AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesTechnology, Industry, AgricultureInformation Science
Two-Hybrid System TechniquesHybridization, GeneticHybrid CellsMolecular Sequence DataArtificial IntelligenceProtein BindingAmino Acid SequenceProteinsAlgorithmsBase SequenceRecombinant Fusion ProteinsCloning, MolecularBinding SitesHybrid VigorChimeraRadiation Hybrid MappingCrosses, GeneticChromosome MappingNucleic Acid HybridizationSpecies SpecificityGenetic SpeciationGenesCell FusionEscherichia coliTriploidyKaryotypingCell LineGenetic MarkersPolyploidyPlasmidsHelianthus
Two-Hybrid System Techniques
Screening techniques first developed in yeast to identify genes encoding interacting proteins. Variations are used to evaluate interplay between proteins and other molecules. Two-hybrid techniques refer to analysis for protein-protein interactions, one-hybrid for DNA-protein interactions, three-hybrid interactions for RNA-protein interactions or ligand-based interactions. Reverse n-hybrid techniques refer to analysis for mutations or other small molecules that dissociate known interactions.
Hybridization, Genetic
The genetic process of crossbreeding between genetically dissimilar parents to produce a hybrid.
Hybrid Cells
Any cell, other than a ZYGOTE, that contains elements (such as NUCLEI and CYTOPLASM) from two or more different cells, usually produced by artificial CELL FUSION.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Artificial Intelligence
Theory and development of COMPUTER SYSTEMS which perform tasks that normally require human intelligence. Such tasks may include speech recognition, LEARNING; VISUAL PERCEPTION; MATHEMATICAL COMPUTING; reasoning, PROBLEM SOLVING, DECISION-MAKING, and translation of language.
Protein Binding
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Amino Acid Sequence
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Proteins
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
Algorithms
A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.
Base Sequence
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Recombinant Fusion Proteins
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
Cloning, Molecular
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Binding Sites
The parts of a macromolecule that directly participate in its specific combination with another molecule.
Hybrid Vigor
The adaptive superiority of the heterozygous GENOTYPE with respect to one or more characters in comparison with the corresponding HOMOZYGOTE.
Chimera
An individual that contains cell populations derived from different zygotes.
Radiation Hybrid Mapping
A method for ordering genetic loci along CHROMOSOMES. The method involves fusing irradiated donor cells with host cells from another species. Following cell fusion, fragments of DNA from the irradiated cells become integrated into the chromosomes of the host cells. Molecular probing of DNA obtained from the fused cells is used to determine if two or more genetic loci are located within the same fragment of donor cell DNA.
Crosses, Genetic
Deliberate breeding of two different individuals that results in offspring that carry part of the genetic material of each parent. The parent organisms must be genetically compatible and may be from different varieties or closely related species.
Chromosome Mapping
Any method used for determining the location of and relative distances between genes on a chromosome.
Nucleic Acid Hybridization
Widely used technique which exploits the ability of complementary sequences in single-stranded DNAs or RNAs to pair with each other to form a double helix. Hybridization can take place between two complimentary DNA sequences, between a single-stranded DNA and a complementary RNA, or between two RNA sequences. The technique is used to detect and isolate specific sequences, measure homology, or define other characteristics of one or both strands. (Kendrew, Encyclopedia of Molecular Biology, 1994, p503)
Species Specificity
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
Genetic Speciation
The splitting of an ancestral species into daughter species that coexist in time (King, Dictionary of Genetics, 6th ed). Causal factors may include geographic isolation, HABITAT geometry, migration, REPRODUCTIVE ISOLATION, random GENETIC DRIFT and MUTATION.
Genes
A category of nucleic acid sequences that function as units of heredity and which code for the basic instructions for the development, reproduction, and maintenance of organisms.
Cell Fusion
Fusion of somatic cells in vitro or in vivo, which results in somatic cell hybridization.
Escherichia coli
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Triploidy
Polyploidy with three sets of chromosomes. Triploidy in humans are 69XXX, 69XXY, and 69XYY. It is associated with HOLOPROSENCEPHALY; ABNORMALITIES, MULTIPLE; PARTIAL HYDATIDIFORM MOLE; and MISCARRAGES.
Karyotyping
Mapping of the KARYOTYPE of a cell.
Cell Line
Established cell cultures that have the potential to propagate indefinitely.
Genetic Markers
A phenotypically recognizable genetic trait which can be used to identify a genetic locus, a linkage group, or a recombination event.
Polyploidy
The chromosomal constitution of a cell containing multiples of the normal number of CHROMOSOMES; includes triploidy (symbol: 3N), tetraploidy (symbol: 4N), etc.
Plasmids
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
Helianthus
A genus herbs of the Asteraceae family. The SEEDS yield oil and are used as food and animal feed; the roots of Helianthus tuberosus (Jerusalem artichoke) are edible.

Huckebein repressor activity in Drosophila terminal patterning is mediated by Groucho. (1/6595)

The Groucho corepressor mediates negative transcriptional regulation in association with various DNA-binding proteins in diverse developmental contexts. We have previously implicated Groucho in Drosophila embryonic terminal patterning, showing that it is required to confine tailless and huckebein terminal gap gene expression to the pole regions of the embryo. Here we reveal an additional requirement for Groucho in this developmental process by establishing that Groucho mediates repressor activity of the Huckebein protein. Putative Huckebein target genes are derepressed in embryos lacking maternal groucho activity and biochemical experiments demonstrate that Huckebein physically interacts with Groucho. Using an in vivo repression assay, we identify a functional repressor domain in Huckebein that contains an FRPW tetrapeptide, similar to the WRPW Groucho-recruitment domain found in Hairy-related repressor proteins. Mutations in Huckebein's FRPW motif abolish Groucho binding and in vivo repression activity, indicating that binding of Groucho through the FRPW motif is required for the repressor function of Huckebein. Taken together with our earlier results, these findings show that Groucho-repression regulates sequential aspects of terminal patterning in Drosophila.  (+info)

Temperature-sensitive RB mutations linked to incomplete penetrance of familial retinoblastoma in 12 families. (2/6595)

The tumor-suppressor activity of the retinoblastoma protein (RB) is encoded within a protein-binding ("pocket") domain that is targeted for mutations in all cases of familial retinoblastoma and in many common adult cancers. Although familial retinoblastoma is a paradigm for a highly penetrant, recessive model of tumorigenesis, the molecular basis for the phenotype of incomplete penetrance of familial retinoblastoma is undefined. We studied the RB pocket-binding properties of three independent, mutant RB alleles that are present in the germline of 12 kindreds with the phenotype of incomplete penetrance of familial retinoblastoma. Each arises from alterations of single codons within the RB pocket domain (designated "delta 480," "661W," or "712R"). Under the same conditions, we studied the properties of wild-type (WT) RB, an RB point mutant isolated from a lung carcinoma sample (706F) and an adjacent, in vitro-generated point mutant (707W). The delta 480, 661W, and 712R mutants lack pocket protein-binding activity in vitro but retain the WT ability to undergo cyclin-mediated phosphorylation in vivo. Each of the low-penetrant RB mutants exhibits marked enhancement of pocket protein binding when the cells are grown at reduced temperature. In contrast, in this temperature range, no change in binding activity is seen with WT RB, the 706F mutant, or the 707W mutant. We have demonstrated that many families with incomplete penetrance of familial retinoblastoma carry unstable, mutant RB alleles with temperature-sensitive pocket protein-binding activity. The variable frequency for tumor development in these families may result from reversible fluctuations in a threshold level of RB pocket-binding activity.  (+info)

MEF-2 function is modified by a novel co-repressor, MITR. (3/6595)

The MEF-2 proteins are a family of transcriptional activators that have been detected in a wide variety of cell types. In skeletal muscle cells, MEF-2 proteins interact with members of the MyoD family of transcriptional activators to synergistically activate gene expression. Similar interactions with tissue or lineage-specific cofactors may also underlie MEF-2 function in other cell types. In order to screen for such cofactors, we have used a transcriptionally inactive mutant of Xenopus MEF2D in a yeast two-hybrid screen. This approach has identified a novel protein expressed in the early embryo that binds to XMEF2D and XMEF2A. The MEF-2 interacting transcription repressor (MITR) protein binds to the N-terminal MADS/MEF-2 region of the MEF-2 proteins but does not bind to the related Xenopus MADS protein serum response factor. In the early embryo, MITR expression commences at the neurula stage within the mature somites and is subsequently restricted to the myotomal muscle. In functional assays, MITR negatively regulates MEF-2-dependent transcription and we show that this repression is mediated by direct binding of MITR to the histone deacetylase HDAC1. Thus, we propose that MITR acts as a co-repressor, recruiting a specific deacetylase to downregulate MEF-2 activity.  (+info)

MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. (4/6595)

The interaction of chromatin with the nuclear matrix via matrix attachment region (MAR) DNA is considered to be of fundamental importance for chromatin organization in all eukaryotic cells. MAR binding filament-like protein 1 (MFP1) from tomato is a novel plant protein that specifically binds to MAR DNA. Its filament protein-like structure makes it a likely candidate for a structural component of the nuclear matrix. MFP1 is located at nuclear matrix-associated, specklelike structures at the nuclear envelope. Here, we report the identification of a novel protein that specifically interacts with MFP1 in yeast two-hybrid and in vitro binding assays. MFP1 associated factor 1 (MAF1) is a small, soluble, serine/threonine-rich protein that is ubiquitously expressed and has no similarity to known proteins. MAF1, like MFP1, is located at the nuclear periphery and is a component of the nuclear matrix. These data suggest that MFP1 and MAF1 are in vivo interaction partners and that both proteins are components of a nuclear substructure, previously undescribed in plants, that connects the nuclear envelope and the internal nuclear matrix.  (+info)

Rpn9 is required for efficient assembly of the yeast 26S proteasome. (5/6595)

We have isolated the RPN9 gene by two-hybrid screening with, as bait, RPN10 (formerly SUN1), which encodes a multiubiquitin chain receptor residing in the regulatory particle of the 26S proteasome. Rpn9 is a nonessential subunit of the regulatory particle of the 26S proteasome, but the deletion of this gene results in temperature-sensitive growth. At the restrictive temperature, the Deltarpn9 strain accumulated multiubiquitinated proteins, indicating that the RPN9 function is needed for the 26S proteasome activity at a higher temperature. We analyzed the proteasome fractions separated by glycerol density gradient centrifugation by native polyacrylamide gel electrophoresis and found that a smaller amount of the 26S proteasome was produced in the Deltarpn9 cells and that the 26S proteasome was shifted to lighter fractions than expected. The incomplete proteasome complexes were found to accumulate in the Deltarpn9 cells. Furthermore, Rpn10 was not detected in the fractions containing proteasomes of the Deltarpn9 cells. These results indicate that Rpn9 is needed for incorporating Rpn10 into the 26S proteasome and that Rpn9 participates in the assembly and/or stability of the 26S proteasome.  (+info)

The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins. (6/6595)

The Rho family of GTPases plays key roles in the regulation of cell motility and morphogenesis. They also regulate protein kinase cascades, gene expression, and cell cycle progression. This multiplicity of roles requires that the Rho GTPases interact with a wide variety of downstream effector proteins. An understanding of their functions at a molecular level therefore requires the identification of the entire set of such effectors. Towards this end, we performed a two-hybrid screen using the TC10 GTPase as bait and identified a family of putative effector proteins related to MSE55, a murine stromal and epithelial cell protein of 55 kDa. We have named this family the Borg (binder of Rho GTPases) proteins. Complete open reading frames have been obtained for Borg1 through Borg3. We renamed MSE55 as Borg5. Borg1, Borg2, Borg4, and Borg5 bind both TC10 and Cdc42 in a GTP-dependent manner. Surprisingly, Borg3 bound only to Cdc42. An intact CRIB (Cdc42, Rac interactive binding) domain was required for binding. No interaction of the Borgs with Rac1 or RhoA was detectable. Three-hemagglutinin epitope (HA(3))-tagged Borg3 protein was mostly cytosolic when expressed ectopically in NIH 3T3 cells, with some accumulation in membrane ruffles. The phenotype induced by Borg3 was reminiscent of that caused by an inhibition of Rho function and was reversed by overexpression of Rho. Surprisingly, it was independent of the ability to bind Cdc42. Borg3 also inhibited Jun kinase activity by a mechanism that was independent of Cdc42 binding. HA(3)-Borg3 expression caused substantial delays in the spreading of cells on fibronectin surfaces after replating, and the spread cells lacked stress fibers. We propose that the Borg proteins function as negative regulators of Rho GTPase signaling.  (+info)

DOT4 links silencing and cell growth in Saccharomyces cerevisiae. (7/6595)

Transcriptional silencing in Saccharomyces cerevisiae occurs at specific loci and is mediated by a multiprotein complex that includes Rap1p and the Sir proteins. We studied the function of a recently identified gene, DOT4, that disrupts silencing when overexpressed. DOT4 encodes an ubiquitin processing protease (hydrolase) that is primarily located in the nucleus. By two-hybrid analysis, the amino-terminal third of Dot4p interacts with the silencing protein Sir4p. Cells lacking DOT4 exhibited reduced silencing and a corresponding decrease in the level of Sir4p. Together, these findings suggest that Dot4p regulates silencing by acting on Sir4p. In strains with several auxotrophic markers, loss of DOT4 ubiquitin hydrolase activity also results in a slow-growth defect. The defect can be partially suppressed by mutations in a subunit of the 26S proteasome, suggesting that Dot4p has the ability to prevent ubiquitin-mediated degradation. Furthermore, wild-type SIR2, SIR3, and SIR4 are required for full manifestation of the growth defect in a dot4 strain, indicating that the growth defect is caused in part by a silencing-related mechanism. We propose that Dot4p helps to restrict the location of silencing proteins to a limited set of genomic loci.  (+info)

Leukemic HRX fusion proteins inhibit GADD34-induced apoptosis and associate with the GADD34 and hSNF5/INI1 proteins. (8/6595)

One of the most common chromosomal abnormalities in acute leukemia is a reciprocal translocation involving the HRX gene (also called MLL, ALL-1, or HTRX) at chromosomal locus 11q23, resulting in the formation of HRX fusion proteins. Using the yeast two-hybrid system and human cell culture coimmunoprecipitation experiments, we show here that HRX proteins interact directly with the GADD34 protein. We have found that transfected cells overexpressing GADD34 display a significant increase in apoptosis after treatment with ionizing radiation, indicating that GADD34 expression not only correlates with apoptosis but also can enhance apoptosis. The amino-terminal third of the GADD34 protein was necessary for this observed increase in apoptosis. Furthermore, coexpression of three different HRX fusion proteins (HRX-ENL, HRX-AF9, and HRX-ELL) had an anti-apoptotic effect, abrogating GADD34-induced apoptosis. In contrast, expression of wild-type HRX gave rise to an increase in apoptosis. The difference observed here between wild-type HRX and the leukemic HRX fusion proteins suggests that inhibition of GADD34-mediated apoptosis may be important to leukemogenesis. We also show here that GADD34 binds the human SNF5/INI1 protein, a member of the SNF/SWI complex that can remodel chromatin and activate transcription. These studies demonstrate, for the first time, a gain of function for leukemic HRX fusion proteins compared to wild-type protein. We propose that the role of HRX fusion proteins as negative regulators of post-DNA-damage-induced apoptosis is important to leukemia progression.  (+info)

