterium Vibrio anguillarum. As iron is important in virulence and bacterial interactions, the effect of P. fluorescens AH2 was studied under iron-rich and iron-limited conditions. Sterile-filtered culture supernatants from iron-limited P. fluorescens AH2 inhibited the growth of V. anguillarum, whereas sterile-filtered supernatants from iron-replete cultures of P. fluorescens AH2 did not. P. fluorescens AH2 inhibited the growth of V. anguillarum during coculture, independently of the iron concentration, when the initial count of the antagonist was 100 to 1, 000 times greater that of the fish pathogen. These in vitro results were successfully repeated in vivo. A probiotic effect in vivo was tested by exposing rainbow trout (Oncorynchus mykiss Walbaum) to P. fluorescens AH2 at a density of 10(5) CFU/ml for 5 days before a challenge with V. anguillarum at 10(4) to 10(5) CFU/ml for 1 h. Some fish were also exposed to P. fluorescens AH2 at 10(7) CFU/ml during the 1-h infection. The combined probiotic treatment resulted in a 46% reduction of calculated accumulated mortality; accumulated mortality was 25% after 7 days at 12 degrees C in the probiotic-treated fish, whereas mortality was 47% in fish not treated with the probiont. (+info)

Effects of salinity and temperature on long-term survival of the eel pathogen Vibrio vulnificus biotype 2 (serovar E). (3/1761)

Vibrio vulnificus biotype 2 (serovar E) is a primary eel pathogen. In this study, we performed long-term survival experiments to investigate whether the aquatic ecosystem can be a reservoir for this bacterium. We have used microcosms containing water of different salinities (ranging from 0.3 to 3.8%) maintained at three temperatures (12, 25, and 30 degrees C). Temperature and salinity significantly affected long-term survival: (i) the optimal salinity for survival was 1.5%; (ii) lower salinities reduced survival, although they were nonlethal; and (ii) the optimal temperature for survival was dependent on the salinity (25 degrees C for microcosms at 0.3 and 0.5% and 12 degrees C for microcosms at 1.5 to 3.8%). In the absence of salts, culturability dropped to zero in a few days, without evidence of cellular lysis. Under optimal conditions of salinity and temperature, the bacterium was able to survive in the free-living form for at least 3 years. The presence of a capsule on the bacterial cell seemed to confer an advantage, since the long-term survival rate of opaque variants was significantly higher than that of translucent ones. Long-term-starved cells maintained their infectivity for eels (as determined by both intraperitoneal and immersion challenges) and mice. Examination under the microscope showed that (i) the capsule was maintained, (ii) the cell size decreased, (iii) the rod shape changed to coccuslike along the time of starvation, and (iv) membrane vesicles and extracellular material were occasionally produced. In conclusion, V. vulnificus biotype 2 follows a survival strategy similar to that of biotype 1 of this species in response to starvation conditions in water. Moreover, the aquatic ecosystem is one of its reservoirs. (+info)

Randomly amplified polymorphic DNA analysis of clinical and environmental isolates of Vibrio vulnificus and other vibrio species. (4/1761)

Vibrio vulnificus is an estuarine bacterium that is capable of causing a rapidly fatal infection in humans. A randomly amplified polymorphic DNA (RAPD) PCR protocol was developed for use in detecting V. vulnificus, as well as other members of the genus Vibrio. The resulting RAPD profiles were analyzed by using RFLPScan software. This RAPD method clearly differentiated between members of the genus Vibrio and between isolates of V. vulnificus. Each V. vulnificus strain produced a unique band pattern, indicating that the members of this species are genetically quite heterogeneous. All of the vibrios were found to have amplification products whose sizes were within four common molecular weight ranges, while the V. vulnificus strains had an additional two molecular weight range bands in common. All of the V. vulnificus strains isolated from clinical specimens produced an additional band that was only occasionally found in environmental strains; this suggests that, as is the case with the Kanagawa hemolysin of Vibrio parahaemolyticus, the presence of this band may be correlated with the ability of a strain to produce an infection in humans. In addition, band pattern differences were observed between encapsulated and nonencapsulated isogenic morphotypes of the same strain of V. vulnificus. (+info)

Arbitrarily primed PCR to type Vibrio spp. pathogenic for shrimp. (5/1761)

A molecular typing study on Vibrio strains implicated in shrimp disease outbreaks in New Caledonia and Japan was conducted by using AP-PCR (arbitrarily primed PCR). It allowed rapid identification of isolates at the genospecies level and studies of infraspecific population structures of epidemiological interest. Clusters identified within the species Vibrio penaeicida were related to their area of origin, allowing discrimination between Japanese and New Caledonian isolates, as well as between those from two different bays in New Caledonia separated by only 50 km. Other subclusters of New Caledonian V. penaeicida isolates could be identified, but it was not possible to link those differences to accurate epidemiological features. This contribution of AP-PCR to the study of vibriosis in penaeid shrimps demonstrates its high discriminating power and the relevance of the epidemiological information provided. This approach would contribute to better knowledge of the ecology of Vibrio spp. and their implication in shrimp disease in aquaculture. (+info)

Isolation of Vibrio vulnificus serovar E from aquatic habitats in Taiwan. (6/1761)

The existence of strains of Vibrio vulnificus serovar E that are avirulent for eels is reported in this work. These isolates were recovered from water and oysters and differed from eel virulent strains in (i) fermentation and utilization of mannitol, (ii) ribotyping after HindIII digestion, and (iii) susceptibility to eel serum. Lipopolysaccharide of these strains lacked the highest molecular weight immunoreactive bands, which are probably involved in serum resistance. (+info)

Mechanosensitive channel functions to alleviate the cell lysis of marine bacterium, Vibrio alginolyticus, by osmotic downshock. (7/1761)

The mechanosensitive channel with large conductance of Escherichia coli is the first to be cloned among stretch-activated channels. Although its activity was characterized by a patch clamp method, a physiological role of the channel has not been proved. The marine bacterium, Vibrio alginolyticus, is sensitive to osmotic stress and cell lysis occurs under osmotic downshock. We introduced an mscL gene into Vibrio alginolyticus, and the mechanosensitive channel with large conductance functions was found to alleviate cell lysis by osmotic downshock. This is the first report to show a physiological role of the mechanosensitive channel with large conductance. (+info)

The polar flagellar motor of Vibrio cholerae is driven by an Na+ motive force. (8/1761)

Vibrio cholerae is a highly motile bacterium which possesses a single polar flagellum as a locomotion organelle. Motility is thought to be an important factor for the virulence of V. cholerae. The genome sequencing project of this organism is in progress, and the genes that are highly homologous to the essential genes of the Na+-driven polar flagellar motor of Vibrio alginolyticus were found in the genome database of V. cholerae. The energy source of its flagellar motor was investigated. We examined the Na+ dependence and the sensitivity to the Na+ motor-specific inhibitor of the motility of the V. cholerae strains and present the evidence that the polar flagellar motor of V. cholerae is driven by an Na+ motive force. (+info)

The bacteria are naturally found in warm seawater and can enter the body through cuts or scrapes on the skin while swimming or playing near the water. People with weakened immune systems, such as those with liver cirrhosis, cancer, or HIV/AIDS, are at a higher risk of developing Vibrio infections.

Types of Vibrio Infections

There are several types of Vibrio bacteria that can cause infections, including:

Vibrio vulnificus: This type of bacteria is found in warm coastal waters and can infect people who have open wounds or weakened immune systems. Vibrio vulnificus infections can be severe and can lead to bloodstream infections, septicemia, and even death.

Vibrio parahaemolyticus: This type of bacteria is found in tropical and subtropical waters and can cause gastrointestinal illness, including diarrhea, abdominal cramps, and fever. In severe cases, Vibrio parahaemolyticus infections can lead to bloodstream infections and other serious complications.