Identification of CAR/RXRα Hetero-dimer Binding Sites in the Human Genome by a Modified Yeast One-Hybrid AssayIdentification of CAR/RXRα Hetero-dimer Binding Sites in the Human Genome by a Modified Yeast One-Hybrid Assay
The constitutive androstane receptor (CAR) is a transcription factor that belongs to the nuclear receptor superfamily. CAR binds as a heterodimer with the retinoid X receptor α (RXRα) to CAR response elements (CAREs) and regulates the expression of various drug metabolizing enzymes and transporters. To identify CAR/RXRα binding sites in the human genome, we performed a modified yeast one-hybrid assay that enables rapid and efficient identification of genomic targets for DNA-binding proteins. DNA fragments were recovered from positive yeast colonies by PCR and sequenced. A motif enrichment analysis revealed that the most frequent motif was a direct repeat (DR) of RGKTCA-like core sequence spaced by 4 bp. Next, we predicted 149 putative CAR/RXRα binding sites from 414 unique clones, by searching for DRs, everted repeats (ERs) and inverted repeats (IRs) of the RGKTCA-like core motif. Based on gel mobility shift assays, the CAR/RXRα heterodimer could directly interact with the 108 predicted sequences,
https://file.scirp.org/Html/5-1350305_55170.htm
Analysis of Mammalian Peroxin Interactions Using a Non-transcription-based Bacterial Two-hybrid Assay | Molecular & Cellular...Analysis of Mammalian Peroxin Interactions Using a Non-transcription-based Bacterial Two-hybrid Assay | Molecular & Cellular...
In recent years, substantial progress has been made in the identification of proteins involved in peroxisome biogenesis. However, with the exception of the peroxisome-targeting signal receptors and the receptor docking proteins, the function of most of these proteins, called peroxins, remains largely unknown. One step toward elucidating the function of a protein is to identify its interacting partners. We have used a non-transcription-based bacterial two-hybrid system to analyze the interactions among a set of 12 mammalian peroxins and a yeast protein three-hybrid system to investigate whether proteins that interact with the same peroxin and have overlapping binding sites cooperate or compete for this site. Here we report a detailed interaction map of these peroxins and demonstrate that (i) farnesylation, and not the CAAX motif, of Pex19p strongly enhances its affinity for Pex13p; (ii) the CAAXmotif, and not farnesylation, of Pex19p strongly enhances its affinity for Pex11pβ; and (iii) the ...
https://www.mcponline.org/content/1/3/243.abstract
GAL4 Antibodies for Yeast Two-Hybrid StudiesGAL4 Antibodies for Yeast Two-Hybrid Studies
GAL4 Antibodies for Yeast Two-Hybrid StudiesGAL4 Antibodies for Yeast Two-Hybrid Studies
Novel Interactome of Saccharomyces cerevisiae Myosin Type II Identified by a Modified Integrated Membrane Yeast Two-Hybrid ...Novel Interactome of Saccharomyces cerevisiae Myosin Type II Identified by a Modified Integrated Membrane Yeast Two-Hybrid ...
To capture the Myo1p-interacting proteins for in vitro validation of the physical interactions identified by iMYTH, and for their subsequent identification by coimmunoprecipitation (coIP), we employed a modified pull-down approach (Babu et al. 2009) using a TAP epitope fused to the Myo1p C-terminus (Myo1-TAP). The Myo1-TAP bait strain was transformed with a full-length prey protein in expression vector BG1805, a URA3 multicopy 2 μ plasmid containing a GAL1 promoter (Gelperin et al. 2005), using the standard lithium acetate procedure (Gietz and Woods 2006). The Myo1 protein was captured using the calmodulin-binding peptide in the TAP epitope. Briefly, 40 ml of culture was grown for 2 d in YPD at 30° at 200 rpm. Subsequently, the cells were centrifuged at 3000 rpm for 3 min, and washed twice with 20 ml IPLB buffer (20 mM Hepes KOH, pH 7.4, 150 mM KOAc, 2 mM Mg(Ac)2, 2 mM CaCl2, and 10% glycerol). For plasmid expression, cells were resuspended in YP-GAL, and incubated for 2-4 hr. The yeast cells ...
http://www.g3journal.org/content/6/5/1469
Yeast strains for yeast two-hybrid screening
Easy two-hybrid library construction enriched for longer inserts. Two highly specialized yeast strains that are optimized for exceptionally stringent two-hybrid library screening and two-hybrid library construction.
https://cellartis.com/products/protein-research/two-hybrid-and-one-hybrid-systems/yeast-two-hybrid-system/yeast-strains
The PHD finger protein 5 is a part of the spliceosome and acts as a DNA-binding protein - ...The PHD finger protein 5 is a part of the spliceosome and acts as a DNA-binding protein - ...
Four proteins namely U2AF35, SRp40, mDomino and Ddx1 were identified as PHF5a interacting partners by using the murine 11.5-days embryo yeast two-hybrid library screening.PHF5a interacting domains of SR proteins U2AF35 and SRp40 were restricted to Cterminal arginine-serine rich domains (RS).Other members of the SR protein family namely SRp20, SRp30c and ASF/SF2 were shown that they can not bind to the PHF5a protein by using a directed yeast twohybrid assay and the a-galactosidase assay.Protein interactions between PHF5a and U2AF35, SRp40, mDomino and Ddx1 were verified by using in vitro coimmmunoprecipitation assays.Mapping of binding sites by using coimmunoprecipitation experiments and a directed yeast two-hybrid assay demonstrated that both ATP-dependent helicases mDomino and Ddx1 interact with the C-terminal segment of PHF5a. In addition, the N-terminal part of PHF5a was identified as a region responsible for binding to splicing proteins U2AF35 and SRp40. By using the yeast-three hybrid assay ...
https://ediss.uni-goettingen.de/handle/11858/00-1735-0000-0006-ABA9-F
The cationic region of Rhes mediates its interactions with specific Gβ subunits - WRAP: Warwick Research Archive PortalThe cationic region of Rhes mediates its interactions with specific Gβ subunits - WRAP: Warwick Research Archive Portal
proteins function in similar ways. AGS1 binds to the Gβ1 subunit of heterotrimeric G proteins and we have used yeast two-hybrid studies to show that Rhes binds selectively to Gβ1, Gβ2 and Gβ3 subunits. Binding to the Gβ subunits involves the cationic regions of AGS1 and Rhes, and we used Rhes-AGS1 chimeras to show that their different cationic regions determine the Gβ-specificity of the interactions. Possible implications of this interaction for the activity of Rhes are discussed.. ...
http://wrap.warwick.ac.uk/361/
An overview of the Yeast one-hybrid assay - Bitesize BioAn overview of the Yeast one-hybrid assay - Bitesize Bio
If you are regularly doing ChIP-qPCR, ChIP-RNAseq or luciferase reporter assays to measure protein-DNA interactions, then this article is for you! ChIP
https://bitesizebio.com/25900/an-overview-of-the-yeast-one-hybrid-assay/
mRNA Processing (Homo sapiens) - WikiPathwaysmRNA Processing (Homo sapiens) - WikiPathways
PMID: 14559993. SRrp86 is a unique member of the SR protein superfamily containing one RNA recognition motif and two serine-arginine (SR)-rich domains separated by an unusual glutamic acid-lysine (EK)-rich region. Previously, we showed that SRrp86 could regulate alternative splicing by both positively and negatively modulating the activity of other SR proteins and that the unique EK domain could inhibit both constitutive and alternative splicing. These functions were most consistent with the model in which SRrp86 functions by interacting with and thereby modulating the activity of target proteins. To identify the specific proteins that interact with SRrp86, we used a yeast two-hybrid library screen and immunoprecipitation coupled to mass spectrometry. We show that SRrp86 interacts with all of the core SR proteins, as well as a subset of other splicing regulatory proteins, including SAF-B, hnRNP G, YB-1, and p72. In contrast to previous results that showed activation of SRp20 by SRrp86, we now ...
https://www.wikipathways.org/index.php/WP411_r79980?title=Pathway:WP411&oldid=79980
Plantae | Author: Chunhua Zhang | PlantaePlantae | Author: Chunhua Zhang | Plantae
Protein-protein interactions mediate fundamental biological processes. Yeast two-hybrid assays can be used to detect protein-protein interactions in a fast and large-scale manner. However, in traditional yeast-two hybrid assays, the prey and bait proteins must be located in the nucleus to activate reporter genes. This requirement limits the application of this assay in detecting membrane protein ...
https://plantae.org/author/czhang/
Molecular Partners AG, Product Pipeline Review, 2015Molecular Partners AG, Product Pipeline Review, 2015
Molecular Partners AG-Product Pipeline Review-2015. Summary. Global Markets Directs, Molecular Partners AG-Product Pipeline Review-2015, provides an overview of the Molecular Partners AGs pharmaceutical research and development focus.. This report provides comprehensive information on the current therapeutic developmental pipeline of Molecular Partners AGs, complete with comparative analysis at various stages, therapeutics assessment by drug target, mechanism of action (MoA), route of administration (RoA) and molecule type. It also reviews latest updates, and featured news and press releases, along with special features on late-stage and discontinued projects.. Global Markets Directs report features investigational drugs from across globe covering over 20 therapy areas and nearly 3,000 indications. The report is built using data and information sourced from Global Markets Directs proprietary databases, Company/University websites, SEC filings, investor presentations and featured press ...
https://www.kenresearch.com/healthcare/pharmaceuticals/molecular-partners-ag-product-pipeline/10249-91.html
Coronavirus company news summary - Sanofi and GSK begin Phase III Covid-19 vaccine trial - Novartis and Molecular Partners...Coronavirus company news summary - Sanofi and GSK begin Phase III Covid-19 vaccine trial - Novartis and Molecular Partners...
Sanofi and GlaxoSmithKline have begun enrolling participants into a Phase III clinical study of their adjuvanted recombinant-protein Covid-19 vaccine candidate. The global randomised, double-blinded, placebo-controlled study will include about 35,000 volunteers aged 18 years and older from different countries, including sites in Asia, Africa, the US and Latin America. The study will assess vaccine formulations targeting the original D.614 virus and the B.1.351 variant across geographies. A booster trial is likely to begin in the coming weeks, with the vaccine expected to be approved by the end of 2021.. Novartis and Switzerland-based biopharma Molecular Partners have commenced the EMPATHY clinical trial, a Phase II and III study exploring the use of its DARPin therapeutic candidate ensovibep (MP0420) for treating Covid-19. Novartis is expected to conduct the clinical trial programme, with Molecular Partners as sponsor of the trials. Molecular Partners reported positive results from its initial ...
https://www.pharmaceutical-technology.com/uncategorised/coronavirus-company-news-summary-sanofi-and-gsk-begin-phase-iii-covid-19-vaccine-trial-novartis-and-molecular-partners-commence-phase-ii-iii-studies-of-covid-19-treatment-candidate/
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinities - Laboratoire de Biologie...A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinities - Laboratoire de Biologie...
We present a technological advancement for the estimation of the affinities of Protein-Protein Interactions (PPIs) in living cells. A novel set of vectors is introduced that enables a quantitative yeast two-hybrid system based on fluorescent fusion proteins. The vectors allow simultaneous quantification of the reaction partners (Bait and Prey) and the reporter at the single-cell level by flow cytometry. We validate the applicability of this system on a small but diverse set of PPIs (eleven protein families from six organisms) with different affinities; the dissociation constants range from 117 pM to 17 µM. After only two hours of reaction, expression of the reporter can be detected even for the weakest PPI. Through a simple gating analysis, it is possible to select only cells with identical expression levels of the reaction partners. As a result of this standardization of expression levels, the mean reporter levels directly reflect the affinities of the studied PPIs. With a set of PPIs with known
http://www.ens-lyon.fr/LBMC/equipes/simbio/publications/Cluetmcp.TIR119.001692?set_language=fr&cl=fr
Donnelly Centre for Cellular and Biomolecular ResearchDonnelly Centre for Cellular and Biomolecular Research
Research in our lab is focused on membrane protein-protein interactions (PPIs), with a particular interest in disease progression due to altered signalling pathways. To this end, the lab has developed two new technologies to enable research in this notoriously difficult environment.. The first was the Membrane Yeast Two-Hybrid (MYTH) system. Based on the split-ubiquitin principle, bait and prey proteins are fused to Cub (C-terminal ubiquitin domain) plus a transcription factor (TF) and NubG (N-terminal domain, I13G mutation), respectively. A bait and prey interaction brings the two domains of ubiquitin into close proximity, forming pseudo-ubiquitin. This is recognized by deubiquitinating enzymes, which cleave off the TF. The TF enters the nucleus and activates a reporter system, allowing detection of interacting proteins.. MYTH has been successfully used in a number of studies, including building a comprehensive map of the yeast ABC transporter interactome (Snider et al. [2013] Nature ...
https://thedonnellycentre.utoronto.ca/content/igor-stagljar
Asian Science Citation Index - Articles written by S. K RayalaAsian Science Citation Index - Articles written by S. K Rayala
Alternative splicing of precursor mRNA is a fundamental mechanism to generate multiple proteins from a single gene. Although constitutive and alternative mRNA splicing is temporally and spatially regulated, deregulation of mRNA splicing could cause development, progression, and metastasis of tumors. Through yeast two-hybrid screening of a human breast cDNA library using estrogen receptor- (ER) as bait, we identified a novel nuclear receptor box containing full-length protein, nuclear protein E3-3 (NPE3-3). Our results revealed that NPE3-3 associates with not only ER but also with splicing factors, serine/arginine-rich protein (SRp)-30c, SRp40, and splicing factor SC-35, suggesting that NPE3-3 is likely to be involved in regulation of mRNA splicing. Accordingly, transient expression of NPE3-3 in cells resulted in expected splicing of the CD44 control minigene. We also discovered that NPE3-3-overexpressing clones produced a novel, previously unrecognized, alternatively spliced variant of ER ...
https://scialert.net/asci/author.php?author=S.%20K&last=Rayala
yeast two-hybridyeast two-hybrid
Dear colleagues, We are maintaining a Web page devoted to the yeast two-hybrid system. An integral part of this page is a database of false positives, isolated in two-hybrid screenings. We are also trying to analyze the parameters of YTH screens to suggest the optimal settings. We are asking for a favor: if you completed a YTH screen (does not matter if it was a success or a failure), please fill out our questionnaire on the Web page. It is our sincere hope that analysis of these data will be helpful for the scientific community. Our Web page also contains a lot of YTH-related information: list of plasmids, libraries, maps, sequences, protocols etc. http://www.fccc.edu/research/labs/golemis/InteractionTrapInWork.html Best regards, Ilya Serebriiskii ______________O_________oO_____________oO______o_______oO___________________ YEAST bionet newsgroup see: http://www.bio.net/hypermail/YEAST/ YEAST e-mail: messages sent to yeast at net.bio.net subscribe: e-mail biosci-server at net.bio.net with: ...
http://bio.net/bionet/mm/yeast/2001-June/009916.html
Plus itPlus it
Activation of PXR by Tian Xian in Cell-Based Assays. To determine the extent to which the extract of tian xian activated human PXR we used a previously described cell-based reporter gene assay (Brobst et al., 2004). In CV-1 cells, 10 μM rifampicin activated the XREM-LUC reporter gene in the presence of transfected human PXR (Fig. 1). A stock extract of tian xian (250 mg/ml) was used to treat transfected CV-1 cells. A clear concentration response was also observed with increasing amounts of tian xian extract (Fig. 1). Thus, in CV-1 cells an extract of tian xian produced efficacious activation of human PXR. The activation of PXR by tian xian at the highest concentrations examined was comparable with that of 10 μM rifampicin, a well known PXR ligand.. Modulation of PXR-Cofactor Interactions in the Mammalian Two-Hybrid System. The interaction between accessory protein cofactors and PXR is modulated by the presence of activating ligands in cells. Specifically, in the absence of activating ligands ...
http://dmd.aspetjournals.org/content/36/8/1538
PMID:20231441 - GONUTSPMID:20231441 - GONUTS
The Bcl-2-associated athanogene (BAG) family is an evolutionarily conserved, multifunctional group of cochaperones that perform diverse cellular functions ranging from proliferation to growth arrest and cell death in yeast, in mammals, and, as recently observed, in plants. The Arabidopsis genome contains seven homologs of the BAG family, including four with domain organization similar to animal BAGs. In the present study we show that an Arabidopsis BAG, AtBAG7, is a uniquely localized endoplasmic reticulum (ER) BAG that is necessary for the proper maintenance of the unfolded protein response (UPR). AtBAG7 was shown to interact directly in vivo with the molecular chaperone, AtBiP2, by bimolecular fluorescence complementation assays, and the interaction was confirmed by yeast two-hybrid assay. Treatment with an inducer of UPR, tunicamycin, resulted in accelerated cell death of AtBAG7-null mutants. Furthermore, AtBAG7 knockouts were sensitive to known ER stress stimuli, heat and cold. In these ...
https://gowiki.tamu.edu/wiki/index.php/PMID:20231441
Two-hybrid screening | ChromotekTwo-hybrid screening | Chromotek
The fluorescent two-hybrid assay (F2H) is a technique for the validation and characterization of protein-protein interactions in vivo. It can be used for studying the modulation of interactions with inhibitors or activators, for compound screening and for confirmation of results from other protein-protein interaction screens such as co-immunoprecipitation studies.. In short, two proteins, bait and prey protein, are fused to GFP and RFP, respectively. A BHK cell line is transformed with ChromoTeks F2H platform reagent and two DNA plasmids coding for the GFP-bait protein and the RFP-prey protein. The interaction of bait protein and prey protein can be detected by co-localization of a green and a red fluorescent spot in the nucleus of the BHK cells with an epi-fluorescence microscope.. PRODUCTS ...
https://www.chromotek.com/applications/detail/applications-detail/two-hybrid-screening/
Two-hybrid screening | ChromotekTwo-hybrid screening | Chromotek
The fluorescent two-hybrid assay (F2H) is a technique for the validation and characterization of protein-protein interactions in vivo. It can be used for studying the modulation of interactions with inhibitors or activators, for compound screening and for confirmation of results from other protein-protein interaction screens such as co-immunoprecipitation studies.. In short, two proteins, bait and prey protein, are fused to GFP and RFP, respectively. A BHK cell line is transformed with ChromoTeks F2H platform reagent and two DNA plasmids coding for the GFP-bait protein and the RFP-prey protein. The interaction of bait protein and prey protein can be detected by co-localization of a green and a red fluorescent spot in the nucleus of the BHK cells with an epi-fluorescence microscope.. PRODUCTS ...
https://www.chromotek.com/applications/detail/applications-detail/two-hybrid-screening/applications/
Study of Proteins in Head and Neck Cancer Cells - Full Text View - ClinicalTrials.govStudy of Proteins in Head and Neck Cancer Cells - Full Text View - ClinicalTrials.gov
OUTLINE: Using molecular laboratory techniques, this study examines the biochemical mechanisms by which LZAP activates transcriptional, tumor suppressive activity (both p53-dependent and p53-independent) of ARF and inhibits transcriptional, tumorigenic activity of NF-kB. LZAP regulation of newly identified ARF activities, such as S-phase delay and ARF-mediated B23 degradation are also evaluated. LZAPs tumor suppressive activity is assessed in vivo using a conditional knockout vector to target LZAP in mice and to observe for spontaneous and induced tumor formation. Laboratory analyses used to determine study endpoints include standard recombinant DNA, recombinant protein expression and purification, cell culture and transfection, cell labeling, reporter assays, flow cytometry, yeast-two hybrid, immunoprecipitation, immunoblotting, immunofluorescence, TUNEL assay, ELISA assay, Southern blotting, and protein and gene expression. ...
https://clinicaltrials.gov/ct2/show/NCT00896948
coimmunoprecipitation - Immunology and Histologycoimmunoprecipitation - Immunology and Histology
I have a protein-protein interaction that I have originally detected in bacterial two-hybrid system and pull-down experiments with bacterially expressed proteins also show positive interaction. Now I would like to confirm this interaction also in eukaryotic cells by coimmunoprecipitating the two. Since I do not have antibodies for these proteins, I am using GFP -(Bait) and HA-tagged (target) proteins and thus transfected cells. I have performed the experiment couple of times, and it kind of looks promising: I have positive interaction when the two proteins are present and all negative controls are negative. What makes me doubt is that I do not concentrate the target protein in the immunoprecipitation, that is that my band is weaker in the immunoprecipitation sample than in the original cell lysate sample. In order to have positive interaction do I have to be able to concentrate the target protein? So, what do you think, are these two proteins interacting ...
http://www.protocol-online.org/biology-forums/posts/32393.html
Ciprobid Dosage - Ciproxin Prezzo MutuabileCiprobid Dosage - Ciproxin Prezzo Mutuabile
Cipro dosis pediatrica - words correctly.your captures every word you say. with the use of a yeast two-hybrid approach, followed.
https://asawomenusa.org/ciprobid-dosage-vjcr
November 2006 - Molecular Partners
This new class of molecules opens the door for transforming new drug formats.. Molecular Partners has established a robust platform to discover and develop DARPin-based product candidates targeting indications in ophthalmology, oncology and immunology. The most advanced DARPin product candidate, called abicipar pegol, is out-licensed to Allergan and is expected to enter Phase III clinical studies for the treatment of wet age-related macular degeneration in the second quarter of 2015 and is currently in Phase II clinical development for the treatment of diabetic macular edema. The other DARPin product candidates in the pipeline are currently being developed by Molecular Partners either on its own or together with renowned pharmaceutical companies through strategic partnerships.. Molecular Partners has the exclusive license to develop DARPin-based product candidates. The vision of Molecular Partners is to pioneer the development of DARPins to create multi-benefit therapeutics transforming the ...
https://www.molecularpartners.com/2006/11/
A three-hybrid system to detect RNA-protein interactions in vivo | PNASA three-hybrid system to detect RNA-protein interactions in vivo | PNAS
RNA-protein interactions are pivotal in fundamental cellular processes such as translation, mRNA processing, early development, and infection by RNA viruses. However, in spite of the central importance of these interactions, few approaches are available to analyze them rapidly in vivo. We describe a yeast genetic method to detect and analyze RNA-protein interactions in which the binding of a bifunctional RNA to each of two hybrid proteins activates transcription of a reporter gene in vivo. We demonstrate that this three-hybrid system enables the rapid, phenotypic detection of specific RNA-protein interactions. As examples, we use the binding of the iron regulatory protein 1 (IRP1) to the iron response element (IRE), and of HIV trans-activator protein (Tat) to the HIV trans-activation response element (TAR) RNA sequence. The three-hybrid assay we describe relies only on the physical properties of the RNA and protein, and not on their natural biological activities; as a result, it may have broad ...
https://www.pnas.org/content/93/16/8496?ijkey=391bba4f71615b85616f7a138e534b2033950d84&keytype2=tf_ipsecsha
Universidade do Minho: Screening for interactions with predicted soluble domains of the yeast lactate transporter JEN1Universidade do Minho: Screening for interactions with predicted soluble domains of the yeast lactate transporter JEN1
The S. cerevisiae membrane protein Jen1 is a monocarboxylate-proton symporter which after the addition of glucose to lactic acid-grown cells triggers loss of Jen1p activity and repression of JEN1 gene expression (Paiva et al., 2002; Andrade et al., 2001). This downregulation of the permease is dependent on phosphorylation and ubiquitylation mechanisms, both of which are dependent on proteins interacting with the Jen1p. To identify the proteins involved in this process we developed a system combined structure prediction and the yeast two-hybrid system to overcome the difficulties associated to measuring protein interactions with membrane proteins. Measuring protein interactions between membrane proteins or between membrane proteins and other proteins has proved to be very difficult. The commonly used yeast two-hybrid systems are inefficient for membrane proteins since the interaction must take place in the cell nucleus between soluble proteins. An advantage of the strategy used in our approach is ...
http://repositorium.sdum.uminho.pt/handle/1822/15986
p53-mediated Inhibitory Mechanism on HIV-1 Tat is Likely to be Associated with Tat-Phosphorylationp53-mediated Inhibitory Mechanism on HIV-1 Tat is Likely to be Associated with Tat-Phosphorylation
HIV-1 tat, a strong transactivator, is essential for the HIV-1 replication and AIDS progression. The Tat function is markedly inhibited by human anti-oncogene p53. This work was initiated to identify the p53-associated inhibitory mechanism on tat-mediated transactivation. Inhibitory function of P53 was confirmed by co-transfection of tat-expressing Jurkat cells with LTR-CAT plasmid, or H3Tl cells (LTR-CAT integrated HeLa cells) with different ratio of pSV-tat/pCDNA-p53 plasmids. Results from the direct protein-protein .interaction between soluble p53 and tat, and yeast two-hybrid experiments showed that the co-suppression mechanism is unlikely to be due to the direct interaction. CAT activity was not affected by tat in Jurkat cells which were transfected with p53-promoter-CAT or p53-enhancer-CAT, suggesting that the tat-mediated p53 suppression is not directly associated with p53-promoter. Finally, we have tested protein kinase activity in p53-tranfected Jurkat cells, which might phosphorylate ...
https://koreamed.org/article/2079JKSV/1998.28.1.39
EGFL7: An Anti-Notch Ligand | Science SignalingEGFL7: An Anti-Notch Ligand | Science Signaling
Epidermal growth factor-like domain 7 (EGFL7) is a secreted protein that has been implicated in cell migration and blood vessel formation. The receptor that EGFL7 binds is unknown. The Notch pathway is involved in both angiogenesis and neural development. Notch is a transmembrane receptor that is cleaved to release the transcriptional regulator NICD (the Notch intracellular domain) in response to ligands, such as Jagged. Schmidt et al. showed by yeast two-hybrid experiments and coimmunoprecipitation and binding assays that EGFL7 and the extracellular domain of Notch interacted and that the interaction could be mediated by either the Emilin-like domain (EMI) or the EGF-like domains of EGFL7 and required the EGF-like repeats on Notch. When Jagged and Notch were coexpressed with increasing amounts of EGFL7, the interaction between Jagged and Notch was disrupted. EGFL7 decreased Notch signaling in response to Jagged. In a more physiological setting, the effect of EGFL7 on cultured murine neural stem ...
https://stke.sciencemag.org/content/2/79/ec236
Cell Based Assays / In vitro > Yeast Two-Hybrid Systems Laboratory Product Directory and Equipment Reviews on...Cell Based Assays / In vitro > Yeast Two-Hybrid Systems Laboratory Product Directory and Equipment Reviews on...
Read reviews and compare manufacturers of Cell Based Assays / In vitro > Yeast Two-Hybrid Systems products in the SelectScience products and suppliers directory
http://www.selectscience.net/cell-based-assays-+-in-vitro/product-directory/yeast-two-hybrid-systems/?catID=1765&u=E7CBD6F7-E1AC-4033-92D2-4EA4FDFBC2F3
The WD-repeat protein superfamily in Arabidopsis: conservation and divergence in structure and function | BMC Genomics | Full...The WD-repeat protein superfamily in Arabidopsis: conservation and divergence in structure and function | BMC Genomics | Full...
In several cases, the homologous WDR proteins are highly conserved throughout the length of the proteins, and appear to operate in highly analogous mechanisms, with specificity in function conferred by changes in upstream signaling pathways and/or downstream effectors. One case is AGB1, the only clear Arabidopsis ortholog of Gβ [31] (Fig. 1). Loss of AGB1 function leads to developmental pleiotropy including shortened fruits [32] and changes in patterns of cell division in the hypocotyl and root [33]. These phenotypes are associated with the derepression of genes that are normally turned on by auxin, suggesting a role for AGB1 as a negative regulator of auxin signaling [33]. There appears to be one Gα-like protein (GPA1) and two Gγ-like proteins (AGG1 and AGG2) in the Arabidopsis proteome [31], and molecular modeling and yeast two-hybrid studies of potential interactions among AGB1, GPA1 and AGG1 are not inconsistent with the possibility that these could form a heterotrimeric protein [33, 34]. ...
https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-4-50
Plus itPlus it
To decipher the mechanism affecting this response, the authors examined Pi signaling-related transcription factors, finding that mutants affecting PHOSPHATE STARVATION RESPONSE2 (PHR2) did not alter the response of leaf angle to Pi, but mutants affecting the SPX (Syg1/Pho81/XPR1) domain proteins SPX1 and SPX2 did. The spx1 and spx2 mutants had a wider leaf angle and longer lamina joint cells than wild-type rice, and the overexpressors had smaller cells, narrower leaf angles, and thus more-erect leaves. SPX proteins generally interact with and inhibit transcription factors. Therefore, the authors next used yeast two-hybrid assays to identify proteins interacting with SPX1. They found the transcription factor REGULATOR OF LEAF INCLINATION1 (RLI1), which shows some similarity to PHR family genes, but lacks the coiled-coil domains. They confirmed the SPX1-RLI1 interaction by coimmunoprecipitation and bimolecular fluorescence complementation.. Mutant and overexpression studies supported the ...
http://www.plantcell.org/content/30/4/743
AID 747467 - Agonist activity at human estrogen receptor-beta by yeast two-hybrid assay in presence of SRC1 - PubChemAID 747467 - Agonist activity at human estrogen receptor-beta by yeast two-hybrid assay in presence of SRC1 - PubChem
BioAssay record AID 747467 submitted by ChEMBL: Agonist activity at human estrogen receptor-beta by yeast two-hybrid assay in presence of SRC1.
https://pubchem.ncbi.nlm.nih.gov/bioassay/747467
A Yeast Two-Hybrid Screen for Clarin-1 (USH3A) Interacting Proteins | IOVS | ARVO JournalsA Yeast Two-Hybrid Screen for Clarin-1 (USH3A) Interacting Proteins | IOVS | ARVO Journals
Purpose: : To search for proteins that bind to the Usher syndrome type 3 protein Clarin-1. Methods: : Yeast two-hybrid screening (Fields method) was performed using three baits representing the two predicted extra-cellular loops and the intracellular C-terminal region of the mouse Clarin-1 protein. The expression of recombinant GAL4-baits was confirmed by Western blot analysis. Suitability of the baits for screening was additionally confirmed by transactivation activity tests. Each of the baits was used to screen approximately 1.5 million mouse brain cDNAs for interaction. Isolated positive clones were identified by DNA sequencing and database searching. Potential interaction partners of Clarin-1 were subjected to the mating assay. Results: : Screening the mouse cDNA library with three GAL4-Clarin-1 baits identified 125 positive clones that potentially bind to Clarin-1. 110 of the clones were sequenced, of which 41 were in the correct reading frame with GAL4. Most of those 41 clones were ...
http://iovs.arvojournals.org/article.aspx?articleid=2391920
Protocols for screening for binding partners of CCN proteins: Yeast two-hybrid system - Fingerprint - Okayama University
Fingerprint Dive into the research topics of Protocols for screening for binding partners of CCN proteins: Yeast two-hybrid system. Together they form a unique fingerprint. ...
https://okayama.pure.elsevier.com/en/publications/protocols-for-screening-for-binding-partners-of-ccn-proteins-yeas/fingerprints/
LSM1 - ويكيبيديا، الموسوعة الحرةLSM1 - ويكيبيديا، الموسوعة الحرة
Lehner B، Semple JI، Brown SE، وآخرون. (2004). Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region. Genomics. 83 (1): 153-67. PMID 14667819. doi:10.1016/S0888-7543(03)00235-0. ...
https://ar.wikipedia.org/wiki/LSM1
RhoB induces apoptosis via direct interaction with TNFAIP1 in HeLa cells<...RhoB induces apoptosis via direct interaction with TNFAIP1 in HeLa cells<...
TY - JOUR. T1 - RhoB induces apoptosis via direct interaction with TNFAIP1 in HeLa cells. AU - Kim, Dong Myung. AU - Chung, Kyung Sook. AU - Choi, Shin Jung. AU - Jung, Yu Jin. AU - Park, Song Kyu. AU - Han, Gyoon Hee. AU - Ha, Jae Seok. AU - Song, Kyung Bin. AU - Choi, Nam Song. AU - Kim, Hwan Mook. AU - Won, Misun. AU - Seo, Yeon Soo. PY - 2009/12/1. Y1 - 2009/12/1. N2 - RhoB, a tumor suppressor, has emerged as an interesting cancer target, and extensive studies aimed at understanding its role in apoptosis have been performed. In our study, we investigated the involvement of RhoB-interacting molecules in apoptosis. To identify RhoB-interacting proteins, we performed yeast-two hybrid screening assays using RhoB as a bait and isolated TNFAIP1, a TNFα-induced protein containing the BTB/POZ domain. The interaction between RhoB and TNFAIP1 was demonstrated in vivo through coimmunoprecipitation studies and in vitro binding assays. RFP-TNFAIP1 was found to be partially colocalized with EGFP-RhoB. ...
https://yonsei.pure.elsevier.com/en/publications/rhob-induces-apoptosis-via-direct-interaction-with-tnfaip1-in-hel
The GAL genetic switch: visualisation of the interacting proteins by split-EGFP bimolecular fluorescence complementationThe GAL genetic switch: visualisation of the interacting proteins by split-EGFP bimolecular fluorescence complementation
A split-EGFP bimolecular fluorescence complementation assay was used to visualise and locate three interacting pairs of proteins from the GAL genetic switch of the budding yeast, Saccharomyces cerevisiae. Both the Gal4p-Gal80p and Gal80p-Gal3p pairs were found to be located in the nucleus under indu …
https://pubmed.ncbi.nlm.nih.gov/21298679/?dopt=Abstract
Plus itPlus it
Yeast two-hybrid analysis. The two-hybrid assay was performed as described previously (Kim et al., 1995). The last 7 aa residues (amino acids 1144-1150; AGRETTV) of KIF1Bα in pBHA bait vector were used in the screen. For the yeast two-hybrid assay against various PDZ domains, wild-type and mutant (the last amino acid V to A) KIF1Bα (amino acids 1083-1150) in pBHA were used. The PDZ domains in pGAD10 are as follows: PDZ1 (amino acids 203-327), PDZ2 (304-425), and PDZ3 (454-553) of SAP97; PDZ0 (16-103), PDZ1 (424-505), PDZ2 (607-683), PDZ3 (777-863), PDZ4 (919-1023), and PDZ5 (1139-1224) of S-SCAM; Shank1 PDZ (585-691); PDZ1-2 (51-245) and PDZ2-3 (148-339) of glutamate receptor-interacting protein-2 (GRIP2) and PDZ1 (13-106) and PDZ2 (142-249) of Na+/H+exchanger regulatory factor-1 (NHERF1). The pGAD10 constructs containing the PDZ domains of PSD-95 have been described previously (Kim et al., 1995).. Antibodies. Anti-peptide KIF1Bα antibodies were raised against the following synthetic ...
http://www.jneurosci.org/content/22/13/5253
pFN11A (BIND) Flexi VectorpFN11A (BIND) Flexi Vector
The pFN11A (BIND) Flexi® Vector is a component of the CheckMate™/Flexi® Vector Mammalian Two-Hybrid System. This ampicillin-resistant vector is designed to express a fusion protein comprised of a DNA-binding domain of the yeast GAL4 gene, a linker segment and an in-frame protein-coding sequence, under the control of the human cytomegalovirus (CMV) immediate early promoter. The pFN11A (BIND) Flexi® Vector encodes a |em>Renilla|/em> luciferase gene which may be used to normalize for transfection differences between samples within an experiment.
https://www.promega.com/products/protein-interactions/pulldown-and-two-hybrid-systems/pfn11a-bind-flexi-vector/
Natural Variation Underlies Differences in ETHYLENE RESPONSE FACTOR17 Activity in Fruit Peel Degreening | Plant PhysiologyNatural Variation Underlies Differences in ETHYLENE RESPONSE FACTOR17 Activity in Fruit Peel Degreening | Plant Physiology
Figure 6. ERF17 regulates Chl degradation-related genes. A, Yeast one-hybrid assay showing the activity of LacZ reporters driven by the PPH and NYC promoters and activated by activation domain (AD) fusion with ERF17-8S and ERF17-3S (blue color). The empty vectors pB42AD and pLacZi were used as negative controls (white color). BD, Binding domain. B, Gel-shift analysis of ERF17-8S and ERF17-3S binding to the promoters of PPH and NYC. EMSAs of a GST-labeled probe with ERF17-8S and ERF17-3S proteins are shown. DNA probes represent the promoters of PPH and NYC (probe sequences are shown in Supplemental Table S3). Protein/DNA complexes are indicated by arrows. C, SPR binding profiles of ERF17-8S and ERF17-3S proteins to the promoters of PPH and NYC. Protein concentrations were 275 nm in all lines but the bottom line, for which it was 17.2 nm. RU, Response units. ...
http://www.plantphysiol.org/content/176/3/2292/tab-figures-data
FERM and PDZ domain-containing protein elisa and antibodyFERM and PDZ domain-containing protein elisa and antibody
Shop FERM and PDZ domain-containing protein ELISA Kit, Recombinant Protein and FERM and PDZ domain-containing protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=ferm-and-pdz-domain-containing-protein