Vibrio alginolyticus: This type of bacteria is found in warm coastal waters and can cause gastrointestinal illness, including diarrhea and abdominal cramps. Vibrio alginolyticus infections are generally less severe than those caused by other types of Vibrio bacteria.

Prevention and Treatment

Preventing Vibrio infections is essential for people who have weakened immune systems or who engage in activities that increase their risk of developing an infection, such as swimming in warm coastal waters. Prevention measures include:

Wound care: People with open wounds should avoid swimming in warm coastal waters until the wounds are fully healed.

Avoiding consumption of raw or undercooked seafood: Raw or undercooked seafood can be a source of Vibrio bacteria, so it's essential to cook seafood thoroughly before eating it.

Using proper first aid: If you experience an injury while swimming in warm coastal waters, clean the wound thoroughly and seek medical attention promptly.

Treatment for Vibrio infections depends on the severity of the infection and may include antibiotics, supportive care, such as intravenous fluids and oxygen therapy, and surgical intervention if necessary. In severe cases, hospitalization may be required.

Preventing and treating Vibrio infections is essential for people who engage in activities that increase their risk of developing an infection. By taking preventive measures and seeking prompt medical attention if symptoms develop, you can reduce the risk of serious complications from these infections.

The symptoms of cholera include:

1. Diarrhea: Cholera causes profuse, watery diarrhea that can last for several days.
2. Dehydration: The loss of fluids and electrolytes due to diarrhea can lead to severe dehydration, which can be life-threatening if not treated promptly.
3. Nausea and vomiting: Cholera patients may experience nausea and vomiting, especially in the early stages of the disease.
4. Abdominal cramps: The abdomen may become tender and painful due to the inflammation caused by the bacteria.
5. Low-grade fever: Some patients with cholera may experience a mild fever, typically less than 102°F (39°C).

Cholera is spread through the fecal-oral route, which means that it is transmitted when someone ingests food or water contaminated with the bacteria. The disease can also be spread by direct contact with infected fecal matter, such as through poor hygiene practices or inadequate waste disposal.

There are several ways to diagnose cholera, including:

1. Stool test: A stool sample can be tested for the presence of Vibrio cholerae using a microscope or a rapid diagnostic test (RDT).
2. Blood test: A blood test can detect the presence of antibodies against Vibrio cholerae, which can indicate that the patient has been infected with the bacteria.
3. Physical examination: A healthcare provider may perform a physical examination to look for signs of dehydration and other symptoms of cholera.

Treatment of cholera typically involves replacing lost fluids and electrolytes through oral rehydration therapy (ORT) or intravenous fluids. Antibiotics may also be given to shorten the duration of diarrhea and reduce the risk of complications. In severe cases, hospitalization may be necessary to provide more intensive treatment.

Prevention of cholera involves maintaining good hygiene practices, such as washing hands with soap and water, and avoiding consumption of contaminated food and water. Vaccines are also available to protect against cholera, particularly for people living in areas where the disease is common.

In conclusion, cholera is a highly infectious disease that can cause severe dehydration and even death if left untreated. Early diagnosis and treatment are critical to preventing complications and reducing the risk of transmission. Prevention measures such as vaccination and good hygiene practices can also help control the spread of the disease.

Some common types of fish diseases include:

1. Bacterial infections: These are caused by bacteria such as Aeromonas, Pseudomonas, and Mycobacterium. Symptoms can include fin and tail rot, body slime, and ulcers.
2. Viral infections: These are caused by viruses such as viral hemorrhagic septicemia (VHS) and infectious hematopoietic necrosis (IHN). Symptoms can include lethargy, loss of appetite, and rapid death.
3. Protozoan infections: These are caused by protozoa such as Cryptocaryon and Ichthyophonus. Symptoms can include flashing, rapid breathing, and white spots on the body.
4. Fungal infections: These are caused by fungi such as Saprolegnia and Achlya. Symptoms can include fuzzy growths on the body and fins, and sluggish behavior.
5. Parasitic infections: These are caused by parasites such as Ichthyophonus and Cryptocaryon. Symptoms can include flashing, rapid breathing, and white spots on the body.

Diagnosis of fish diseases is typically made through a combination of physical examination, laboratory tests, and observation of the fish's behavior and environment. Treatment options vary depending on the type of disease and the severity of symptoms, and can include antibiotics, antifungals, and medicated baths. Prevention is key in managing fish diseases, and this includes maintaining good water quality, providing a balanced diet, and keeping the fish in a healthy environment.

Note: The information provided is a general overview of common fish diseases and their symptoms, and should not be considered as professional medical advice. If you suspect your fish has a disease, it is recommended that you consult with a veterinarian or a qualified aquarium expert for proper diagnosis and treatment.

There are several types of diarrhea, including:

1. Acute diarrhea: This type of diarrhea is short-term and usually resolves on its own within a few days. It can be caused by a viral or bacterial infection, food poisoning, or medication side effects.
2. Chronic diarrhea: This type of diarrhea persists for more than 4 weeks and can be caused by a variety of conditions, such as irritable bowel syndrome (IBS), inflammatory bowel disease (IBD), or celiac disease.
3. Diarrhea-predominant IBS: This type of diarrhea is characterized by frequent, loose stools and abdominal pain or discomfort. It can be caused by a variety of factors, including stress, hormonal changes, and certain foods.
4. Infectious diarrhea: This type of diarrhea is caused by a bacterial, viral, or parasitic infection and can be spread through contaminated food and water, close contact with an infected person, or by consuming contaminated food.

Symptoms of diarrhea may include:

* Frequent, loose, and watery stools
* Abdominal cramps and pain
* Bloating and gas
* Nausea and vomiting
* Fever and chills
* Headache
* Fatigue and weakness

Diagnosis of diarrhea is typically made through a physical examination, medical history, and laboratory tests to rule out other potential causes of the symptoms. Treatment for diarrhea depends on the underlying cause and may include antibiotics, anti-diarrheal medications, fluid replacement, and dietary changes. In severe cases, hospitalization may be necessary to monitor and treat any complications.

Prevention of diarrhea includes:

* Practicing good hygiene, such as washing hands frequently and thoroughly, especially after using the bathroom or before preparing food
* Avoiding close contact with people who are sick
* Properly storing and cooking food to prevent contamination
* Drinking safe water and avoiding contaminated water sources
* Avoiding raw or undercooked meat, poultry, and seafood
* Getting vaccinated against infections that can cause diarrhea

Complications of diarrhea can include:

* Dehydration: Diarrhea can lead to a loss of fluids and electrolytes, which can cause dehydration. Severe dehydration can be life-threatening and requires immediate medical attention.
* Electrolyte imbalance: Diarrhea can also cause an imbalance of electrolytes in the body, which can lead to serious complications.
* Inflammation of the intestines: Prolonged diarrhea can cause inflammation of the intestines, which can lead to abdominal pain and other complications.
* Infections: Diarrhea can be a symptom of an infection, such as a bacterial or viral infection. If left untreated, these infections can lead to serious complications.
* Malnutrition: Prolonged diarrhea can lead to malnutrition and weight loss, which can have long-term effects on health and development.

Treatment of diarrhea will depend on the underlying cause, but may include:

* Fluid replacement: Drinking plenty of fluids to prevent dehydration and replace lost electrolytes.
* Anti-diarrheal medications: Over-the-counter or prescription medications to slow down bowel movements and reduce diarrhea.
* Antibiotics: If the diarrhea is caused by a bacterial infection, antibiotics may be prescribed to treat the infection.
* Rest: Getting plenty of rest to allow the body to recover from the illness.
* Dietary changes: Avoiding certain foods or making dietary changes to help manage symptoms and prevent future episodes of diarrhea.