A New Source of Fatty Acids through Yeast Biotechnology | Biopetrolia
We create rare bioactive fatty acids from sustainable sources. A new source of fatty acids though engineered yeast cells and a fermentation bioprocess.
https://www.biopetrolia.com/
Extensive proteomic screening identifies the obesity-related NYGGF4 protein as a novel LRP1-interactor, showing reduced...Extensive proteomic screening identifies the obesity-related NYGGF4 protein as a novel LRP1-interactor, showing reduced...
The low-density lipoprotein receptor related protein 1 (LRP1) has been implicated in Alzheimers disease (AD) but its signalling has not been fully evaluated. There is good evidence that the cytoplasmic domain of LRP1 is involved in protein-protein interactions, important in the cell biology of LRP1. We carried out three yeast two-hybrid screens to identify proteins that interact with the cytoplasmic domain of LRP1. The screens included both conventional screens as well as a novel, split-ubiquitin-based screen in which an LRP1 construct was expressed and screened as a transmembrane protein. The split-ubiquitin screen was validated in a screen using full-length amyloid protein precursor (APP), which successfully identified FE65 and FE65L2, as well as novel interactors (Rab3a, Napg, and ubiquitin b). Using both a conventional screen as well as the split-ubiquitin screen, we identified NYGGF4 as a novel LRP1 interactor. The interaction between LRP1 and NYGGF4 was validated using two-hybrid assays,
https://molecularneurodegeneration.biomedcentral.com/articles/10.1186/1750-1326-5-1/figures/2
Well-posedness of hybrid systems<...Well-posedness of hybrid systems<...
TY - CHAP. T1 - Well-posedness of hybrid systems. AU - Camlibel, M.K.. AU - Heemels, W.P.M.H.. AU - Schaft, van der, A.J.. AU - Schumacher, J.M.. PY - 2004. Y1 - 2004. N2 - Well-posedness problems arise in hybrid systems theory as a consequence of the use of implicit descriptions and of solution concepts that are based on relaxations. Examples show that the well-posedness issue is considerably more complex in hybrid systems than in continuous systems, as a result of a number of factors including the possible presence of sliding modes, the interaction of guards and invariants, and the occurrence of left or right accumulations of event times. Description formats that are based on implicit or relaxed specifications are typically connected to particular subclasses of hybrid systems, and so there is no general theory of well-posedness of hybrid systems; however, the questions that need to be answered are similar in each case. This chapter surveys several description formats and solution concepts that ...
https://research.tue.nl/en/publications/well-posedness-of-hybrid-systems
Molecular Partners Publishes Audited Financial Results for 2018 and Annual Report 2018 | | IT Business Net
ZURICH-SCHLIEREN, SWITZERLAND / ACCESSWIRE / March 15, 2019 / Molecular Partners AG (SWX: MOLN), a clinical-stage biotech company pioneering the use of DARPin®
http://www.theusdaily.com/2019/03/molecular-partners-publishes-audited-financial-results-for-2018-and-annual-report-2018/
Microbiology Society Journals | Complete protein linkage map between the P2 and P3 non-structural proteins of poliovirusMicrobiology Society Journals | Complete protein linkage map between the P2 and P3 non-structural proteins of poliovirus
All of the non-structural proteins of poliovirus, including their processing precursors, are involved in the replication of the viral RNA genome. These proteins assemble into a replication complex, which also contains the viral RNA and cellular factors. An understanding of how these viral proteins interact with each other would enhance our understanding of the molecular events occurring during poliovirus infection of the cell. Previously, we have employed the yeast two-hybrid system to construct two separate linkage maps for the polioviral P2 and P3 proteins, respectively. In the present study, we have searched for interacting pairs between the P2 and P3 proteins in a similar inducible yeast two-hybrid system. Although, the primary functions of the proteolytic products of the P2 and P3 domains of the polyprotein in the viral life cycle are different, we observed significant interactions between 2CATPase and 3AB; 2Apro and 3A, 3Cpro or 3Dpol; 2B and 3A or 3AB. All of the interactions were measured in the
http://jgv.microbiologyresearch.org/content/journal/jgv/10.1099/vir.0.82795-0
Identification of p130Cas as a Mediator of Focal Adhesion Kinase-promoted Cell Migration | Journal of Cell Biology |...Identification of p130Cas as a Mediator of Focal Adhesion Kinase-promoted Cell Migration | Journal of Cell Biology |...
In this report, we provide several lines of evidence that p130Cas is a downstream mediator of FAK-promoted cell migration. First, a mutation of P712/715A in FAK abolished its ability to promote CHO cell migration (Fig. 3). The proline-rich region on FAK spanning amino acids 712-718 has been mapped as the primary binding site for p130Cas through its SH3 domain (Polte and Hanks, 1995; Harte et al., 1996), although a second proline-rich region (amino acids 875-884) can also mediate FAK binding to p130Cas (Harte et al., 1996; Polte and Hanks, 1997). In vivo coimmunoprecipitation experiments showed that FAK/ p130Cas association was reduced but not abolished by the P712/715A mutation (Fig. 6), indicating that the second proline-rich region on FAK may mediate some binding to p130Cas, as demonstrated previously (Harte et al., 1996; Polte and Hanks, 1997). However, binding of p130Cas to an alternative site clearly does not allow for FAK-promoted migration. It has also been suggested that p130Cas may ...
https://rupress.org/jcb/article-standard/140/1/211/857/Identification-of-p130Cas-as-a-Mediator-of-Focal
Bio-Resource: Yeast Two Hybrid System - For Protein - Protein Interaction StudiesBio-Resource: Yeast Two Hybrid System - For Protein - Protein Interaction Studies
Yeast Two Hybrid system uses a reporter gene to detect the interaction of pair of proteins inside the yeast cell nucleus. In the yeast Two Hybrid System, The interaction of target protein to the protein will bring together transcriptional activator, which then switches on the expression of reporter gene.
http://technologyinscience.blogspot.com/2014/07/yeast-two-hybrid-system-for-protein.html
matrix protein and yeast two-hybridmatrix protein and yeast two-hybrid
I assume you mean all the interactions occur outside the cell? One of the advantages of standard yeast two hybrid systems is that they level the playing field with respect to protein localization. This can lead to false positives (extra-cellular/ intra-cellular etc.) but should not be a problem for you. The problem of course is if the interaction you are looking for is dependent on a post-translational modification not applied to intracellular proteins (glycosylation etc...). If your matrix protein contains a transmembrane domain I would suggest removing it as well. There are other membrane based two hybrid systems out there which mount the bait protein onto the intracellular leaf of the cell membrane. These systems work by triggering a signal transduction cascade when the bait/ prey interact. Of course they are also internal so are bound by the same limitations as the standard transcription factor methods. Cheers Martin , Helo, I hope some people here in this forum familar with yeast , ...
http://www.bio.net/bionet/mm/yeast/2003-January/010313.html
Pull-Down Assays | Thermo Fisher Scientific - USPull-Down Assays | Thermo Fisher Scientific - US
This article discusses the pull-down technique, which is an invaluable tool for scientists interested in studying cellular pathways via protein-protein interactions.
https://www.thermofisher.com/us/en/home/life-science/protein-biology/protein-biology-learning-center/protein-biology-resource-library/pierce-protein-methods/pull-down-assays.html
Membrane-based Yeast Two-Hybrid Screening - ProfacgenMembrane-based Yeast Two-Hybrid Screening - Profacgen
Profacgen provides One-Stop-Service on Membrane-based Yeast Two-Hybrid Screening service. Our service can be tailored according to your specialized requirements.
https://www.profacgen.com/membrane-based-yeast-two-hybrid-screening.htm
LIFE SCIENCE PRODUCTS - Euromedex, a world of solutions for a world of healthLIFE SCIENCE PRODUCTS - Euromedex, a world of solutions for a world of health
At Euromedex we constantly collaborate with french leading researchers to bring new life science products to the scientific community. Therefore we can propose worldwide. -Bacth kit ref EUK001 developed by Mr Ladant (Institut Pasteur). Euromedex bacterial two-hybrid (BACTH, for Bacterial Adenylate Cyclase-based Two-Hybrid) system is a simple and fast approach to detect and characterize protein-protein interactions in vivo.. -Monoclonals Antibodies for studies of genetic diseases and Transcription Factors (developed by IGBMC - Strasbourg).. EUROMEDEX is continuously looking for high quality products to expand its product portfolio. Please contact us when you are searching for partners to sell you products to the bioscience research community. ...
https://web.euromedex.com/en/life-science-products/
Proteome-wide drug and metabolite interaction mapping by thermal-stability profiling - NDM Research Building
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
https://www.ndmrb.ox.ac.uk/research/our-research/publications/567638
publish.UP Searchpublish.UP Search
Unlike for other retroviruses, only a few host cell factors that aid the replication of foamy viruses (FVs) via interaction with viral structural components are known. Using a yeast-two-hybrid (Y2H) screen with prototype FV (PFV) Gag protein as bait we identified human polo-like kinase 2 (hPLK2), a member of cell cycle regulatory kinases, as a new interactor of PFV capsids. Further Y2H studies confirmed interaction of PFV Gag with several PLKs of both human and rat origin. A consensus Ser-Thr/Ser-Pro (S-T/S-P) motif in Gag, which is conserved among primate FVs and phosphorylated in PFV virions, was essential for recognition by PLKs. In the case of rat PLK2, functional kinase and polo-box domains were required for interaction with PFV Gag. Fluorescently-tagged PFV Gag, through its chromatin tethering function, selectively relocalized ectopically expressed eGFP-tagged PLK proteins to mitotic chromosomes in a Gag STP motif-dependent manner, confirming a specific and dominant nature of the Gag-PLK ...
https://publishup.uni-potsdam.de/solrsearch/index/search/searchtype/all/rows/10/yearfq/2016/facetNumber_author_facet/all/sortfield/title/sortorder/asc/author_facetfq/Serrao%2C+Erik/start/0/institutefq/Mathematisch-Naturwissenschaftliche+Fakult%C3%A4t
OPUS Würzburg | SearchOPUS Würzburg | Search
SAP47 ist ein Synapsenassoziiertes Protein von 47 kDa aus Drosophila melanogaster, das zu einer neuen Proteinfamilie gehört. Um eine Sap47 Mutante zu erzeugen wurden drei Methoden eingesetzt: Gezielte Mutagenese durch homologe Rekombination, RNA interference (RNAi) und Transposon Remobilisierung. Um einen Interaktionspartner für das SAP47 Protein zu identifizieren wurden ein Yeast-Two-Hybrid System und das CytoTrap Verfahren eingesetzt ...
https://opus.bibliothek.uni-wuerzburg.de/solrsearch/index/search/searchtype/authorsearch/author/Natalja+Funk/rows/50/subjectfq/Gezeilte+Mutagenese/author_facetfq/Funk%2C+Natalja/institutefq/Theodor-Boveri-Institut+f%C3%BCr+Biowissenschaften
218916-52-0 supplier218916-52-0 supplier
Warmth shock transcription factors (HSFs) are mainly involved in the activation of genes in response to heat stress as well as other abiotic and biotic stresses. localized in the nucleus, indicating their related subcellular distributions as transcription factors. Our candida one-hybrid assay suggested that FaTHSFA2a offers trans-activation activity, whereas FaTHSFB1a expresses trans-repression 218916-52-0 supplier function. …Read More. ...
http://researchhunt.com/tag/218916-52-0-supplier/
Yeast One-HybridYeast One-Hybrid
The December issues of Cold Spring Harbor Protocols features four protocols on how to prepare reagents for yeast one-hybrid analysis. An important question when studying gene regulation is which transcription factors (TFs) interact with which cis-regulatory elements, such as promoters … Continue reading →. ...
http://walhoutlab.umassmed.edu/?tag=yeast-one-hybrid
PBP4 (YDL053C) Result Summary | BioGRIDPBP4 (YDL053C) Result Summary | BioGRID
Pbp1p Binding Protein; Interacts Strongly With Pab1p-binding Protein 1 (Pbp1p) In The Yeast Two-hybrid System; Also Interacts With Lsm12p In A Copurification Assay; Relative Distribution To The Nucleus Increases Upon DNA Replication Stress
https://thebiogrid.org/32006/summary/saccharomyces-cerevisiae/pbp4.html
Wollberg Zvi - Sagol School of NeuroscienceWollberg Zvi - Sagol School of Neuroscience
Research topic: Characterization of genes in the human deaf population and corresponding mouse models; the regulation by microRNAs in the auditory and vestibular systems and their targets; networks of genes and proteins in the auditory system using transcriptomics and proteomics; the correlation between anxiety and balance defects in mouse models.. Research methods: Deep sequencing/massively parallel sequencing, gene cloning, quantitative RT-PCR, immunofluorescence, yeast two-hybrid assays, cell culture, scanning electron microscopy, mass spectrometry, in situ hybridization, bioinformatics.. Main projects in the lab include:. ...
https://www.sagol.tau.ac.il/en/faculty/wollberg-zvi/
Molecules and CellsMolecules and Cells
To dissect how NSM00158 functions, we evaluated its effects on the interactions of CtBP2-p300, CtBP2-E1A, p300-c-MYC and p300-c-JUN in yeast cells. The CtBP2-p300 interaction, and the interactions of CtBP2-E1A, p300-c-MYC and p300-c-JUN were previously reported in other publications (Faiola et al., 2005; Lee et al., 1996; Zhao et al., 2008). Accordingly, we cotransformed different combinations of plasmids, including pGADT7-CtBP2 + pGBKT7-p300, pGADT7-CtBP2 + pGBKT7-E1A-Flag, pGADT7-c-MYC + pGBKT7-p300, and pGADT7-c-JUN + pGBKT7-p300, into AH109 yeast cells. After determining the protein levels in positive colonies (Supplementary Fig. S3A), we examined and verified protein interactions in the SC-HTL medium (Supplementary Fig. S3B, top panel). We next evaluated the effects of NSM00158 on these interactions. As shown in Supplementary Fig. S3B (bottom panel), supplementation with 4 μM NSM00158 inhibited the growth of the cells coexpressing pGADT7-CtBP2 + pGBKT7-p300 or pGADT7-CtBP2 + ...
http://molcells.inforang.com/journal/view.html?doi=10.14348/molcells.2020.0042&sort=&scale=12&key=&keyword=&s_v=&s_n=&pn=&year=&page=
PDZ domain-containing protein 4PDZ domain-containing protein 4
MGCNMCVVQKPEEQYKVMLQVNGKELSKLSQEQTLQALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVDS 1 - 70 GTQTDITFEHIMALGKLRPPTPPMVILEPPPISHEYYDPAEFMEGGPQEADRLDELEYEEVELYKSSHRD 71 - 140 KLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGVDVQNREEAVAILSQEENTNISLL 141 - 210 VARPESQLAKRWKDSDRDDFLDDFGSENEGELRARKLKSPPAQQPGNEEEKGAPDAGPGLSNSQELDSGV 211 - 280 GRTDESTRNEESSEHDLLGDEPPSSTNTPGSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGGDVPGLT 281 - 350 DEEYERYRELLEIKCHLENGNQLGLLFPRASGGNSALDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQ 351 - 420 KMQQLRERCMKAWLLEEESLYDLAASEPKKHELSDISELPEKSDKDSTSAYNTGESCRSTPLLVEPLPES 421 - 490 PLRRAMAGNSNLNRTPPGPAVATPAKAAPPPGSPAKFRSLSRDPEAGRRQHAEERGRRNPKTGLTLERVG 491 - 560 PESSPYLSRRHRGQGQEGEHYHSCVQLAPTRGLEELGHGPLSLAGGPRVGGVAAAATEAPRMEWKVKVRS 561 - 630 DGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQHLIRAREQRKRREFMMQ 631 - 700 SRLECLREQQNGDSKPELNIIALSHRKTMKKRNKKILDNWITIQEMLAHGARSADGKRVYNPLLSVTTV 701 - 769 ...
https://pharos.nih.gov/idg/targets/Q76G19
FERM and PDZ domain-containing protein 3FERM and PDZ domain-containing protein 3
This gene encodes a protein that contains a PDZ (post synaptic density protein (PSD95), Drosophila disc large tumor suppressor (Dlg1), and zonula occludens-1 protein (zo-1) domain at the N-terminus followed by a FERM domain. The encoded protein is involved in signal transduction. The PDZ domain is thought to function in protein-protein interactions, mainly by binding to specific C-terminal peptides of other proteins. The FERM domain is found in proteins that are localized to the plasma membrane and are associated with the cytoskeleton. [provided by RefSeq, May 2017 ...
https://pharos.nih.gov/idg/targets/Q5JV73
CiteSeerX - Citation Query Sastry: An Algebraic Geometric Approach to the Identification of a Class of Linear Hybrid Systems,CiteSeerX - Citation Query Sastry: An Algebraic Geometric Approach to the Identification of a Class of Linear Hybrid Systems,
CiteSeerX - Scientific documents that cite the following paper: Sastry: An Algebraic Geometric Approach to the Identification of a Class of Linear Hybrid Systems,
http://citeseerx.ist.psu.edu/showciting?cid=3155
Tailor made hybrid systems - H2sysTailor made hybrid systems - H2sys
H2SYS conçoit et réalise des systèmes hybrides qui génèrent électricité et chaleur à partir dhydrogène et accompagne les industriels.
https://www.h2sys.fr/en/hybrid-systems-2/
Lelo in Nopo: Discovered! A crafted item that hasnt shown up on Etsy
It doesnt matter. McCain doesnt have a chance. Osamas too good. The debates will be one-sided. He has a better chance against Hillary. I can get into the explanation that the gods only use their power to hurt the disfavored, but youve already heard it. Consistant with this, expect gas to climb to $4 if not $5 this summer, ensuring the election is delivered to the wrong candidate::::Theyve used the price of gas to punish the people for electing the wrong person. In addition, public response to recent poor economic reports ensures conservative behavior, another factor which is intentionally damaging to McCains chances ...
http://www.lelonopo.com/2008/04/discovered-crafted-item-that-hasnt.html
Protocols and Video Articles Authored by Steve A. KayProtocols and Video Articles Authored by Steve A. Kay
Steve A. Kay is the author of this article in the Journal of Visualized Experiments: A Modified Yeast-one Hybrid System for Heteromeric Protein Complex-DNA Interaction Studies
https://www.jove.com/author/Steve++A._Kay
Wallacei Problem with running and results! - GrasshopperWallacei Problem with running and results! - Grasshopper
Hi,I am running a bending active hybrid system optimization where i have 9 values as a genome input that control various heights. Fitness value is obtained af…
https://www.grasshopper3d.com/group/wallacei/forum/topics/wallacei-problem-with-running-and-results
Recombinant Human PIST protein (ab93743) ReferencesRecombinant Human PIST protein (ab93743) References
References for Abcams Recombinant Human PIST protein (ab93743). Please let us know if you have used this product in your publication
http://www.abcam.com/recombinant-human-pist-protein-ab93743-references.html
Computational complexity theoryComputational complexity theory
"Computational Techniques for the Verification of Hybrid Systems". Proceedings of the IEEE. 91 (7): 986-1001. CiteSeerX 10.1. ... computation and differential equations are used in the modelling of continuous-time and hybrid discrete-continuous-time systems ... Classes like IP and AM are defined using Interactive proof systems. ALL is the class of all decision problems. For the ... and this fact forms the basis of several modern cryptographic systems, such as the RSA algorithm. The integer factorization ...