It is important to seek medical attention if you experience any of the following:

* Severe diarrhea that lasts for more than 3 days
* Diarrhea that is accompanied by fever, blood in the stool, or abdominal pain
* Diarrhea that is severe enough to cause dehydration or electrolyte imbalances
* Diarrhea that is not responding to treatment

Prevention of diarrhea includes:

* Good hand hygiene: Washing your hands frequently, especially after using the bathroom or before preparing food.
* Safe food handling: Cooking and storing food properly to prevent contamination.
* Avoiding close contact with people who are sick.
* Getting vaccinated against infections that can cause diarrhea, such as rotavirus.

Overall, while diarrhea can be uncomfortable and disruptive, it is usually a minor illness that can be treated at home with over-the-counter medications and plenty of fluids. However, if you experience severe or persistent diarrhea, it is important to seek medical attention to rule out any underlying conditions that may require more formal treatment.

Note: Group-1: Vibrio alginolyticus; Group-2: Vibrio natriegens, Vibrio pelagius, Vibrio azureus; + = Positive; - =Negative; V ... In Latin "vibrio" means "to quiver". The genus Vibrio contains a large number of species. So, variation in the biochemical ... The proposed conservation of the generic name Vibrio Pacini 1854 and designation of the neotype strain of Vibrio cholerae ... "The Proposed Conservation of the Generic Name Vibrio Pacini 1854 and Designation of the Neotype Strain of Vibrio Cholerae ...

https://en.wikipedia.org/wiki/Vibrio

... is a gram-negative organism that is rod-shaped and has a two-sheathed flagella that is found on one side of ... Type strain of Vibrio aerogenes at BacDive - the Bacterial Diversity Metadatabase (Articles with short description, Short ... "Vibrio Aerogenes Sp. Nov., a Facultatively Anaerobic Marine Bacterium That Ferments Glucose with Gas Production." International ... This organism is a strain that most likely belongs to the species Vibrio and therefore the family, Vibrionaceae. The sequence ...

https://en.wikipedia.org/wiki/Vibrio_aerogenes

... is a gram negative, oxidase and catalase positive marine bacterium described in 1971. It is commonly found in ... "Vibrio pelagius (Baumann et al., 1971) Baumann et al., 1981". Species 2000 & ITIS Catalogue of Life. Species 2000: Naturalis, ...

https://en.wikipedia.org/wiki/Vibrio_pelagius

... is a species of Gram-negative, motile, curved rod-shaped (bacillus), pathogenic bacteria of the genus Vibrio ... "Vibrio Species Causing Vibriosis". Centers for Disease Control. Retrieved June 5, 2017. "Vibrio vulnificus". NCBI Genome ... vulnificus at Todar's Online Textbook of Bacteriology CNN video on vibrio vulnificus Type strain of Vibrio vulnificus at ... Vibrio vulnificus is commonly found in the Gulf of Mexico, where more than a dozen people have died from the infection since ...

https://en.wikipedia.org/wiki/Vibrio_vulnificus

... is a pathogenic bacterium which attacks larvae of the scallop Pecten maximus. This bacterium does not use ... A365 is the type strain (= CIP 105190T). Lambert, C.; Nicolas, J. L.; Cilia, V.; Corre, S. (1998). "Vibrio pectenicida sp. nov ... "Phenotypic diversity amongst Vibrio isolates from marine aquaculture systems." Aquaculture 219.1 (2003): 9-20. Lambert, ... LPSN Type strain of Vibrio pectenicida at BacDive - the Bacterial Diversity Metadatabase v t e (Articles with short description ...

https://en.wikipedia.org/wiki/Vibrio_pectenicida

Vibrio fischerii Vibrio harveyi Vibrio ordalii Vibrio tubiashii Vibrio vulnificus Serotype Virulence Type strain of Vibrio ... Vibrio anguillarum is a species of Gram-negative bacteria with a curved-rod shape and one polar flagellum. It is damaging to ...

https://en.wikipedia.org/wiki/Vibrio_anguillarum

"Vibrio lentus protects gnotobiotic sea bass (Dicentrarchus labrax L.) larvae against challenge with Vibrio harveyi". Veterinary ... Vibrio lentus has been isolated from lesions found on the mantle and arms of the common octopus (Octopus vulgaris), where it ... Vibrio lentus is a species of Gram-negative bacteria found in marine environments. It was first isolated from Mediterranean ... The phenotype of V. lentus is similar to that of Vibrio splendidus. It was first described as a new species by Macian, Ludwig, ...

https://en.wikipedia.org/wiki/Vibrio_lentus

Media related to Vibrio parahaemolyticus at Wikimedia Commons Data related to Vibrio parahaemolyticus at Wikispecies CDC ... eds.). Cholera, Vibrio cholerae O1 and O139, and Other Pathogenic Vibrios. In: Barron's Medical Microbiology (4th ed.). Univ of ... Vibrio parahaemolyticus (V. parahaemolyticus) is a curved, rod-shaped, Gram-negative bacterium found in the sea and in ... "Vibrio parahaemolyticus and raw Pacific oysters from Coffin Bay, SA". Food Standards Australia New Zealand (FSANZ). Retrieved ...

https://en.wikipedia.org/wiki/Vibrio_parahaemolyticus

... is a Vibrio species that mimics V. cholerae. V. mimicus has been recognized as a cause of gastroenteritis ... Type strain of Vibrio mimicus at BacDive - the Bacterial Diversity Metadatabase (Articles with short description, Short ... Vibrio mimicus infection from consuming crayfish". Morbidity and Mortality Weekly Report. Spokane, Washington. 59 (42): 1374. ... was notified of two hospitalized patients under intensive care with severe dehydration whose stool specimens yielded Vibrio ...

https://en.wikipedia.org/wiki/Vibrio_mimicus

... is a water-borne bacterium first isolated from patients with severe diarrhoea in Bahrain in the 1970s by A. L ... Type strain of Vibrio fluvialis at BacDive - the Bacterial Diversity Metadatabase v t e (Articles with short description, Short ... J. V. Lee; P. Shread; A. L. Furniss & T. N. Bryant (1981). "Taxonomy and description of Vibrio fluvialis sp. nov. (synonym ... Upon discovery, this organism was considered to be similar to both Vibrio and Aeromonas species, but was ultimately determined ...

https://en.wikipedia.org/wiki/Vibrio_fluvialis

"Vibrio coralliilyticus" at the Encyclopedia of Life Type strain of Vibrio coralliilyticus at BacDive - the Bacterial Diversity ... Vibrio anguillarum. Vibrio coralliilyticus has been studied quite extensively since its discovery and as such, several ... "Insight into the resilience and susceptibility of marine bacteria to T6SS attack by Vibrio cholerae and Vibrio coralliilyticus ... "Mortalities of Eastern and Pacific Oyster Larvae Caused by the Pathogens Vibrio coralliilyticus and Vibrio tubiashii". Applied ...

https://en.wikipedia.org/wiki/Vibrio_coralliilyticus

... is a polysaccharide-secreting bacterium isolated from a deep-sea hydrothermal vent polychaete annelid, ... Rougeaux H, Kervarec N, Pichon R, Guezennec J (1999). "Structure of the exopolysaccharide of Vibrio diabolicus isolated from a ... Raguenes, G.; Christen, R.; Guezennec, J.; Pignet, P.; Barbier, G. (1997). "Vibrio diabolicus sp. nov., a New Polysaccharide- ... A Multiphasic Study of Patterns in Diversity and Structure Within a Coastal Vibrio cholerae Population. ProQuest, 2009. Hidalgo ...

https://en.wikipedia.org/wiki/Vibrio_diabolicus

... is a Gram-negative, bioluminescent, marine bacterium in the genus Vibrio. V. harveyi is rod-shaped, motile (via ... V. harveyi at NCBI Vibrios at NCBI Type strain of Vibrio harveyi at BacDive - the Bacterial Diversity Metadatabase (Articles ... Bassler BL, Wright M, Showalter RE, Silverman MR (1993). "Intercellular signalling in Vibrio harveyi: sequence and function of ... Surette MG, Miller MB, Bassler BL (1999). "Quorum sensing in Escherichia coli, Salmonella typhimurium, and Vibrio harveyi: a ...

https://en.wikipedia.org/wiki/Vibrio_harveyi

... is a Gram-negative, curved rod-shaped, marine bacterium closely related to its sister species, Vibrio harveyi ... This is considered a rare phenotype in Vibrio and is thought to be caused by their exploitation of lateral gene transfer during ... Type strain of Vibrio campbellii at BacDive - the Bacterial Diversity Metadatabase (Articles with short description, Short ... The PEL22A strain showed that the genes that regulate the bacteriophage CTXΦ, the main cause of virulence in Vibrio cholerae, ...

https://en.wikipedia.org/wiki/Vibrio_campbellii

... is a gram negative, oxidase and catalase positive marine bacterium. It is commonly found in marine environments ... "Vibrio azureus Yoshizawa et al., 2009". Species 2000 & ITIS Catalogue of Life. Species 2000: Naturalis, Leiden, the Netherlands ... Yoshizawa, Susumu; Karatani, Hajime; Wada, Minoru; Kogure, Kazuhiro (April 2012). "Vibrio azureus emits blue-shifted light via ...

https://en.wikipedia.org/wiki/Vibrio_azureus

"Vibrio furnissii" at the Encyclopedia of Life Type strain of Vibrio furnissii at BacDive - the Bacterial Diversity Metadatabase ... October 1983). "Vibrio furnissii (formerly aerogenic biogroup of Vibrio fluvialis), a new species isolated from human feces and ... Vibrio furnissii is a Gram-negative, rod-shaped bacterium. Its type strain is ATCC 35016 (= CDC B3215). V. furnissii is ... Wu, T.-K.; Wang, Y.-K.; Chen, Y.-C.; Feng, J.-M.; Liu, Y.-H.; Wang, T.-Y. (2007). "Identification of a Vibrio furnissii ...

https://en.wikipedia.org/wiki/Vibrio_furnissii

NCBI: Vibrio cholerae O1 (serogroup) NCBI: Vibrio cholerae O139 (serogroup) Harris, Jason B.; LaRocque, Regina C.; Qadri, ... Conservation of Vibrio Pacini 1854 as a Bacterial Generic Name, Conservation of Vibrio Cholerae Pacini 1854 as the ... "Medical Definition of Vibrio cholerae". MedTerms Dictionary. MedicineNet. Retrieved 2021-06-03. "New strains of Vibrio cholerae ... Copepods and cholera in untreated water Vibrio cholerae El Tor N16961 Genome Page [hmepage] Type strain of Vibrio cholerae at ...

https://en.wikipedia.org/wiki/Vibrio_cholerae

... is a Gram-negative marine bacterium. It was first isolated from salt marsh mud. It is a salt-loving organism ... Type strain of Vibrio natriegens at BacDive - the Bacterial Diversity Metadatabase University of Marburg 2018 iGEM team v t e ( ... It reacts well to the presence of sodium ions which appear to stimulate growth in Vibrio species, to stabilise the cell ... 2021) isolated and identified many strains of Vibrio natriegens from marine sponges of the Saint Martin's Island Area of the ...

https://en.wikipedia.org/wiki/Vibrio_natriegens

... is a Gram-negative, rod-shaped (0.5 um-1.5 um) marine bacterium that uses a single polar flagellum for ... Vibrio tubiashii was originally isolated from juvenile and larval bivalve mollusks suffering from bacillary necrosis, now ... 1984). "Vibrio tubiashii sp. nov., a pathogen of bivalve mollusks". International Journal of Systematic and Evolutionary ... Delston et al 2003) (Kothary et al 2001) (Sussman et al 2009). (Hasegawa et al 2008) Type strain of Vibrio tubiashii at BacDive ...

https://en.wikipedia.org/wiki/Vibrio_tubiashii

"Vibrio cyclotrophicus" at the Encyclopedia of Life LPSN WORMS entry Type strain of Vibrio cyclitrophicus at BacDive - the ... Vibrio cyclitrophicus (previously known as Vibrio cyclotrophicus ) is a polycyclic aromatic hydrocarbon (PAH)-degrading marine ... Hedlund BP, Staley JT (January 2001). "Vibrio cyclotrophicus sp. nov., a polycyclic aromatic hydrocarbon (PAH)-degrading marine ...

https://en.wikipedia.org/wiki/Vibrio_cyclitrophicus

... is a Gram-negative species of bacterium in the genus Vibrio. Strains of this species were originally isolated from ... Type strain of Vibrio casei at BacDive - the Bacterial Diversity Metadatabase v t e (Articles with short description, Short ... Bleicher, A.; Neuhaus, K.; Scherer, S. (11 September 2009). "Vibrio casei sp. nov., isolated from the surfaces of two French ...

https://en.wikipedia.org/wiki/Vibrio_casei

"Vibrio ordalii" at the Encyclopedia of Life LPSN Type strain of Vibrio ordalii at BacDive - the Bacterial Diversity ... "Monoclonal antibodies against Vibrio anguillarum O2 and Vibrio ordalii identify antigenic differences in lipopolysaccharide O- ... "Growth inhibition of the salmon pathogen Vibrio ordalii by a siderophore produced by Vibrio anguillarum strain VL4355". Journal ... Vibrio ordalii is a Gram-negative, rod-shaped bacterium. It causes vibriosis in fish. Its type strain is ATCC 33509 (=DF3K =Dom ...

https://en.wikipedia.org/wiki/Vibrio_ordalii

Vibrio cyclosites 5S ribosomal RNA, on: NCBI GenBank Taxonomy - Vibrio cyclosites (SPECIES), on: UniProt v t e (Articles with ... just like Vibrio cyclosites. "Vibrio adaptatus ZoBell and Upham (ATCC 19263)". ATCC. Retrieved 11 March 2018. Muir, David; ... Vibrio adaptatus is the name given to a Gram-negative species of bacteria first described from the ocean by ZoBell and Upham in ... It was later shown to be genetically very different from other species of Vibrio (which belongs to Gammaproteobacteria), ...

https://en.wikipedia.org/wiki/Vibrio_adaptatus

"Vibrio tapetis" at the Encyclopedia of Life LPSN Type strain of Vibrio tapetis at BacDive - the Bacterial Diversity ... Vibrio tapetis is a Gram-negative, rod-shaped bacterium, the causative agent of the brown ring disease that affects cultured ... Borrego, J. J.; Castro, D.; Luque, A.; Paillard, C.; Maes, P.; Garcia, M. T.; Ventosa, A. (1996). "Vibrio tapetis sp. nov., the ... Intraspecific characterization of Vibrio tapetis strains by use of pulsed-field gel electrophoresis, ribotyping, and plasmid ...

https://en.wikipedia.org/wiki/Vibrio_tapetis

... is a Gram-negative marine bacterium. It is medically important since it causes otitis and wound infection ... Vibrio alginolyticus are commonly found in aquatic environments. Some strains of V. alginolyticus are highly salt tolerant and ... Type strain of Vibrio alginolyticus at BacDive - the Bacterial Diversity Metadatabase v t e (Articles with short description, ... Noguchi, T; Hwang, D F; Arakawa, O; Sugita, H; Deguchi, Y; Shida, Y; Hashimoto, K (1987). "Vibrio alginolyticus, a tetrodotoxin ...