https://en.wikipedia.org/wiki/Computational_complexity_theory
ControllabilityControllability
"Computational Techniques for the Verification of Hybrid Systems" (PDF). Proceedings of the IEEE. 91 (7): 986-1001. CiteSeerX ... That is, the system can have significant zero dynamics, which are trajectories of the system that are not observable from the ... In the so-called behavioral system theoretic approach due to Willems (see people in systems and control), models considered do ... Example Let the system be an n dimensional discrete-time-invariant system from the formula: Φ(n,0,0,w)= ∑ i = 1 n A i − 1 B w ...
https://en.wikipedia.org/wiki/Controllability
Measuring attractiveness by a categorical-based evaluation technique (MACBETH)Measuring attractiveness by a categorical-based evaluation technique (MACBETH)
2012). "A hybrid MCDM methodology for ERP selection problem with interacting criteria." Decision Support Systems 54(1): 206-214 ... 2012). Selection of hybrid renewable energy systems in landfills. Florence, 9th International Conference on the European Energy ... 2010). "Towards a multi-dimensional project Performance Measurement System." Decision Support Systems 48(2): 342-353. Lacerda, ... 2013). A hybrid model to support the diagnosis of disease: A case study for diabetes. Regina, Saskatchewan, Canada, 26th IEEE ...
https://en.wikipedia.org/wiki/Measuring_attractiveness_by_a_categorical-based_evaluation_technique_(MACBETH)
RhexRhex
A Context-Based State Estimation Technique for Hybrid Systems. In Proc. IEEE Int. Conf. Robotics and Automation (ICRA), pp3935- ... A Leg Configuration Sensory System for Dynamical Body State Estimates in a Hexapod Robot. In Proc. IEEE Int. Conf. Robotics and ... In Proceedings of the 12th Yale Workshop on Adaptive and Learning Systems, May 2003. D. McMordie, C. Prahacs, M. Buehler. ... of 2003 IEEE/RSJ International Conference on Intelligent Robots and Systems (IROS), Vol 2, pp808-1813, October 2003. J.C. ...
https://en.wikipedia.org/wiki/Rhex
Recommender systemRecommender system
There is no reason why several different techniques of the same type could not be hybridized. Hybrid approaches can be ... most content-based recommender systems now use some form of the hybrid system. Content-based recommender systems can also ... This system combines a content-based technique and a contextual bandit algorithm. Mobile recommender systems make use of ... Collaborative filtering is still used as part of hybrid systems. Another common approach when designing recommender systems is ...
https://en.wikipedia.org/wiki/Recommender_system
Cold start (recommender systems)Cold start (recommender systems)
Hybrid feature weighting techniques in particular are tailored for the recommender system domain. Some of them learn feature ... Although various techniques exist to apply feature weighting to user or item features in recommender systems, most of them are ... Recommender systems form a specific type of information filtering (IF) technique that attempts to present information items (e- ... Burke, Robin (2007). "Hybrid Web Recommender Systems". The Adaptive Web. Lecture Notes in Computer Science. Vol. 4321. pp. 377- ...
https://en.wikipedia.org/wiki/Cold_start_(recommender_systems)
RetrotronicsRetrotronics
... "hybrid systems". For example, in the Netherlands, the TubeSociety employs this technique. Amongst guitarists, the goal of a " ... Hybrid systems using Hypex UcD-modules TubeSociety webpage Tentlabs website http://www.tubeclockdb.com/ a large collection of ... Another trend is the mixing of tubes with more up-to-date circuitry; these systems are referred to as a " ...
https://en.wikipedia.org/wiki/Retrotronics
Collaborative filteringCollaborative filtering
Usually most commercial recommender systems are hybrid, for example, the Google news recommender system. In recent years a ... Collaborative filtering (CF) is a technique used by recommender systems. Collaborative filtering has two senses, a narrow one ... Collaborative filtering systems have many forms, but many common systems can be reduced to two steps: Look for users who share ... The more a given user makes use of the system, the better the recommendations become, as the system gains data to improve its ...
https://en.wikipedia.org/wiki/Collaborative_filtering
Hybrid bond graphHybrid bond graph
... a hybrid dynamical system). Similar to a regular bond graph, it is an energy-based technique. However, it allows instantaneous ... A hybrid bond graph is a graphical description of a physical dynamic system with discontinuities (i.e., ... Pieter Mosterman, 2001: "HyBrSim - A Modeling and Simulation Environment for Hybrid Bond Graphs" in Journal of Systems and ... Cuijpers, P.J.L., Broenink, J.F., and Mosterman P.J., 2008: "Constitutive Hybrid Processes: a Process-Algebraic Semantics for ...
https://en.wikipedia.org/wiki/Hybrid_bond_graph
Finite-difference time-domain methodFinite-difference time-domain method
W. Sui; D. A. Christensen; C. H. Durney (1992). "Extending the two-dimensional FDTD method to hybrid electromagnetic systems ... technique, the auxiliary differential equation (ADE) technique, or the Z-transform technique. An alternative way of solving ... Being a time-domain technique, FDTD directly calculates the impulse response of an electromagnetic system. Therefore, a single ... Being a time-domain technique, FDTD directly calculates the nonlinear response of an electromagnetic system. This allows ...
https://en.wikipedia.org/wiki/Finite-difference_time-domain_method
William M. Lewis Sr.William M. Lewis Sr.
He also produced many reports on aquaculture techniques such as recirculating biofiltration systems for hybrid striped bass. He ...
https://en.wikipedia.org/wiki/William_M._Lewis_Sr.
Hans WitsenhausenHans Witsenhausen
... where he worked on analog and hybrid computer techniques and on systems analysis problems. From 1963 to 1965 he was associated ... A Minimax Control Problem for Sampled Linear Systems. Hans Witsenhausen. IEEE TRANSACTIONS ON AUTOMATIC CONTROL, VOL. AC-13, NO ... with the Electronic Systems Laboratory and the Lincoln Laboratory at MIT. During 1965-1966 he was a fellow of the Fannie and ...
https://en.wikipedia.org/wiki/Hans_Witsenhausen
Expert systemExpert system
"Hybrid categorical expert system for use in content aggregation". Software Systems and Computational Methods (4): 1-22. doi: ... As expert systems evolved, many new techniques were incorporated into various types of inference engines. Some of the most ... An expert system is an example of a knowledge-based system. Expert systems were the first commercial systems to use a knowledge ... These expert systems in medicine were the MYCIN expert system, the INTERNIST-I expert system and later, in the middle of the ...
https://en.wikipedia.org/wiki/Expert_system
Neri OxmanNeri Oxman
Many of Oxman's projects use new platforms and techniques for 3D printing and fabrication. They include co-fabrication systems ... "Hybrid Living Materials". Hybrid Living Materials. Retrieved April 18, 2021. "No Joints Needed: By Experimenting with Materials ... The group developed its own methods and printing platforms, and worked with a range of 3D production systems. Projects have ... 2020: Hybrid Living Materials 2018: Making Data Matter 2016: 3D printed multimaterial microfluidic valve 2016: Recursive ...
https://en.wikipedia.org/wiki/Neri_Oxman
Anders P. RavnAnders P. Ravn
Ravn specialized in research into formal methods, especially for embedded systems and hybrid systems. In particular, he worked ... 1998). Formal Techniques in Real-Time and Fault-Tolerant Systems. Lecture Notes in Computer Science. Vol. 1486. Springer-Verlag ... 1993). Hybrid Systems. Lecture Notes in Computer Science. Vol. 736. Springer-Verlag. doi:10.1007/3-540-57318-6. ISBN 978-3-540- ... he was a systems programmer on minicomputers at the early Danish computer company A/S Regnecentralen. He returned to academia ...
https://en.wikipedia.org/wiki/Anders_P._Ravn
Synthetic-aperture radarSynthetic-aperture radar
See pulse-doppler radar). A common technique for many radar systems (usually also found in SAR systems) is to "chirp" the ... The system then becomes a hybrid of a SAR and a phased array, sometimes being called a Vernier array. Combining the series of ... systems. A typical UWB system might use a bandwidth of one-third to one-half of its center frequency. For example, some systems ... The bandwidth of a chirped system can be as narrow or as wide as the designers desire. Pulse-based UWB systems, being the more ...
https://en.wikipedia.org/wiki/Synthetic-aperture_radar
Predictive engineering analyticsPredictive engineering analytics
These hybrid modeling techniques will allow realistic real-time evaluation of system behavior very early in the development ... also referred to as 1D CAE or mechatronics system simulation, allows scalable modeling of multi-domain systems. The full system ... smart systems control systems 3D simulation or 3D CAE Industrie 4.0 Internet of Things real-time simulation Hardware-in-the- ... Calvano, C.N.; John, P (2004). "Systems engineering in an age of complexity". Systems Engineering. 7 (1): 25-34. doi:10.1002/ ...
https://en.wikipedia.org/wiki/Predictive_engineering_analytics
Bacterial one-hybrid systemBacterial one-hybrid system
B1H is just one emerging technique among many that is useful for studying protein-DNA interactions. Transformation of a ... the one-hybrid system specializes in the latter. Meng et al.'s B1H system differs from the two-hybrid version in two key ... and two-hybrid systems. Whereas the two-hybrid versions can assess both protein-protein interaction and protein-DNA ... The bacterial one-hybrid (B1H) system is a method for identifying the sequence-specific target site of a DNA-binding domain. In ...
https://en.wikipedia.org/wiki/Bacterial_one-hybrid_system
Hybrid navigationHybrid navigation
Automotive navigation system Hybrid positioning system Navigation Data Standard Sensor fusion Rizos, C, Grejner-Brzezinska, DA ... Bestmann, vonWulfen, Hecker, Kneissl, Kropp (August 2010). "Aviation Applications: Hybrid Navigation Techniques and Safety-of- ... This system uses vehicle speed data supplied by a Fleet Management System. Differential GPS. This system uses terrestrial radio ... The hybrid system needs to decide how to choose among the different methods at any given time. One solution is a triple ...
https://en.wikipedia.org/wiki/Hybrid_navigation
Brian Sterling-VeteBrian Sterling-Vete
The book is about a hybrid exercise system created by Sterling called TRISOmetrics, or the TRISOmetric exercise system. It ... or the TRISOmetric exercise system. It combines three scientific approaches into one technique. The exercises are based on a ... The book is about a 90-day progressive advanced exercise course based on the hybrid exercise system created by Sterling called ... In particular, the isometric exercise system in the system will deliver maximum muscle stimulus with minimum impact on the ...
https://en.wikipedia.org/wiki/Brian_Sterling-Vete
Multi-swarm optimizationMulti-swarm optimization
Multi-swarm systems thus provide a useful framework for the development of hybrid algorithms. For example, the UMDA-PSO multi- ... S. Chen, "Locust Swarms - A New Multi-Optima Search Technique", in Proceedings of the IEEE Congress on Evolutionary Computation ... Multi-swarm systems provide a new approach to improve this balance. Instead of trying to achieve a compromise between ... 53-60.[2] Antonio Bolufé Röhler and S. Chen, "Multi-swarm hybrid for multi-modal optimization", in Proceedings of the IEEE ...
https://en.wikipedia.org/wiki/Multi-swarm_optimization
Phage displayPhage display
Directed evolution protein-protein interactions PelB leader sequence Competing techniques: Two-hybrid system mRNA display ... Like the two-hybrid system, phage display is used for the high-throughput screening of protein interactions. In the case of M13 ... In this technique, a gene encoding a protein of interest is inserted into a phage coat protein gene, causing the phage to " ... The technique is also used to determine tumour antigens (for use in diagnosis and therapeutic targeting) and in searching for ...
https://en.wikipedia.org/wiki/Phage_display
Jump diffusionJump diffusion
... an example of jump diffusion and a generalization of the jump process Hybrid system (in the context of dynamical systems), a ... Using techniques from pattern theory, a posterior probability model was constructed over the countable union of sample space; ... this is therefore a hybrid system model, containing the discrete notions of object number along with the continuum notions of ... Grenander, U.; Miller, M.I. (1994). "Representations of Knowledge in Complex Systems". Journal of the Royal Statistical Society ...
https://en.wikipedia.org/wiki/Jump_diffusion
Fiber to the xFiber to the x
A variant of this technique for cable television providers is used in a hybrid fiber-coaxial (HFC) system. It is sometimes ... If all three systems cannot directly reach the unit, it is possible to combine signals and transport them over a common medium ... Typically any system terminating fiber within 1,000 ft (300 m) of the customer premises equipment would be described as FTTC. ... For FTTH and for some forms of FTTB, it is common for the building's existing ethernet, phone, and cable TV systems to connect ...
https://en.wikipedia.org/wiki/Fiber_to_the_x
Time-hoppingTime-hopping
Although often used to form hybrid spread-spectrum (SS) systems, TH is strictly speaking a non-SS technique. Spreading of the ... An example of hybrid SS is TH-FHSS or hybrid TDMA (time division multiple access). Spread spectrum Frequency-hopping spread ... Time-hopping (TH) is a communications signal technique which can be used to achieve anti-jamming (AJ) or low probability of ... ISBN 0-02-804837-7. "Time hopping and frequency hopping in ultrawideband systems" v t e (Channel access methods, Wireless ...
https://en.wikipedia.org/wiki/Time-hopping
Two-hybrid screeningTwo-hybrid screening
Detail on sister technique two-hybrid system Science Creative Quarterly's overview of the yeast two hybrid system Gateway- ... Compatible Yeast One-Hybrid Screens Video animation of the Yeast Two-Hybrid System Two-Hybrid+System+Techniques at the US ... Two-hybrid screening (originally known as yeast two-hybrid system or Y2H) is a molecular biology technique used to discover ... "Mammalian two-hybrid system: a complementary approach to the yeast two-hybrid system". BioTechniques. 22 (2): 350-2. doi: ...
https://en.wikipedia.org/wiki/Two-hybrid_screening
Multiway switchingMultiway switching
These include the X10 system, available since the 1970s, and newer hybrid wired/wireless systems, such as Insteon and Z-Wave. ... and commercial applications is increasingly being implemented with power line signalling and wireless signalling techniques. ... In the traveler system, also called the "common" system, the power line (hot, shown in red) is fed into the common terminal of ... An alternative system, known as the "California 3-way", or "coast 3-way" connection system allows both switched and unswitched ...
https://en.wikipedia.org/wiki/Multiway_switching
KCNJ15KCNJ15
In 2007 the channel was found to interact with the Calcium-sensing receptor in human kidney, using a yeast-two-hybrid system. ... This co-localization was verified at the protein level using both immunofluorescence techniques and coimmunoprecipitation of ...
https://en.wikipedia.org/wiki/KCNJ15
Culture of AsiaCulture of Asia
Modern hybrid martial arts systems such as Jeet Kune Do and Krav Maga often incorporate techniques from traditional East Asian ... The Chinese script is one of the oldest continuously used writing systems in the world, and has been a major unifying force and ... The ancient architecture of the region of the Tigris-Euphrates river system dates back to the 10th millennium BC and lead to ... Nations within its orbit from Central Asia to Southeast Asia paid to the Chinese tributary system (also see List of tributaries ...
https://en.wikipedia.org/wiki/Culture_of_Asia
Photovoltaic thermal hybrid solar collectorPhotovoltaic thermal hybrid solar collector
Concentrator systems also often require reliable control systems to accurately track the sun and to protect the PV cells from ... "A review on recent advancements in photovoltaic thermal techniques". Renewable and Sustainable Energy Reviews. 76: 645-672. doi ... The temperatures of the specific system depend on the requirements of the heat supply system for domestic hot water (e.g. ... water heating systems, water desalination, space cooling, food processing systems. PVT technologies can bring a valuable ...
https://en.wikipedia.org/wiki/Photovoltaic_thermal_hybrid_solar_collector
Protocol WarsProtocol Wars
"Experience has shown that IP systems are very easy to mount and use, in contrast to such systems as SNA and to a lesser extent ... Abbate 2000, p. 38 The NPL group influenced a number of American computer scientists in favor of the new technique, and they ... 5 (7). Papageorgiou, Chuck (1988-10-10). "Users cultivating hybrid methods to manage nets". Network World. IDG Network World ... In these systems, the routers examine each packet as it arrives, looks at the routing information within them, and decides ...
https://en.wikipedia.org/wiki/Protocol_Wars
World Food PrizeWorld Food Prize
Krishnankutty, Pia (24 May 2021). "Yuan Longping, the poor farmer's son who created hybrid rice & saved millions from famine". ... "Edward Knipling and Raymond Bushland Win Award for the Sterile Insect Technique". Entomology Today. Entomological Society of ... Productivity and Management in Agricultural Systems. Cambridge University Press. p. 479. ISBN 978-1-139-50032-6. "2007: Nelson ...
https://en.wikipedia.org/wiki/World_Food_Prize
Close combatClose combat
... "the Fairbairn system", incorporating use of the handgun, knife, and the Defendu martial art fighting technique. Since that time ... Hybrid martial arts, Hand to hand tactics). ... devised a system of close-combat fighting for both soldiers and ...
https://en.wikipedia.org/wiki/Close_combat
TechnoTechno
Basically, we're tired of hearing about being in love or falling out, tired of the R&B system, so a new progressive sound has ... Techno musicians, or producers, rather than employing traditional compositional techniques, may work in an improvisatory ... creating a hybrid of post-punk, funkadelia and electro-disco...a mesmerizing underground of new dance which blends European ... Basically, we're tired of hearing about being in love or falling out, tired of the R&B system, so a new progressive sound has ...
https://en.wikipedia.org/wiki/Techno
42-volt electrical system42-volt electrical system
The availability of higher-efficiency motors, new wiring techniques and digital controls, and a focus on hybrid vehicle systems ... 48-volt systems are being deployed in mild hybrid vehicles, which add electric assistance to the propulsion and regeneration ... Literature on 42-volt electrical systems often refers to systems powered with a 6-cell lead-acid battery as nominally 14 volts ... In a 42 V/14 V system, the 14 V branch should have been freed of higher-power loads and should operate within much narrower ...
https://en.wikipedia.org/wiki/42-volt_electrical_system
Drum rollDrum roll
These additional rolls are possible and are taught in modern hybrid drumming and in older pre-NARD rudimental systems, as well ... The technique is also known amongst many drummers as the gravity blast, though gravity is not required as the technique can be ... A drum roll (or roll for short) is a technique used by percussionists to produce a sustained sound for the duration of a ... This produces a near-continuous sound when the technique is mastered. In rudimental drumming, open rolls, consisting of double ...
https://en.wikipedia.org/wiki/Drum_roll
NeodymiumNeodymium
NdFeB magnets are used in hybrid electric vehicles (HEVs), plug-in hybrid electric vehicles (PHEVs), electric vehicles (EVs), ... Neodymium's per-particle abundance in the Solar System is 0.083 ppb (parts per billion). This figure is about two thirds of ... https://doi.org/10.1007/978-3-540-38508-0_3 Bray, Charles (2001). Dictionary of glass: materials and techniques. University of ... Larger neodymium magnets are used in electric motors with a high power-to-weight ratio (e.g., in hybrid cars) and generators (e ...
https://en.wikipedia.org/wiki/Neodymium
Error correction codeError correction code
However, some systems adapt to the given channel error conditions: some instances of hybrid automatic repeat-request use a ... Use of interleaving techniques increases total delay. This is because the entire interleaved block must be received before the ... Most telecommunication systems use a fixed channel code designed to tolerate the expected worst-case bit error rate, and then ... The code-rate of a given ECC system is defined as the ratio between the number of information bits and the total number of bits ...
https://en.wikipedia.org/wiki/Error_correction_code
Dispersive flies optimisationDispersive flies optimisation
Alhakbani, Haya (2018). Handling Class Imbalance Using Swarm Intelligence Techniques, Hybrid Data and Algorithmic Level ... Proceedings of the 2014 Federated Conference on Computer Science and Information Systems. Vol. 2. pp. 529-538. doi:10.15439/ ... In the first work on DFO, this algorithm was compared against a few other existing swarm intelligence techniques using error, ... Proceedings of the 2017 Federated Conference on Computer Science and Information Systems. Vol. 11. pp. 399-402. doi:10.15439/ ...
https://en.wikipedia.org/wiki/Dispersive_flies_optimisation
Shamanic musicShamanic music
It has been suggested that the sound material used by the shaman constitutes a system of sounds. This idea of semiotics of the ... A further element is the spatialisation of sound brought about not only by the shaman's movement, but also by techniques of ... All of these factors make it uniquely difficult in Korea to distinguish the 'pure' from hybrid and concert forms of shamanic ... The Nervous System, Routledge 1992 Sevyan Vainshtein, The Tuvan Shaman's Drum and the ceremony of its Enlivening, in V.Dioszegi ...
https://en.wikipedia.org/wiki/Shamanic_music
Clothes dryerClothes dryer
Hybrid dryers can also use a heat pump and a heating element at the same time to dry clothes faster. Clothes dryers can cause ... These systems are necessary, in order to prevent lint from building up inside the dryer and evaporator and condenser coils. ... Given that this is a relatively simple and cheap technique to materialize, most consumer products showcase the added benefit of ... First, the tumbler and its contents are heated to 100 °C. The wet steam that results purges the system of air and is the only ...
https://en.wikipedia.org/wiki/Clothes_dryer
National Museum of BrazilNational Museum of Brazil
The fire began in the air-conditioning system of the auditorium on the ground floor. One of the three devices did not have ... Items are evaluated in terms of the similarity of decorative patterns and artistic techniques, as well as in the subjects ... anthropomorphic and hybrid vessels, etc. Santarém culture (or Tapajós culture), which inhabited the region of the Tapajós River ... The Konduri collection is primarily composed of pottery, noted for the techniques of decoration such as incision and dotted ...
https://en.wikipedia.org/wiki/National_Museum_of_Brazil
Flip-flop (electronics)Flip-flop (electronics)
Transparent latches are typically used as I/O ports or in asynchronous systems, or in synchronous two-phase systems ( ... One technique for suppressing metastability is to connect two or more flip-flops in a chain, so that the output of each one ... The J-K Flip-Flop Shirriff, Ken (August 2022). "Reverse-engineering a 1960s hybrid flip flop module with X-ray CT scans". (CS1 ... Flip-flops in use at Hughes at the time were all of the type that came to be known as J-K. In designing a logical system, ...
https://en.wikipedia.org/wiki/Flip-flop_(electronics)
List of fishes of West VirginiaList of fishes of West Virginia
The following letters indicate the river systems that contain each species: In addition, the IUCN classifies one of these ... Gravel addition as a habitat zestoration technique for tailwaters. North American Journal of Fisheries Management 30.5:1238- ... N Hybrid striped bass (Morone chrysops x saxatilis) O Family Centrarchidae (sunfishes) Rock bass (Ambloplites rupestris) O,N,J, ...
https://en.wikipedia.org/wiki/List_of_fishes_of_West_Virginia
Shotgun proteomicsShotgun proteomics
Hu L, Ye M, Jiang X, Feng S, Zou H (August 2007). "Advances in hyphenated analytical techniques for shotgun proteome and ... Wu CC, MacCoss MJ (June 2002). "Shotgun proteomics: tools for the analysis of complex biological systems". Current Opinion in ... "Characterization of strategies for obtaining confident identifications in bottom-up proteomics measurements using hybrid FTMS ... Shotgun proteomics refers to the use of bottom-up proteomics techniques in identifying proteins in complex mixtures using a ...
https://en.wikipedia.org/wiki/Shotgun_proteomics
Storage area networkStorage area network
Server operating systems maintain their own file systems on their own dedicated, non-shared LUNs on the SAN, as though they ... Newer SAN configurations enable hybrid SAN and allow traditional block storage that appears as local storage but also object ... 148-149 LUN masking is a technique whereby the host bus adapter and the SAN software of a server restrict the LUNs for which ... These are known as shared-disk file system. Video editing systems require very high data transfer rates and very low latency. ...
https://en.wikipedia.org/wiki/Storage_area_network
Mitochondrial DNAMitochondrial DNA
An IVF technique known as mitochondrial donation or mitochondrial replacement therapy (MRT) results in offspring containing ... The heavy strand is rich in guanine and encodes 12 subunits of the oxidative phosphorylation system, two ribosomal RNAs (12S ... Fontaine KM, Cooley JR, Simon C (September 2007). "Evidence for paternal leakage in hybrid periodical cicadas (Hemiptera: ... Some in vitro fertilization techniques, particularly injecting a sperm into an oocyte, may interfere with this. The fact that ...
https://en.wikipedia.org/wiki/Mitochondrial_DNA
PanasasPanasas
The ActiveStor product line is a parallel file system appliance that integrates hybrid storage hardware (hard drives and solid ... molecular imaging techniques in life sciences, and converged HPC/AI data use cases. "Panasas Plots New Path". Byte and Switch. ... opening up the possibility of hosting the file system on third-party storage platforms. The file system's portability also ... While other storage systems assign data to media "tiers" based on how recently files were accessed, Dynamic Data Acceleration ...
https://en.wikipedia.org/wiki/Panasas
Cable televisionCable television
Most systems use hybrid fiber-coaxial (HFC) distribution; this means the trunklines that carry the signal from the headend to ... Many channels can be transmitted through one coaxial cable by a technique called frequency division multiplexing. At the ... Due to widespread cable theft in earlier analog systems, the signals are typically encrypted on modern digital cable systems, ... Many large cable systems have upgraded or are upgrading their equipment to allow for bi-directional signals, thus allowing for ...
https://en.wikipedia.org/wiki/Cable_television
List of Metal Gear charactersList of Metal Gear characters
But over time, the system evolved from simply maintaining economic and political systems into creating an entirely new world ... Khamsin's body from the waist down is replaced with connectors to his mech suit, which wields a chainsaw/battle-axe hybrid ... Samuel Rodrigues (サムエル・ホドリゲス, Samueru Hodorigesu) is a master of a Brazilian fighting technique called the "New Shadow School ... In Metal Gear Solid 4, Naomi is working with Liquid Ocelot in order to hijack the SOP battlefield control system, but joins Old ...
https://en.wikipedia.org/wiki/List_of_Metal_Gear_characters
Rotational-vibrational spectroscopyRotational-vibrational spectroscopy
1993). Practical Sampling Techniques for Infrared Analysis. CRC PressINC. ISBN 0-8493-4203-1. Harris, Daniel, C.; Bertolucci, ... "Hitran on the Web Information System". Harvard-Smithsonian Center for Astrophysics (CFA), Cambridge, MA, USA; V.E. Zuev ... the result is a hybrid band. For ammonia, NH3, the symmetric bending vibration is observed as two branches near 930 cm−1 and ...
https://en.wikipedia.org/wiki/Rotational–vibrational_spectroscopy
AptXAptX
In addition, aptX Live also features techniques that aid connection in situations where the bit error rate (BER) is excessively ... Unlike the name suggests, the codec is still considered lossy; however, it permits a "hybrid" coding scheme for applications ... By comparison, the latency of standard Bluetooth stereo varies greatly depending on the system implementation and buffering. ... talk-back systems) is becoming a prime operational consideration. aptX Live offers up to 8:1 compression of 24-bit resolution ...
https://en.wikipedia.org/wiki/AptX
BackgammonBackgammon
Players often use mental calculation techniques to determine pip counts in live play. Backgammon is played in two principal ... He also established the World Backgammon Club of Manhattan, devised a backgammon tournament system in 1963, then organized the ... and 1-1 is a hybrid Turkish-Persian where hep is Turkish for "altogether". In the early 20th century, as use of Classical ... "A Persian-Turkic counting system used in dice games"]". In Einar von Schuler (ed.). XXIII. Deutscher Orientalistentag: vom 16. ...
https://en.wikipedia.org/wiki/Backgammon
RhubarbRhubarb
By the early 18th century, these two species and a possible hybrid of unknown origin, R. × hybridum, were grown as vegetable ... The "Russian rhubarb" was the most valued, probably because of the rhubarb-specific quality control system maintained by the ... and varies according to both rhubarb variety and production technique. The colour is not related to its suitability for cooking ... Rhubarb is the fleshy, edible stalks (petioles) of species and hybrids (culinary rhubarb) of Rheum in the family Polygonaceae, ...
https://en.wikipedia.org/wiki/Rhubarb
Glossary of motorsport termsGlossary of motorsport terms
ERS (energy recovery system) Part of the hybrid powertrain systems used in Formula One since 2014, that recovers energy from ... drafting A technique where multiple vehicles align end to end, reducing the overall effect of drag due to exploiting the lead ... hybrid) system to provide power. Also see KERS. qualifying The process of deciding the starting order of a race. See also pre- ... Drag Reduction System (DRS) A mechanically-activated element of the rear wing of modern Formula One cars, which can be used at ...
https://en.wikipedia.org/wiki/Glossary_of_motorsport_terms
Massively multiplayer online role-playing gameMassively multiplayer online role-playing game
MMORPGs include reliable systems for a number of vital tasks. The server must be able to handle and verify a large number of ... Some employ hybrid themes that either merge or replace fantasy elements with those of science fiction, sword and sorcery, or ... The Realm Online was the first MMORPG to begin to use a rudimentary form of this technique and Anarchy Online would develop it ... A system for recording the games data at regular intervals, without stopping the game, is also important. Maintenance requires ...
https://en.wikipedia.org/wiki/Massively_multiplayer_online_role-playing_game
2015 6 Hours of Spa-Francorchamps2015 6 Hours of Spa-Francorchamps
Bernhard was caught by Duval and used his car's hybrid boost system on the Kemmel straight, moving ahead of the German under ... New cooling techniques were achieved by creating new suspension solutions to restrict spring displacement which also reduced ... holding the lead until Lieb reclaimed it by employing his car's hybrid boost system to overtake him on the Kemmel straight. ... He passed him with hybrid boost assistance on the Kemmel straight on the following lap. Audi elected to keep Tréluyer on track ...
https://en.wikipedia.org/wiki/2015_6_Hours_of_Spa-Francorchamps
Sentiment analysisSentiment analysis
For a recommender system, sentiment analysis has been proven to be a valuable technique. A recommender system aims to predict ... Based on the feature/aspects and the sentiments extracted from the user-generated text, a hybrid recommender system can be ... and hybrid approaches. Knowledge-based techniques classify text by affect categories based on the presence of unambiguous ... A current system based on their work, called EffectCheck, presents synonyms that can be used to increase or decrease the level ...
https://en.wikipedia.org/wiki/Sentiment_analysis
Mobile wireless sensor networkMobile wireless sensor network
Instead of single topology, hybrid topology plays a vital role in data collection, and the performance is good. Hybrid topology ... IET Wireless Sensor Systems, vol. 6, no. 2, pp. 49-57. H. Yan, H. Huo, Y. Xu and M. Gidlund. 2010. Wireless Sensor Network ... Another popular routing technique is to utilise location information from a GPS module attached to the nodes. This can be seen ... List of ad hoc routing protocols List of sensors Cyber-physical system Mobile ad hoc networks Mobile robot and Mobile ...
https://en.wikipedia.org/wiki/Mobile_wireless_sensor_network
Experimental analysis of PAPR reduction technique using hybrid peak windowing in LTE system | EURASIP Journal on Wireless...Experimental analysis of PAPR reduction technique using hybrid peak windowing in LTE system | EURASIP Journal on Wireless...
In this paper, we propose a hybrid peak-windowing scheme that selects the optimum PAPR reduction scheme according to the PAPR ... have been proposed in order to reduce the PAPR in OFDM-based systems. However, these schemes reduce the peak signals regardless ... has the advantages of spectral efficiency in wideband communication systems such as 3GPP long-term evolution (LTE). However, ... Experimental analysis of PAPR reduction technique using hybrid peak windowing in LTE system. Access & Citations. * 6671 Article ...
https://jwcn-eurasipjournals.springeropen.com/articles/10.1186/s13638-015-0282-9/metrics
Performance analysis of 80 channels hybrid optical time division dense multiplexing system with the support of different...
Performance analysis of 80 channels hybrid optical time division dense multiplexing system with the support of different ... orthogonal modulation techniques ...
http://op.niscair.res.in/index.php/IJEMS/article/view/27285/465478878
Institut für Mathematik: Preprints 2017
Regular solutions of DAE hybrid systems and regularization techniques Preprint 5-2017, Institute of Mathematics, Technische ... Port-Hamiltonian descriptor systems Preprint 6-2017, Institute of Mathematics, Technische Universität Berlin, 2017 ... Condensed Forms for linear Port-Hamiltonian Descriptor Systems Preprint 9-2017, Institute of Mathematics, Technische ...
https://www.math.tu-berlin.de/menue/forschung/veroeffentlichungen/preprints_2017/parameter/de/font3/minhilfe/
SUN-1 and ZYG-12, mediators of centrosome-nucleus attachment, are a functional SUN/KASH pair in Caenorhabditis elegansSUN-1 and ZYG-12, mediators of centrosome-nucleus attachment, are a functional SUN/KASH pair in Caenorhabditis elegans
Two-Hybrid System Techniques Substances * Caenorhabditis elegans Proteins * Cell Cycle Proteins * Receptors, Cytoplasmic and ...
https://pubmed.ncbi.nlm.nih.gov/19759181/?dopt=AbstractPlus
PDF] Multiple Lyapunov functions and other analysis tools for switched and hybrid systems | Semantic ScholarPDF] Multiple Lyapunov functions and other analysis tools for switched and hybrid systems | Semantic Scholar
... systems. We introduce some analysis tools for switched and hybrid systems. We first present work on stability analysis. We ... We also discuss the case where the switched systems are indexed by an arbitrary compact set. Finally, we extend Bendixsons ... introduce multiple Lyapunov functions as a tool for analyzing Lyapunov stability and use iterated function systems theory as a ... Recent results on Lyapunov-theoretic techniques for nonlinear stability. *Yuandan Lin, Eduardo Sontag, Y. Wang ...
https://www.semanticscholar.org/paper/Multiple-Lyapunov-functions-and-other-analysis-for-Branicky/c904ba963d58ca20ef1682bcbe8d080c2191d0a0
Invariance principles for switching systems via hybrid systems techniques | Center for Control, Dynamical Systems and...Invariance principles for switching systems via hybrid systems techniques | Center for Control, Dynamical Systems and...
Invariance principles for switching systems via hybrid systems techniques. Title. Invariance principles for switching systems ... Center for Control, Dynamical Systems and Computation • University of California, Santa Barbara. Copyright © 2019 The Regents ...
https://www.ccdc.ucsb.edu/publications/12652
CPC Scheme - H05H PLASMA TECHNIQUE ; PRODUCTION OF ACCELERATED ELECTRICALLY-CHARGED PARTICLES OR OF NEUTRONS ; PRODUCTION OR...CPC Scheme - H05H PLASMA TECHNIQUE ; PRODUCTION OF ACCELERATED ELECTRICALLY-CHARGED PARTICLES OR OF NEUTRONS ; PRODUCTION OR...
Magnet systems {, e.g. undulators, wigglers (free-electron laser H01S 3/0903)}; Energisation thereof [2016-08] ... PLASMA TECHNIQUE (fusion reactors G21B; ion-beam tubes H01J 27/00; magnetohydrodynamic generators H02K 44/08; producing X-rays ... Circuits or systems for supplying or feeding radio-frequency energy (radio-frequency generators H03B) [2013-01] ... Arrangements for beam delivery or irradiation (irradiation systems per se G21K 5/00)} [2013-01] ...
https://www.uspto.gov/web/patents/classification/cpc/html/cpc-H05H.html
Study on Hybrid Solar Wind Power System with PMSG for Power Enhancement Using AI Technique | SMART MOVES JOURNAL...Study on Hybrid Solar Wind Power System with PMSG for Power Enhancement Using AI Technique | SMART MOVES JOURNAL...
Study on Hybrid Solar Wind Power System with PMSG for Power Enhancement Using AI Technique Authors. * Asanna Kumar Badge M.Tech ... Study on Hybrid Solar Wind Power System with PMSG for Power Enhancement Using AI Technique. SMART MOVES JOURNAL IJOSCIENCE, 6(1 ... The wind generation system is still a challenge to extract smooth power from wind. To improve the power quality of the system ... operated in wind energy systems and solar energy systems. A complete survey has been made towards the new contributions for ...
https://ijoscience.com/ojsscience/index.php/ojsscience/article/view/252
Comparative performance analysis of hybrid differential evolution and pattern search technique for frequency control of the...Comparative performance analysis of hybrid differential evolution and pattern search technique for frequency control of the...