https://en.wikipedia.org/wiki/Vibrio_alginolyticus

... is a Gram-negative species of bacterium in the genus Vibrio. Strains of this species were originally isolated ... Type strain of Vibrio mytili at BacDive - the Bacterial Diversity Metadatabase v t e (Articles with short description, Short ... Pujalte, M.-J.; Ortigosa, M.; Urdaci, M.-C.; Garay, E.; Grimont, P. A. D. (1 April 1993). "Vibrio mytili sp. nov., from Mussels ...

https://en.wikipedia.org/wiki/Vibrio_mytili

... is a bacteriophage (a virus that infects bacteria) of the family Myoviridae, genus Longwoodvirus. van Zyl LJ ...

https://en.wikipedia.org/wiki/Vibrio_virus_K139

Portal: Biology As of this edit, this article uses content from "1.E.30 The Vibrio Holin (Vibrio Holin) Family", which is ... Holin Lysin Transporter Classification Database "1.E.30 The Vibrio Holin (Vibrio Holin) Family". Transporter Classification ... The Vibrio Holin Family (TC# 1.E.30) consists of small proteins 50 to 65 amino acyl residues in length that exhibit a single N- ... A representative list of proteins belonging to the Vibrio Holin family can be found in the Transporter Classification Database ...

https://en.wikipedia.org/wiki/Vibrio_holin_family

... (formerly Vibrio phage nt-1) is a bacteriophage known to infect Vibrio bacteria. It infects Vibrio natriegens ... "ICTV Taxonomy history: Vibrio virus nt1" (html). International Committee on Taxonomy of Viruses (ICTV). Retrieved 29 January ...

https://en.wikipedia.org/wiki/Vibrio_virus_nt1

VrrA (Vibrio regulatory RNA of OmpA) is a non-coding RNA that is conserved across all Vibrio species of bacteria and acts as a ... Page for Vibrio regulatory RNA of OmpA at Rfam v t e (Non-coding RNA, All stub articles, Molecular biology stubs). ... Song T, Wai SN (July 2009). "A novel sRNA that modulates virulence and environmental fitness of Vibrio cholerae". RNA Biol. 6 ( ... This non-coding RNA was initially identified from Tn5 transposon mutant libraries of Vibrio cholerae and its location within ...

https://en.wikipedia.org/wiki/Vibrio_regulatory_RNA_of_OmpA

Vibrio parahaemolyticus infections linked to fresh crab meat from Venezuelaplus icon * Vibrio parahaemolyticus infections ... Vibrio parahaemolyticus illnesses associated with consumption of shellfish, United States, 2013plus icon *Recall & Advice to ... Information on this website focuses on Vibrio species causing vibriosis. To learn about the illness caused by certain strains ... Thats because Vibrio bacteria thrive in coastal waters where oysters are harvested. ...

https://www.cdc.gov/vibrio/index.html

MMWR and Articles about Vibrio species causing Vibriosis. ... Vibrio infections on the Gulf Coast: results of the first year ... Vibrio parahaemolyticus infections linked to fresh crab meat from Venezuelaplus icon * Vibrio parahaemolyticus infections ... Draft genome sequences of nine Vibrio sp. isolates from across the United States closely related to Vibrio cholerae. DOI ... Complete genome sequence of Vibrio sp. strain 2521-89, a close relative of Vibrio cholerae isolated from lake water in New ...

https://www.cdc.gov/vibrio/publications.html

Vibrio cholera infections and noncholera Vibrio infections. Historically, the noncholera Vibrio species are classified as ... Vibrio infections are largely classified into two distinct groups: ... With the exception of nonhalophilic Vibrio species, such as Vibrio cholerae and Vibrio mimicus, all Vibrio species require ... Vibrio infections have no racial predilection. Because Vibrio species are natural inhabitants of sea water, Vibrio infections ...

https://www.medscape.com/answers/232038-118442/what-are-the-sexual-predilections-of-vibrio-infections

Vibrio cholera infections and noncholera Vibrio infections. Historically, the noncholera Vibrio species are classified as ... Vibrio infections are largely classified into two distinct groups: ... Vibrio parahaemolyticus and Vibrio vulnificus Recovered from Oysters during an Oyster Relay Study. Appl Environ Microbiol. 2018 ... Table 2. Clinical Presentation Rates of Pathogenic Vibrio Infections. *Table 3. Clinical Signs and Symptoms of Vibrio ...

https://emedicine.medscape.com/article/232038-medication

18, 2020 - As soon as the foodborne pathogen Vibrio parahaemolyticus infects a human intestinal cell, the bacteria are already ... Escape Artists: How Vibrio Bacteria Break Out of Cells. After replicating inside human cells, one foodborne pathogen uses a ... Vibrio bacteria are found in warm seawater and humans become infected by eating raw shellfish such as oysters. About a dozen ... Vibrio, they showed, uses a common bacterial system known as the type 3 secretion system 2 (T3SS2) to invade cells and begin ...

https://www.newswise.com/articles/escape-artists-how-vibrio-bacteria-break-out-of-cells

... Environmental Microbiology. ... the focus was on environmental parameters associated with incidence and distribution of clinically relevant Vibrio spp. and ... namely in the context of prediction of environmental conditions favourable to Vibrio spp., hence human health risk. ...

https://www.niehs.nih.gov/research/resources/articles_journals/eheaNIEHS/ehea/resources/page946207.cfm

... - Genomics and Precision Health Blog ...

https://blogs.cdc.gov/genomics/tag/vibrio-cholerae/

Vibrio atlanticus LGP32). Find diseases associated with this biological target and compounds tested against it in bioassay ...

https://pubchem.ncbi.nlm.nih.gov/protein/B7VLL5

Risk assessment of Vibrio vulnificus in raw oysters: interpretative summary and technical report ... Selection and application of methods for the detection and enumeration of human-pathogenic halophilic vibrio spp. in seafood: ...

https://extranet.who.int/iris/restricted/browse?authority=Vibrio+vulnificus&type=mesh

"While we are interested in how the population dynamics of Vibrio might cause disease, for this study we wanted to use Vibrios ... more potentially harmful Vibrio blooms. "Knowing the connection between Saharan dust and Vibrio population blooms is ... Vibrio cases are increasing at a higher rate than many other bacterial pathogens in the U.S., which could be due in part to ... Vibrios ability to rapidly respond to these nutrient plumes at a potentially faster rate than microalgae short circuits this ...

https://phys.org/news/2016-05-saharan-big-impact-caribbean.html

... including Vibrio cholerae - the causative agent of cholera. All V. cholerae strains examined to date harbor gene clusters ...

https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0048320

The mosaic-structured Vibrio cholerae genome points to the importance of horizontal gene transfer (HGT) in the evolution of ... Chitin induces natural competence in Vibrio cholerae Karin L Meibom 1 , Melanie Blokesch, Nadia A Dolganov, Cheng-Yen Wu, Gary ... Global impact of Vibrio cholerae interactions with chitin. Pruzzo C, Vezzulli L, Colwell RR. Pruzzo C, et al. Environ Microbiol ... Chitin induces natural competence in Vibrio cholerae Karin L Meibom et al. Science. 2005. . ...

http://www.ncbi.nlm.nih.gov/pubmed/16357262

Vibrio are bacteria that cause an estimated 80,000 illnesses each year in the United States. About a dozen species of Vibrio ... Other Vibrio Infections. In: Red Book: 2021-2024 Report of the Committee on Infectious Diseases, 32nd ed. 2021 January. Itasca ... Vibrio naturally live in coastal waters, including salt water and brackish water, which is a mixture of salt water and fresh ... Unlike other Vibrio species, V. vulnificus is primarily transmitted through open-wound contact with salt water or brackish ...