The most significant situation in power system control is load frequency control. In the present work, a hybrid differential ... The suggested control method has been applied for two electrical power systems model, i.e., 2-area diverse source power system ... The suggested method (hDE-PS tuned FOPID) is further investigated with a 2-area thermal system. The performance of the ... Robustness of the suggested approach has been analyzed by variation in random load and the system parameters. ...
https://jesit.springeropen.com/articles/10.1186/s43067-021-00033-y/tables/2
Electric And Hybrid Aircraft Propulsion System Market to grow by USD 12.1 Mn by 2026, Evolving Opportunities with Airbus SE.,...Electric And Hybrid Aircraft Propulsion System Market to grow by USD 12.1 Mn by 2026, Evolving Opportunities with Airbus SE.,...
8, 2022 -- Technavios latest report on the electric and hybrid aircraft propulsion system market projects a growth of USD 12.1 ... Hybrid powertrain and All-electric powertrain) and Geography (Europe, North America, APAC, Middle East and Africa, and South ... 120 Pages report segments the electric and hybrid aircraft propulsion system market by Technology ( ... driving the growth of the electric and hybrid aircraft propulsion system market is the employment of innovative techniques for ...
https://www.theautochannel.com/news/2022/11/08/1215717-electric-and-hybrid-aircraft-propulsion-system-market-to-grow-by.html
Part III - Practical Internet Groupware [Book]Part III - Practical Internet Groupware [Book]
This part shows how to build custom groupware solutionsâ a collaborative document-review system, … - Selection from Practical ... Internet directory services; the LDAP consensus; a docbase notification system for subscribers; the hybrid push/pull technique ... This part shows how to build custom groupware solutionsâ a collaborative document-review system, a helpdesk, a group calendar, ...
https://www.oreilly.com/library/view/practical-internet-groupware/1565925378/pr02s05.html
SoCPaR 2013 : Soft Computing and Pattern RecognitionSoCPaR 2013 : Soft Computing and Pattern Recognition
Hybrid intelligent systems Nature inspired computing techniques Machine learning Ambient intelligence Hardware implementations ... Control systems SoCPaR2013-flyer.pdf Proceedings: SoCPaR2013 proceedings will be published by IEEE. It is mandatory at least an ... Artificial immune systems Fuzzy Sets Uncertainty analysis Fractals Rough Sets Support vector machines Artificial neural ...
http://wikicfp.com/cfp/servlet/event.showcfp?eventid=30540©ownerid=499
Engineering and Computer Science CoursesEngineering and Computer Science Courses
... photovoltaic systems, wind power, fuel cells, hybrid systems. Hydrogen and other forms of energy storage for renewable power ... Description: Review of linear control design techniques for nonlinear systems and their limitations; introduction to Lyapunov ... navigation systems; automatic flight control systems; monitoring/warning/alert systems; flight management systems; system ... hybrid automata and executions; Lyapunov stability analysis of switched and hybrid systems; stability as a convex optimization ...
https://www.concordia.ca/academics/graduate/calendar/current/gina-cody-school-of-engineering-and-computer-science-courses/engineering-and-computer-science-courses.html
Orchestration and Reconfguration Control Architecture | ORCA Project | Results | H2020 | CORDIS | European CommissionOrchestration and Reconfguration Control Architecture | ORCA Project | Results | H2020 | CORDIS | European Commission
A Survey on Hybrid Beamforming Techniques in 5G: Architecture and System Model Perspectives Author(s): Irfan Ahmed, Hedi ... IEEE Systems Journal, 2020, Page(s) 1-12, ISSN 1932-8184 Publisher: Institute of Electrical and Electronics Engineers DOI: ... Comparing f-OFDM and OFDM Performance for MIMO Systems Considering a 5G Scenario Author(s): Felipe A. P. de Figueiredo, ... Partial Multi-Cell MMSE Vector Combining to Reduce Computational Cost for Massive MIMO Systems Author(s): Andrea P. Guevara, ...
https://cordis.europa.eu/project/rcn/206355/results/en
Ali MAJDI | Research Director | Doctor of Engineering | Al-Mustaqbal University College, Al Ḩillah | Building and Construction...Ali MAJDI | Research Director | Doctor of Engineering | Al-Mustaqbal University College, Al Ḩillah | Building and Construction...
In this study, off-grid design of the hybrid energy system based-renewable resources is proposed for a house in Hamadan city in ... A new optimum technique has been provided for providing well-organized unknown parameters identification of the solid oxide ... New optimized configuration for a hybrid PV/diesel/battery system based on coyote optimization algorithm: A case study for ... Economic Performance of a Hybrid Renewable Energy System with Optimal Design of Resources ...
https://www.researchgate.net/profile/Ali-Majdi-2
Luke Lambourne, Ph.D. | Harvard Catalyst Profiles | Harvard CatalystLuke Lambourne, Ph.D. | Harvard Catalyst Profiles | Harvard Catalyst
Two-Hybrid System Techniques. 2. 2019. 484. 0.200. Why? Databases, Protein. 2. 2019. 378. 0.190. Why? ...
https://connects.catalyst.harvard.edu/Profiles/display/person/162659/network/researchareas/details
TACASTACAS
analytical techniques for real-time, hybrid, or stochastic systems;. *analytical techniques for safety, security, or ... 24th International Conference on Tools and Algorithms for the Construction and Analysis of Systems (TACAS). Accepted papers ... They should provide information about the following aspects: the system being studied and the reasons it is of interest, the ... Alexander K. Petrenko (Institute for System Programming, Russia). Zvonimir Rakamaric (University of Utah, USA) Kristin Yvonne ...
https://etaps.org/2018/tacas
Courses | University of Strathclyde
Merit - Introduction to demand/supply matching and the sizing of hybrid renewable energy systems Learn about approaches to the ... Learn about techniques to assess multi-variate performance quicker, better and cheaper than conventional design approaches. ... BioMH - biomass heating system decision support tool. Focus on component sizing and system performance analysis. Delivered via ... Training courses are delivered on a range of topical issues related to energy systems and the environment and are designed to ...
https://www.strath.ac.uk/research/energysystemsresearchunit/courses/
Hybrid Database Management System - McObject LLCHybrid Database Management System - McObject LLC
Starting with a true IMDS is critical to all benefits from a hybrid database management system. Use both paradigms in one ... Hybrid Database Management System. eXtremeDB makes it easy to combine both database paradigms - in-memory and on-disk - in a ... The best of both worlds: a hybrid database management system. eXtremeDB enables the developer to easily combine both database ... In-memory database systems (IMDSs) such as McObjects eXtremeDB offer superior performance and the possibility of very small ...
https://www.mcobject.com/hybrid-database/
IoT, Machine Learning and Blockchain Technologies for Renewable EnergyIoT, Machine Learning and Blockchain Technologies for Renewable Energy
... and blockchain technologies for renewable energy and modern hybrid power systems wi ... Application of Optimization Technique in Modern Hybrid Power Systems 8. Application of Machine Learning Techniques in Modern ... IoT, Machine Learning and Blockchain Technologies for Renewable Energy and Modern Hybrid Power Systems. ISBN , Quantity: ... IoT, Machine Learning and Blockchain Technologies for Renewable Energy and Modern Hybrid Power Systems Edited By C. Sharmeela. ...
https://www.routledge.com/IoT-Machine-Learning-and-Blockchain-Technologies-for-Renewable-Energy/Sharmeela-Sanjeevikumar-Sivaraman-Joseph/p/book/9788770227247
سامانه نشر مجلات علمی دانشگاه تهران
Developing a Product Recommender System: Designing a Hybrid Model Using Data Mining Techniques. ... Designing an Expert System for Management of Crowding and Overcrowding in Emergency Departments. ...
https://journals.ut.ac.ir/issue_6927_7154_.html
US20180054319A9 - Method, Apparatus, And System For Establishing A Dedicated Communication - Google Patents
H04L12/64-Hybrid switching systems * H04L12/6418-Hybrid transport * * H-ELECTRICITY * H04-ELECTRIC COMMUNICATION TECHNIQUE ... Method and system for authenticating IoT device using mobile device CN115066863A (en) 2022-09-16. Systems and techniques for ... the operating system may be a mobile operating system, such as the Android™ mobile operating system for example. The program ... Systems and methods for convenient and secure mobile transactions RU2665869C2 (en) 2018-09-04. Systems and methods for linking ...
https://patents.google.com/patent/US20180054319A9/en
M.Sc. - Understanding the production of hybrid meat and plant protein systems | Ontario Agricultural CollegeM.Sc. - Understanding the production of hybrid meat and plant protein systems | Ontario Agricultural College
Some examples of techniques that will be used are: texture analysis, dynamic rheology, microscopy, and sensory evaluation. A ... Understanding the production of hybrid meat and plant protein systems. Position: M.Sc. - Understanding the production of hybrid ... Understanding the production of hybrid meat and plant protein systems (current page) ... research project studying the production of hybrid meat and plant protein systems. ...
https://www.uoguelph.ca/oac/future-students/msc-understanding-production-hybrid-meat-and-plant-protein-systems
Application of Multi-Objective Optimization Techniques for Improved Emissions and Fuel Economy over Transient ManoeuvresApplication of Multi-Objective Optimization Techniques for Improved Emissions and Fuel Economy over Transient Manoeuvres
... through the application of multi-objective optimization techniques to the calibration of the Variable Valve Timing (VVT) system ... HyPACE - Hybrid Petrol Advance Combustion Engine - Advanced Boosting System for Extended Stoichiometric Operation and Improved ... Current mature calibration approaches for the VVT system are predominantly based on steady state techniques which fail to ... through the application of multi-objective optimization techniques to the calibration of the Variable Valve Timing (VVT) system ...
https://www.sae.org/publications/technical-papers/content/2019-01-1177/?src=2019-01-0764
Federico Millo | Politecnico di Torino
Engine emissions control/Electric and hybrid propulsion systems (modulo di Engine emissions control). A.A. 2017/18, AUTOMOTIVE ... Modelling techniques for advanced internal combustion engine technologies. A.A. 2020/21, ENERGETICA. Teaching assistant ... Engine emissions control/Electric and hybrid propulsion systems (modulo di Engine emissions control). A.A. 2018/19, AUTOMOTIVE ... Engine emissions control/Electric and hybrid propulsion systems (modulo di Engine emissions control). A.A. 2019/20, AUTOMOTIVE ...
https://www.polito.it/en/staff?p=federico.millo
Subject: basic-leucine zipper transcription factors / Subject term: basic-leucine zipper transcription factors / Text...Subject: basic-leucine zipper transcription factors / Subject term: basic-leucine zipper transcription factors / Text...
... two hybrid system techniques; ubiquitin-protein ligase; zinc finger motif. Abstract:. ... LONG HYPOCOTYL5 (HY5) and STF1 ( ... two hybrid system techniques; wheat; yeasts. Abstract:. ... The basic leucine zipper (bZIP) proteins play important roles ... Meta-analysis and experimental validation identified atrazine as a toxicant in the male reproductive system ... CRISPR-Cas systems; basic-leucine zipper transcription factors; biochemical pathways; blue light; cryptochromes; cultivars; ...
https://pubag.nal.usda.gov/?f%5Bsubject_facet%5D%5B%5D=basic-leucine+zipper+transcription+factors&f%5Bsubject_term%5D%5B%5D=basic-leucine+zipper+transcription+factors&f%5Btext_availability%5D%5B%5D=Citation+in+PubAg&per_page=50&sort=title
MeSH BrowserMeSH Browser
Human Rights Reports: Custom Report Excerpts - United States Department of StateHuman Rights Reports: Custom Report Excerpts - United States Department of State
A code of federal criminal procedure passed in 2018 replaced the countrys hybrid federal inquisitive system with a full ... It also implements the use of new investigative techniques and expands victims rights. Prosecutors in provinces implementing ... The slow pace of the justice system often resulted in lengthy detentions beyond the period stipulated by law. The PPN reported ... In June 2019 Salta and Jujuy became the first provinces to implement this accusatory system at the federal level, which is ...
https://www.state.gov/report/custom/eca4b83623/
StochasticArchitectures2021MethodsApproachesRenewable energy2022SensitivityBehaviorSimulationConventionalAnalyticalTheoreticalPrinciplesMulti-cloud and hybrid cloudRandom amplificationControlApplicationsCombinesIntelligent systemsModulation techniquesProcesses2019EnvironmentsMicroscopyBiomassApproachAffineDetectionPracticesPerformanceLimitationsQuantumAlgorithmsImplementationParametersInherentMathematicalJournalSubstancesCharacterizationWorld'sAnalysisDataCombineMolecularTechnologyLevitationMagneticReductionStrengthsCapacitorsModelIEEEDiscreteMonitoringRobustnessDecompositionSurgical techniquesClinicallyTheoriesFrequency
Stochastic2
  • The intrinsic multi-scale nature of these systems, both in space, in organization levels, and in time, makes extremely difficult to model them in a uniform way, e.g., by means of differential equations or discrete stochastic processes. (imag.fr)
  • DDS is an appropriate stochastic modeling and analysis approach for random systems characterization in the field of modal analysis. (unl.edu)
Architectures2
  • Raytheon Cybersecurity and Special Missions (CSM) is seeking Principal Systems Engineers with both Cloud and SAFe Release Train Engineering expertise to collaborate with the Customer's SE&I team to assess architectures and requirements, to develop derived requirements and systems engineering artifacts, and to guide Agile scrum teams in the development of advanced cybersecurity capabilities. (hired.com)
  • Experience and/or familiarity with architectural views including operational, technical standards, and system/services views and business, data, applications, and technology architectures using applicable standards (e.g. (hired.com)
20213
  • Article: Optimal allocation of renewable distributed generators and shunt capacitors in distribution system using hybrid intelligent approach Journal: International Journal of Ad Hoc and Ubiquitous Computing (IJAHUC) 2021 Vol.37 No.2 pp.98 - 112 Abstract: Increased utilisation of naturally available energy sources in a distribution system (DS) is customary in recent years. (inderscience.com)
  • 2021): Modular design patterns for hybrid learning and reasoning systems: A taxonomy, patterns and use cases. (dfki.de)
  • Proceedings - 5th International Conference on Intelligent Computing and Control Systems, ICICCS 2021). (elsevier.com)
Methods6
  • Systems biology aims at providing a system-level understanding of biological systems by unveiling their structure, dynamics and control methods. (imag.fr)
  • Our session only touched on the other solvents: primarily, we discussed a variety of mechanical methods, including dry media blasting techniques that use wheat starch and plastic media: two hybrid systems, C02 pellet blasting and tee blasting: and two wet systems, the high-pressure or ultra high pressure water technique and slurry blasting, using sodium bicarbonate. (cdc.gov)
  • This thesis aspects the application of state of art sensing methods in the field of condition monitoring of electromechanical systems. (hud.ac.uk)
  • The outcome has been development of techniques to learn and control systems with small amounts of data, taking uncertainty into account, and testing those methods on the real systems of the partners in the process industry. (forskningsradet.no)
  • The application areas we wish to target are all safety-critical systems that are governed by known laws of physics, but which are too complex to model from first principles, thus partially requiring data-driven methods. (forskningsradet.no)
  • The proposed system makes use of the advantages of both the methods by presenting a hybrid technique of encoding and encryption, resulting in a much secured and faster alternative of storing web browser artefacts. (ijrte.org)
Approaches11
  • They should provide information about the following aspects: the system being studied and the reasons it is of interest, the goals of the study, the challenges the system poses to automated analysis, research methodologies and approaches used, the degree to which goals were attained, and how the results can be generalized to other problems and domains. (etaps.org)
  • Learn about techniques to assess multi-variate performance quicker, better and cheaper than conventional design approaches. (strath.ac.uk)
  • Merit - Introduction to demand/supply matching and the sizing of hybrid renewable energy systems Learn about approaches to the design of low carbon communities based on hybrid technology solutions. (strath.ac.uk)
  • e X treme DB makes it easy to combine all the strengths of the on-disk and all-in-memory approaches to data management in a single database system. (mcobject.com)
  • Current mature calibration approaches for the VVT system are predominantly based on steady state techniques which fail to consider the engine dynamic behaviour in real world driving, which is heavily transient. (sae.org)
  • The Feature Paper can be either an original research article, a substantial novel research study that often involves several techniques or approaches, or a comprehensive review paper with concise and precise updates on the latest progress in the field that systematically reviews the most exciting advances in scientific literature. (mdpi.com)
  • The book addresses some of the most recent issues, with the theoretical and methodological aspects, of evolutionary multi-objective optimization problems and the various design challenges using different hybrid intelligent approaches. (freecomputerbooks.com)
  • One of the best approaches to solve this problem is by reducing the order of the system into a second orders, based on this reduction many approaches can be prop. (researchgate.net)
  • University of Sussex researchers overcame these challenges by developing a hybrid system that combines the versatility of phased arrays of transducers (PATs) with the precision of acoustic metamaterials while helping to eliminate the restrictions on sound field resolution and variability each of the previous approaches applied. (sussex.ac.uk)
  • Newer approaches have progressed far beyond balloon valvuloplasty to include catheter techniques for emulating surgical annuloplasty and edge-to-edge repair of regurgitant mitral valves. (medscape.com)
  • The application of hybrid approaches in other contexts will depend upon the exposure of interest and the nature of the individual exposure estimates available. (cdc.gov)
Renewable energy1
  • IoT and its Requirements for Renewable Energy Systems 3. (routledge.com)
20221
  • EAS 2022 will be a hybrid event at the University of Wisconsin Oshkosh (at the Culver Family Welcome Center ) and online. (vtol.org)
Sensitivity1
  • One technique is a hybrid system called a "viral replication assay" that combines PCR with a more traditional culture method for increased sensitivity. (cdc.gov)