https://emergency.cdc.gov/han/2023/han00497.asp

... from Vibrio Cholerae cocrystallized with octanoyl-CoA: hydrolzed ligand ... Vibrio cholerae O1 biovar El Tor str. N16961. Mutation(s): 1 Gene Names: fabH2, VC_A0751. EC: 2.3.1.180. ... Find proteins for Q9KLJ3 (Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)) ... Beta-ketoacyl-ACP synthase III -2 (FabH2) (C113A) from Vibrio Cholerae cocrystallized with octanoyl-CoA: hydrolzed ligand. *PDB ...

https://www.rcsb.org/structure/5KP2

Global dissemination of Vibrio parahaemolyticus serotype O3:K6 and its serovariants. Clin Microbiol Rev. 2007;20:39-48. DOI ... New Variant of Vibrio parahaemolyticus, Sequence Type 3, Serotype O10:K4, China, 2020. Emerging Infectious Diseases. 2022;28(6 ... Assessment of evolution of pandemic Vibrio parahaemolyticus by multilocus sequence typing. J Clin Microbiol. 2004;42:1280-2. ... Vibrio parahaemolyticus is a halophilic bacterium distributed naturally in marine and estuarine environments. It is one of the ...

https://wwwnc.cdc.gov/eid/article/28/6/21-1871

β-ketoacyl-acyl Carrier Protein (ACP) Synthase III-2 (FabH2) From Vibrio cholerae. The production of fatty acids are critical ...

https://www.niaid.nih.gov/node/3598

Vibrio parahaemolyticus, a Climate Change Indicator in Alaska Marine Mammals (book section). ... Vibrio parahaemolyticus, a Climate Change Indicator in Alaska Marine Mammals. Caroline E.C. Goertz, Robert Walton, Natalie ... One fecal pathogen in particular, Vibrio parahaemolyticus (Vp), is considered an indicator of climate change as this organism ... Vibrio spp.) and exposure to a variety of diseases known to affect marine mammals and/or humans (e.g., Brucella, Morbillivirus ...

https://seagrant.uaf.edu/bookstore/pubs/item.php?id=12181

The effect of exposure to artificial sea water (ASW) on the ability of classical Vibrio cholerae O1 cells to interact with ... Persistence of adhesive properties in Vibrio cholerae after long‐term exposure to sea water. ... Persistence of adhesive properties in Vibrio cholerae after long‐term exposure to sea water. ...

https://cbcb.umd.edu/publications/persistence-adhesive-properties-vibrio-cholerae-after-long%E2%80%90term-exposure-sea-water

Although Campylobacter, Listeria, Salmonella, Vibrio and Cryptosporidium are up, Shigella, E. coli O157:H7 and Yersinia are ... Campylobacter, Listeria, Salmonella, Vibrio and Cryptosporidium are up, Shigella, E. coli O157:H7 and Yersinia are down in new ... Home , Lawyer Op-Ed , Campylobacter, Listeria, Salmonella, Vibrio and Cryptosporidium are up, Shigella, E. coli O157:H7 and ...

https://www.marlerblog.com/lawyer-oped/campylobacter-listeria-salmonella-vibrio-and-cryptosporidium-are-up-shigella-e-coli-o157h7-and-yersi/

vibrio Zürich. vibrio. Repräsentanz Schweiz /Jenni Kommunikation. Südstrasse 85/PF. CH-8034 Zürich. 41 (44) 388 60 80 ... vibrio München. vibrio. Kommunikationsmanagement Dr. Kausch GmbH. Rundfunkplatz 2. 80335 München. +49 89 3215170 ... vibrio Wien. vibrio Repräsentanz Österreich. Kunigundbergstraße 43. A-2380 Perchtoldsdorf. +43 1 3196959 ...

https://vibrio.eu/vibrio/titel02-2/

The marine bacterium Vibrio harveyi ATCC BAA-1116 channels the information of three AI signals into one QS cascade. Three ...

https://cipsm.de/publications/research-area-d/activity-abundance-and-localization-of-quorum-sensing-receptors-in-vibrio-harveyi/

https://www.emergency.cdc.gov/han/2023/han00497.asp

Strikingly, we observed that in Vibrio cholerae, protein production capacity was independent of S10 position. Deep sequencing ... From: Macromolecular crowding links ribosomal protein gene dosage to growth rate in Vibrio cholerae ...

https://bmcbiol.biomedcentral.com/articles/10.1186/s12915-020-00777-5/figures/1

Vibrio cholerae O22 might be a putative source of exogenous DNA resulting in the emergence of the new strain of Vibrio cholerae ... RÉSUMÉ Au cours des dix dernières années, limportance des souches de Vibrio cholerae non-O1 et non-O139 a été mise en avant à ... Vibrio cholerae non-O1, non-O139 serogroups and cholera-like diarrhea, Kolkata, India. Emerg Infect Dis. 2013 Mar;19(3):464-7. ... La présente étude visait à évaluer la fréquence de lisolation des souches de Vibrio cholerae non-O1 et non-O139 et leur profil ...

https://www.emro.who.int/ar/emhj-volume-22-2016/volume-22-issue-2/isolation-frequency-and-susceptibility-pattern-of-non-o1-and-non-o139-vibrio-cholerae-in-a-tertiary-health-care-laboratory-19992012.html

Vibrio cholerae is a noninvasive enteric bacterium that causes the severe diarrheal disease cholera. Candidate cholera vaccines ...

https://edrn.nci.nih.gov/data-and-resources/publications/15213169-625-transcriptional-responses-of-intestinal-epithelial-cells-to-infection-with-vibrio-cholerae/

... ... Notes from the Field: Outbreak of Vibrio cholerae Associated with Attending a Funeral - Chegutu District, Zimbabwe, 2018 ... "Notes from the Field: Outbreak of Vibrio cholerae Associated with Attending a Funeral - Chegutu District, Zimbabwe, 2018" vol. ... Title : Notes from the Field: Outbreak of Vibrio cholerae Associated with Attending a Funeral - Chegutu District, Zimbabwe, ...

https://stacks.cdc.gov/view/cdc/57349

... A Bacterium Reaches Out and Grabs Some New DNA Posted on July 19th, 2018. by Dr. Francis Collins ... Tags: antibiotic resistance, bacteria, cholera, DNA, horizontal gene transfer, imaging, microbiology, pili, pilus, Vibrio ... Specifically, you see Vibrio cholerae, the water-dwelling bacterium that causes cholera, stretching out a hair-like appendage ...

https://directorsblog.nih.gov/tag/vibrio-cholerae/

... from Vibrio sp. EJY3. Plus protein sequence and external database links. ... Domain assignment for gi,375262335,ref,YP_005024565.1, from Vibrio sp. EJY3. Domain architecture ... hypothetical protein VEJY3_15851 [Vibrio sp. EJY3]. Sequence. MAKLTIFYDGTCPLCAKEMRALTKRDTHQHIRIVDIYSEAFSAYPQIDAAKANTILHALD ...

https://supfam.mrc-lmb.cam.ac.uk/SUPERFAMILY/cgi-bin/gene.cgi?genome=ABf&seqid=gi%7C375262335%7Cref%7CYP_005024565.1%7C

Vibrio cholera infections and noncholera Vibrio infections. (medscape.com)
A review of Cholera and Other Vibrio Illness Surveillance (COVIS) data from 1997-2006 reported that of 4754 Vibrio species-related illnesses, 1210 (25%) were nonfoodborne Vibrio infections (NFVIs). (medscape.com)
Vibrio cholerae is a noninvasive enteric bacterium that causes the severe diarrheal disease cholera. (nih.gov)
Specifically, you see Vibrio cholerae , the water-dwelling bacterium that causes cholera, stretching out a hair-like appendage called a pilus (green) to snag a free snippet of DNA (red). (nih.gov)
In collaboration with Wim Hol (UW) we studied the structure of the vibrio cholera toxin secretion channel. (ucla.edu)
The T2SS is responsible for the secretion of virulence factors such as cholera toxin (CT) and heat-labile enterotoxin (LT) from Vibrio cholerae and enterotoxigenic Escherichia coli, respectively. (ucla.edu)
Cholera is caused by the bacteria Vibrio cholerae . (nih.gov)
Gotuzzo E, Seas C. Cholera and other vibrio infections. (nih.gov)

Newswise - DALLAS - Aug. 18, 2020 - As soon as the foodborne pathogen Vibrio parahaemolyticus infects a human intestinal cell, the bacteria are already planning their escape. (newswise.com)
The mosaic-structured Vibrio cholerae genome points to the importance of horizontal gene transfer (HGT) in the evolution of this human pathogen. (nih.gov)
The food-borne opportunistic human pathogen Vibrio vulnificus has a well-conserved QS system consisting of the homologues of V. harveyi autoinducer-2 (AI-2) signaling components. (snu.ac.kr)

Information on this website focuses on Vibrio species causing vibriosis. (cdc.gov)
Other Vibrio species. (cdc.gov)
Historically, the noncholera Vibrio species are classified as halophilic or nonhalophilic, depending on their requirement of sodium chloride for growth. (medscape.com)
In 2007, the surveillance was expanded to national notification of infections caused by any Vibrio species. (medscape.com)
Although V parahaemolyticus is the most common noncholera Vibrio species reported to cause infection, V vulnificus is associated with up to 94% of noncholera Vibrio infection-related deaths. (medscape.com)
Tigecycline, a novel glycylcycline, has a potent in vitro antimicrobial effect against Vibrio species. (medscape.com)
About a dozen species of Vibrio are pathogenic to humans. (cdc.gov)
Unlike other Vibrio species, V. vulnificus is primarily transmitted through open-wound contact with salt water or brackish water, but occasionally (in approximately 10% of cases) the bacteria also can infect people if they eat raw or undercooked shellfish. (cdc.gov)
Like other members of the Vibrio genus, this species is motile, with a single, polar flagellum. (artomyst.com)

In 2020, a new serotype of Vibrio parahaemolyticus O10:K4 emerged and caused several outbreaks and sporadic cases in Guangxi, China. (cdc.gov)
IMSEAR at SEARO: Antibiotic sensitivity of Vibrio cholerae other than O serotype 1 (so-called NAG vibrios). (who.int)
Sanyal SC, Mukherjee S, Sil J. Antibiotic sensitivity of Vibrio cholerae other than O serotype 1 (so-called NAG vibrios). (who.int)

Selection and application of methods for the detection and enumeration of human-pathogenic halophilic vibrio spp. (who.int)
Vibrio parahaemolyticus is a halophilic bacterium distributed naturally in marine and estuarine environments. (cdc.gov)

Vibrio vulnificus infection reporting on death certificates: The invisible impact of an often fatal infection. (cdc.gov)
In 2011, the CDC estimated about 80,000 cases of Vibrio infections in the United States annually, including 45,000 cases of Vibrio parahaemolyticus infection and approximately 100 cases of Vibrio vulnificus infection. (medscape.com)

Image of Vibrio parahaemolyticus bacteria trapped in a host cell. (outbreaknewstoday.com)

Syndromes of Vibrio vulnificus infections. (cdc.gov)
Because most Vibrio infections are associated with the consumption of contaminated food, these infections are often considered a foodborne disease. (medscape.com)
The prevalence of noncholera Vibrio infections in the United States appears to have increased in recent years. (medscape.com)
Since 1988, the CDC has maintained a voluntary surveillance system for culture-confirmed Vibrio infections in the Gulf Coast region (Alabama, Florida, Louisiana, Mississippi, and Texas). (medscape.com)
In the event of a natural disaster, the disturbance to the environment may increase the risk of infectious diseases such as Vibrio infections. (medscape.com)
During the 2 weeks following Hurricane Katrina in August 2005, the CDC reported 22 new cases of Vibrio infections in Louisiana and Mississippi. (medscape.com)
[ 8 ] The increased incidence of Vibrio wound infections in the residents of Gulf Coast states was most likely associated with the exposure of skin and soft-tissue injuries to the contaminated floodwaters. (medscape.com)
Among children with serious noncholera Vibrio infections in whom tetracycline and fluoroquinolone are contraindicated, trimethoprim-sulfamethoxazole plus an aminoglycoside (eg, gentamicin) is recommended. (medscape.com)
Other newer antibiotics such as daptomycin and linezolid that were approved for the treatment of serious skin and soft-tissue infections have not been studied in serious Vibrio infections. (medscape.com)
Therefore, the authors do not recommend the use of these antibiotics in the treatment of serious Vibrio infections. (medscape.com)
Notify healthcare providers, laboratories, and public health departments about recent reports of fatal Vibrio vulnificus ( V. vulnificus ) infections, including wound and foodborne infections. (cdc.gov)
Extreme weather events, such as coastal floods, hurricanes, and storm surges, can force coastal waters into inland areas, putting people that are exposed to these waters-especially evacuees who are older or have underlying health conditions-at increased risk for Vibrio wound infections. (cdc.gov)
Vibrio vulnificus infections is worldwide public health problems associated with illnesses resulting from consumption of raw or partially cooked seafood worldwide. (ukessays.com)
Three major syndromes of clinical illness caused by pathogenic vibrio: septicemia, gastroenteritis and wound infections. (ukessays.com)

The type II secretion system (T2SS) is a macromolecular complex spanning the bacterial inner and outer membranes of Gram-negative bacteria, including many pathogenic bacteria such as Vibrio cholerae and enterotoxigenic Escherichia coli . (ucla.edu)

Compared with data from 2016-2018, the incidence in 2019 increased significantly for Cyclospora (1,209%), Yersinia (153%), Vibrio (79%), STEC (34%), and Campylobacter (13%), according to a CDC report. (medscape.com)
Although Campylobacter , Listeria , Salmonella , Vibrio and Cryptosporidium are up, Shigella , E. coli O157:H7 and Yersinia are down that does not seem to justify a late Friday night posting on the CDC's website. (marlerblog.com)

Draft genome sequences of eight Vibrio sp. (cdc.gov)
Complete genome sequence of Vibrio sp. (cdc.gov)

clinical isolates from across the United States that form a basal sister clade to Vibrio cholerae . (cdc.gov)
isolates from across the United States closely related to Vibrio cholerae . (cdc.gov)

hypothetical protein VEJY3_15851 [Vibrio sp. (cam.ac.uk)

In 2009, an outbreak of Vibrio parahaemolyticus occurred from clinical samples of patients with symptoms of gas- in Piura, Cajamarca, Lambayeque, and Lima, Peru. (cdc.gov)

Because clinical laboratories do not routinely use the selective medium thiosulfate-citrate-bile salts-sucrose (TCBS) for stool culture, many cases of Vibrio gastroenteritis are not identified. (medscape.com)
Results of assays of clinical Vibrio fluvialis strains to determine ability to lyse rabbit erythrocytes and cytotoxic effect on CHO and HeLa cells. (cdc.gov)

ABSTRACT In the past decade the importance of non-O1 and non-O139 strains of Vibrio cholerae has been highlighted globally. (who.int)

That's because Vibrio bacteria thrive in coastal waters where oysters are harvested. (cdc.gov)
Vibrio bacteria are found in warm seawater and humans become infected by eating raw shellfish such as oysters. (newswise.com)
Most people get infected with Vibrio by eating raw or undercooked shellfish, particularly oysters. (cdc.gov)

The marine bacterium Vibrio harveyi ATCC BAA-1116 channels the information of three AI signals into one QS cascade. (cipsm.de)
식품 유래 기회감염성 병원균인 패혈증 비브리오균 (Vibrio vulnificus) 역시 비브리오 하비아이 (V. harveyi)의 자기유도인자-2 (autoinducer-2) 신호전달 체계의 상동단백질들로 이루어진, 잘 보존된 정족수 인식 시스템을 지니고 있다. (snu.ac.kr)

Vibrio cases are increasing at a higher rate than many other bacterial pathogens in the U.S., which could be due in part to Vibrio bacteria populations in coastal waters expanding with rising sea surface temperatures, Lipp said. (phys.org)
Vibrio naturally live in coastal waters, including salt water and brackish water, which is a mixture of salt water and fresh water. (cdc.gov)

Vibrio are bacteria that cause an estimated 80,000 illnesses each year in the United States. (cdc.gov)

Not only did they observe that dissolved iron increases in ocean surface water as the dust arrived, but Vibrio grew from a background level of just 1 percent to almost 20 percent of the total microbial community within 24 hours of exposure. (phys.org)
Although Westrich and Lipp did not examine health impacts in this study, they did speculate how dust-related Vibrio blooms could affect exposure in humans. (phys.org)
The effect of exposure to artificial sea water (ASW) on the ability of classical Vibrio cholerae O1 cells to interact with chitin-containing substrates and human intestinal cells was studied. (umd.edu)

Most people with Vibrio infection have diarrhea. (cdc.gov)

Transcriptional responses of intestinal epithelial cells to infection with Vibrio cholerae. (nih.gov)

Vibrio bacteria, common to ocean waters worldwide, are probably best known for their ability to cause serious illness in humans and other marine organisms. (phys.org)
Vibrio parahaemolyticus is a Gram-negative, curved, rod-shaped bacterium found in the sea and in estuaries which, when ingested, can cause gastrointestinal illness in humans. (artomyst.com)

While we are interested in how the population dynamics of Vibrio might cause disease, for this study we wanted to use Vibrio 's opportunistic behavior as a model for how bacteria could exploit the availability of new nutrients and, in particular, iron delivered in dust. (phys.org)

In this review, the focus was on environmental parameters associated with incidence and distribution of clinically relevant Vibrio spp. (nih.gov)

To confirm these findings, the team traveled to sites in the Florida Keys and Barbados to measure the Vibrio growth during natural Saharan dust events. (phys.org)

In addition, molecular methods designed for detection and enumeration proved useful for predictive modeling and are described, namely in the context of prediction of environmental conditions favourable to Vibrio spp. (nih.gov)
Molecular analysis of rugosity in a Vibrio cholerae O1 El Tor phase variant. (nih.gov)

Vibrio was identified in wounds (68%), blood (20%), and "other" (18%).However, a cluster of 5 patients with V. vulnificus necrotizing fasciitis was reported in the summer months of 2017 and 2018 in connection to the Delaware Bay, a previously non-endemic area. (medscape.com)

In the laboratory, the researchers were able to show that iron in dust could cause test cultures of Vibrio to grow. (phys.org)

In a study published today in the Proceedings of the National Academy of Sciences , researchers from the University of Georgia found that Vibrio bacteria respond rapidly to this influx of iron-rich Saharan dust, leading to large blooms of the potentially harmful bacteria in ocean surface water. (phys.org)

Vibrio , they showed, uses a common bacterial system known as the type 3 secretion system 2 (T3SS2) to invade cells and begin replicating. (newswise.com)

Anatomy1

Organisms18

Diseases4

Chemicals and Drugs11

Analytical, Diagnostic and Therapeutic Techniques and Equipment6

Phenomena and Processes9

Disciplines and Occupations3

Technology, Industry, Agriculture4

Information Science4

Health Care4

Geographicals1

Reassessment of the taxonomic position of Vibrio iliopiscarius (Onarheim et al. 1994) and proposal for Photobacterium iliopiscarium comb. nov. (1/1761)

Inhibition of vibrio anguillarum by Pseudomonas fluorescens AH2, a possible probiotic treatment of fish. (2/1761)

Effects of salinity and temperature on long-term survival of the eel pathogen Vibrio vulnificus biotype 2 (serovar E). (3/1761)

Randomly amplified polymorphic DNA analysis of clinical and environmental isolates of Vibrio vulnificus and other vibrio species. (4/1761)

Arbitrarily primed PCR to type Vibrio spp. pathogenic for shrimp. (5/1761)

Isolation of Vibrio vulnificus serovar E from aquatic habitats in Taiwan. (6/1761)

Mechanosensitive channel functions to alleviate the cell lysis of marine bacterium, Vibrio alginolyticus, by osmotic downshock. (7/1761)

The polar flagellar motor of Vibrio cholerae is driven by an Na+ motive force. (8/1761)

Vibrio

Vibrio cholerae

Vibrio Infections

Vibrio parahaemolyticus

Vibrio vulnificus

Vibrio cholerae O1

Vibrio alginolyticus

Cholera

Vibrio cholerae O139

Vibrio mimicus

Vibrio cholerae non-O1

Aliivibrio fischeri

Ostreidae

Cholera Toxin

Shellfish

Water Microbiology

Bacterial Proteins

Seawater

DNA, Bacterial

Hemolysin Proteins

Cholera Vaccines

Gene Expression Regulation, Bacterial

Molecular Sequence Data

Genes, Bacterial

Virulence

Quorum Sensing

Fish Diseases

Decapodiformes

Aquaculture

Eels

Sequence Analysis, DNA

Bacterial Typing Techniques

Flagella

Culture Media

Environmental Microbiology

Luminescence

Virulence Factors

Phylogeny

Base Sequence

Decapoda (Crustacea)

Siderophores

Bangladesh

Bacterial Outer Membrane Proteins

Amino Acid Sequence

O Antigens

Bacteriophages

Fimbriae Proteins

Photobacterium

Luminescent Measurements

Food Microbiology

Seafood

Colony Count, Microbial

Escherichia coli

Serotyping

Penaeidae

Diarrhea

Reassessment of the taxonomic position of Vibrio iliopiscarius (Onarheim et al. 1994) and proposal for Photobacterium iliopiscarium comb. nov. (1/1761)

Inhibition of vibrio anguillarum by Pseudomonas fluorescens AH2, a possible probiotic treatment of fish. (2/1761)

Effects of salinity and temperature on long-term survival of the eel pathogen Vibrio vulnificus biotype 2 (serovar E). (3/1761)

Randomly amplified polymorphic DNA analysis of clinical and environmental isolates of Vibrio vulnificus and other vibrio species. (4/1761)

Arbitrarily primed PCR to type Vibrio spp. pathogenic for shrimp. (5/1761)

Isolation of Vibrio vulnificus serovar E from aquatic habitats in Taiwan. (6/1761)

Mechanosensitive channel functions to alleviate the cell lysis of marine bacterium, Vibrio alginolyticus, by osmotic downshock. (7/1761)

The polar flagellar motor of Vibrio cholerae is driven by an Na+ motive force. (8/1761)

Vibrio

Vibrio aerogenes

Vibrio pelagius

Vibrio vulnificus

Vibrio pectenicida

Vibrio anguillarum

Vibrio lentus

Vibrio parahaemolyticus

Vibrio mimicus

Vibrio fluvialis

Vibrio coralliilyticus

Vibrio diabolicus

Vibrio harveyi

Vibrio campbellii

Vibrio azureus

Vibrio furnissii