Behavior2
  • Hybrid modeling techniques, combining discrete and continuous processes, are gaining more and more attention in systems biology, and they have been applied to successfully capture the behavior of several biological complex systems, ranging from genetic networks, biochemical reactions, signaling pathways and cardiac tissues electrophysiology. (imag.fr)
  • To analyze the behavior of a model-based system, the model of the system is augmented with a testing automaton that represents a given test case, and with a monitoring automaton that captures the formally specified properties of the system. (upenn.edu)
Simulation7
  • ESP-r dynamic energy systems modelling and simulation - introduction and advanced courses. (strath.ac.uk)
  • This edited book comprises chapters that describe the IoT, machine learning, and blockchain technologies for renewable energy and modern hybrid power systems with simulation examples and case studies. (routledge.com)
  • After reading this book, users will understand recent technologies such as IoT, machine learning techniques, and blockchain technologies and the application of these technologies to renewable energy resources and modern hybrid power systems through simulation examples and case studies. (routledge.com)
  • Development of a mechatronic hybrid model for five-axis CNC machine tool using Multi-Body-System (MBS) simulation approach is described. (hud.ac.uk)
  • This paper proposed to design, implementation and simulation of Direct Torque Control of Induction Motor drive system is to minimize stator current distortion, electromagnetic torque and flux ripples. (sciencepubco.com)
  • Simulation and the performance of the proposed Hybrid NFC are analyzed. (sciencepubco.com)
  • Simulation results showed that a significant improvement in dynamic torque and speed response in both steady and transient states and also a considerable reduction in torque and flux minimization compared to the other AI techniques. (sciencepubco.com)
Conventional8
  • 305 ] Many researchers and commercial companies have come to the conclusion that UWB technology is the most promising solution for communications and precision location of firefighters in urban areas and particularly in buildings where conventional Global Positioning System (GPS) or almost any communications using a sinusoidal-based waveform is subject to the issues of multipath fading. (cdc.gov)
  • The conventional two-step adhesive system (63%) and hybrid/ microhybrid composite resin (52.1%) are the most commonly used materials. (bvsalud.org)
  • The conventional two-step adhesive system is mostly used by DDSs. (bvsalud.org)
  • We believe the methodology proposed may be a key part of advanced decision support systems for policymakers and operators that are dealing with the on-going transition from conventional bus fleets towards greener transport solutions. (uni.lu)
  • According to one of Nestwave's blog posts on signal processing , received signals are processed using symmetrical matched filters (MF) in conventional systems. (allaboutcircuits.com)
  • This course examines the utilization and storage for renewable technologies such as wind, solar, biomass, fuel cells and hybrid systems and for more conventional fossil fuel-based technologies. (arava.org)
  • In this paper, Hybrid Neuro-Fuzzy Controller is proposed to replace the conventional PI torque and flux controller to achieve desired torque and flux with zero steady state error and also with good dynamic fast response. (sciencepubco.com)
  • Ability to analyze problems using conventional (analysis or similarity) and computerized techniques within established processes. (panasonic.com)
Analytical2
  • In my experience working proactively with federal agencies, I've found identifying complex fraud schemes (and the criminals behind them) is only possible when agencies use a multifaceted, anti-fraud detection approach that combines sophisticated data integration with a hybrid analytical approach. (sas.com)
  • The combination of data integration and a hybrid analytical approach is key to uncovering the crime organizations in the first few months, which greatly limits potential losses to the government and taxpayers. (sas.com)
Theoretical3
  • Research papers clearly identify and justify a principled advance to the theoretical foundations for the construction and analysis of systems. (etaps.org)
  • We solicit the submission of unpublished results that address on both theoretical and applied aspects of hybrid modeling techniques in systems biology. (imag.fr)
  • Experiments carried out by a team of scientists from Delft University of Technology in the Netherlands and University of California, Santa Barbara, showed that theoretical development of this technique worked well in practice. (webpronews.com)
Principles3
  • While deep learning systems have been quite successfully applied to, for example, pattern recognition, image interpretation, speech recognition and translation, they can be characterized as overly data hungry, susceptible to adversarial attacks, opaque (non-interpretable by humans), and not informed by general principles such as causality or commonsense and domain knowledge. (dfki.de)
  • To do it without stretching themselves thin, they should follow main principles of hybrid work and incorporate the new scheduling techniques and tools that proved their effectiveness during the pandemic. (tmetric.com)
  • This workshop report is intended to provide scientists with a broad overview of relevant testicular toxicity literature and to suggest opportunities where bioengineering principles and techniques could be used to build improved in vitro testicular models for safety evaluation. (ainhibitor.com)
Multi-cloud and hybrid cloud1
  • Across industries, enterprises are taking advantage of multi-cloud and hybrid-cloud offerings. (informatica.com)
Random amplification1
  • These techniques include karyotyping, random amplification of polymorphic DNA, restriction fragment length polymorphism (RFLP), DNA hybridization studies, amplified fragment length polymorphism (AFLP), and polymerase chain reaction (PCR) fingerprinting ( 12 - 17 ). (cdc.gov)
Control25
  • But realizing stable suspension of hybrid magnet is a tricky problem in the suspension control sphere. (hindawi.com)
  • Considering from this point, we take magnetic flux signal as a state variable and put this signal back to suspension control system. (hindawi.com)
  • The experiments denote that the new hybrid suspension control algorithm based on magnetic flux signal feedback designed in this paper has more advantages than traditional position-current double cascade control algorithm. (hindawi.com)
  • therefore, promoting the robustness and stability of maglev control system is the destination of control engineers. (hindawi.com)
  • Literature [ 3 ] mainly designs a robust fuzzy-neural-network control (RFNNC) scheme for the levitated positioning of the linear maglev rail system with nonnegative inputs. (hindawi.com)
  • The influence of the PID control parameters on the response performance of the system is studied by using the MATLAB SISO [ 5 ]. (hindawi.com)
  • Wai and Lee [ 7 , 8 ] has designed an adaptive fuzzy-neural-network control (AFNNC) scheme by imitating a sliding-mode control (SMC) strategy for a magnetic-levitation (maglev) transportation system. (hindawi.com)
  • Based on sliding mode control with the feedback linearization, a kind of nonlinear control strategy of electrical Maglev air gap was offered the design method of the system was researched [ 9 ]. (hindawi.com)
  • A nonlinear robust control design for the levitation and propulsion of a magnetic levitation (maglev) system is presented, and a proposed recursive controller is designed using nonlinear state transformation and Lyapunov's direct method in order to guarantee global stability for the nonlinear maglev system [ 10 ]. (hindawi.com)
  • With its True-Hybrid control system, ZEISS ensures that both systems always work synchronously. (zeiss.com)
  • The True-Hybrid control system allows the user maximum operating freedom: a common control interface provides all important functions with the simplest possible handling. (zeiss.com)
  • Several techniques have been used to control hemorrhage. (medscape.com)
  • The control of higher order linear system is one of the main fields of research area that has been studied for decades because of the difficulty in designing a controller for such systems. (researchgate.net)
  • The hybrid system allows for a number of fun applications including new educational experiences with museum displays, enhanced board games with new levels of interactivity, the potential to direct desired smells from a diffuser to where they are needed, the ability to control motion in non-solid items (such as dry ice or fire) and the potential to synchronize these movements to music. (sussex.ac.uk)
  • The present study is concerned with the development of a condition monitoring system for high speed Computer Numerical Control (CNC) milling machine tools. (hud.ac.uk)
  • The motion control system of the CNC machine tool is described and the elements, which compose the axis drives including both the electrical components and the mechanical ones, are analysed and modelled. (hud.ac.uk)
  • We propose a Mixed Integer Linear Program to address the problem of optimal scheduling of a mixed fleet of electric and hybrid / non-electric buses, and employ it as predictor in a Model Predictive Control approach. (uni.lu)
  • The computer system controlled charging and discharging of the battery improves its cycle life, calendar life, and thermal control efficiency. (notes.io)
  • Among the Prius's choices are Toyota's application of a Smart Key System (the feature can be user-deactivated), DVD navigation on the multi-function display, Car Stability Control and Bluetooth for hands-free calling. (notes.io)
  • Many hybrid automated systems have evolved as the products of applications of modern information- and control-based methodologies to automate and integrate different functions of often complex technological systems. (iloencyclopaedia.org)
  • HAS was originally identified with the introduction of computer-based systems used in the design and operation of real-time control systems for nuclear power reactors, for chemical processing plants and for discrete parts-manufacturing technology. (iloencyclopaedia.org)
  • HAS can now also be found in many service industries, such as air traffic control and aircraft navigation procedures in the civil aviation area, and in the design and use of intelligent vehicle and highway navigation systems in road transportation. (iloencyclopaedia.org)
  • With continuing progress in computer-based automation, the nature of human tasks in modern technological systems shifts from those that require perceptual-motor skills to those calling for cognitive activities, which are needed for problem solving, for decision making in system monitoring, and for supervisory control tasks. (iloencyclopaedia.org)
  • Therefore, at present, many of the computer-integrated (technological) systems are not fully compatible with the inherent capabilities of the human operators as expressed by the skills and knowledge necessary for the effective control and monitoring of these systems. (iloencyclopaedia.org)
  • New hybrid fuzzy controller for direct torque control of induction motor drives, IEEE Trans, Power Electron, 18:1211-1219. (sciencepubco.com)
Applications8
  • The successes of symbolic reasoning techniques ("good old fashioned AI") are in such applications as automated (human-understandable, traceable) planning, diagnosis, design tasks, and question answering by cognitive virtual assistants but are often quite limited by the need of expensive, explicit knowledge acquisition and modelling, inefficient logic-based reasoning, and instability in the presence of noisy data. (dfki.de)
  • Furthermore, many applications function more effectively using a hybrid systems approach. (freecomputerbooks.com)
  • Before moving to Tokyo Tech, he graduated in Master for Distributed Systems and Applications from the Pierre & Mari Curie Paris 6 University. (insidehpc.com)
  • Android is a software stack for mobile devices that includes an operating system, middleware and key applications. (ijariie.com)
  • Prof.Vikram M Kakade, and Priya Gawande, "Attendance Monitoring System & Applications," International Journal Of Advance Research And Innovative Ideas In Education , vol. 3, no. 1, pp. 1585-1589, Jan-Feb 2017. (ijariie.com)
  • Machine Learning Techniques, Applications, and Potential Future Opportunities in Pressure Injuries (Bedsores) Management: A Systematic Review. (cdc.gov)
  • Currently, we mainly focus on the synthesis and basic understanding of Carbon Nanotubes (CNTs) , Graphene , Silk Fibroin (SF) , their hybrid materials , toward their applications in high performance, flexible and stretchable electronics and smart wearable systems. (yyzhanggroup.com)
  • It helps to transfer and sync different data types and formats between systems and applications. (informatica.com)
Combines2
  • With the True Black Hybrid Planetarium, ZEISS combines the optical-mechanical starry sky projection of a ZEISS star projector with the high-contrast projection of the ZEISS VELVET LED projector. (zeiss.com)
  • Its recent application to high-rate digital communications, particularly for use in urban environments where robust propagation in structures is required, is an innovative technique that combines the ability to transmit high-rate digital data at low power. (cdc.gov)
Intelligent systems1
  • This seminar (HyLEAR) is concerned with selected hybrid intelligent systems that combine techniques from machine learning with symbolic techniques from knowledge representation and reasoning. (dfki.de)
Modulation techniques2
  • Newer modulation techniques, such as binary offset carrier (BOC), allocate energy around sub-carriers. (allaboutcircuits.com)
  • The objective of these modulation techniques is a useful datalink, including the ability to differentiate between the triangulation satellites and provide estimated distances. (allaboutcircuits.com)
Processes2
  • Hybrid AM is the use of AM process with one or more secondary processes or energy sources that are fully coupled and synergistically affect part quality, functionality, and/or process performance. (unl.edu)
  • Conducting trade studies to determine improvements to system capabilities and system delivery processes (hardware, software, architecture, automated deployments, training). (hired.com)
20192
  • Application of Multi-Objective Optimization Techniques for Improved Emissions and Fuel Economy over Transient Manoeuvres," SAE Technical Paper 2019-01-1177, 2019, https://doi.org/10.4271/2019-01-1177 . (sae.org)
  • 1] van Harmelen, F. & Teije, A.T. (2019): A Boxology of Design Patterns for Hybrid Learning and Reasoning Systems. (dfki.de)
Environments1
Microscopy1
  • Some examples of techniques that will be used are: texture analysis, dynamic rheology, microscopy, and sensory evaluation. (uoguelph.ca)
Biomass1
  • BioMH - biomass heating system decision support tool. (strath.ac.uk)
Approach10
  • In this paper, a multiple Lyapunov functions based approach is presented for the stability analysis for switched systems. (semanticscholar.org)
  • The approach followed in this paper looks at the existence of a switched quadratic Lyapunov function to check asymptotic stability of the switched system under consideration and shows that the second condition is, in this case, less conservative. (semanticscholar.org)
  • This paper presents a novel approach to augment existing engine calibrations to deliver improved engine performance during a transient, through the application of multi-objective optimization techniques to the calibration of the Variable Valve Timing (VVT) system of a 1.0 litre gasoline engine. (sae.org)
  • This approach comprises robotics, image-guided surgical devices, surgical navigation systems, preoperative planners and simulators, and augmented-reality or hybrid-reality computer interfaces. (medscape.com)
  • In this work we develop an optimal vehicle scheduling approach for next generation PT systems, considering the instance of mixed electric / hybrid fleet. (uni.lu)
  • In this work we develop a dynamic fleet management approach for next generation Public Transportation systems, considering the instance of mixed electric / hybrid fleet. (uni.lu)
  • Test results based upon a real-life scenario showcase how the proposed approach is indeed capable of yielding a sizable reduction in operational costs, even when considerable disturbances arise from the underlying system. (uni.lu)
  • The generic digital RF front-end allows external vendor RF transceivers, which could enable interesting triangulation efficiencies with Nestwave's hybrid approach to geolocation, using other technologies such as 4G/5G signal multilateration or Wi-Fi sniffing . (allaboutcircuits.com)
  • With the reopening of offices, a reset for hybrid work will require marketing teams to take a new approach to time management that we would like to discuss in this post. (tmetric.com)
  • Though a high level of uncertainty is still prevailing, there is no argument around hybrid work as the top on the list of employees' preferences , which requires a new approach to time management and the implementation of the best hybrid workplace solutions. (tmetric.com)
Affine2
  • In this paper we present various algorithms both for stability analysis and state-feedback design for discrete-time piecewise affine systems. (semanticscholar.org)
  • A Maglev system is modeled by two self-organizing neural-fuzzy techniques to achieve linear and affine Takagi-Sugeno (T-S) fuzzy systems [ 4 ]. (hindawi.com)
Detection2
  • Before moving to BSC he was a postdoctoral researcher for three years at the Argonne National Laboratory, where he investigated data corruption detection techniques and error propagation. (insidehpc.com)
  • One research group reported the presence of measles virus particles and genomic RNAin inflammatory bowel disease tissues, but this could not be confirmed by other groups, despite use of techniques that are highly specific and sensitive for the detection of measles virus nucleic acid in clinical specimens down to the molecular level. (who.int)
Practices1
  • Watch to on-demand Webinars, hosted by experts, about proven database management system practices. (mcobject.com)
Performance6
  • These RES are intermittent in nature and impact the system performance significantly. (inderscience.com)
  • Focus on component sizing and system performance analysis. (strath.ac.uk)
  • In-memory database systems (IMDSs) such as McObject's e X treme DB offer superior performance and the possibility of very small RAM, CPU and storage demands. (mcobject.com)
  • In addition, his paper " FTI : High Performance Fault Tolerance Interface for Hybrid Systems " was awarded with a Special Certificate of Recognition for achieving a perfect score at the Supercomputing Conference (SC'11). (insidehpc.com)
  • In the past several years, we have reported the feeding of CNTs and graphene to silkworms for enhanced silk fibers, high performance strain-pressure sensors based on carbonized natural fiber fabrics, silk E-skins, silk nanofiber air filtration membranes, CVD growth of pentagon-shaped graphene, CVD growth of the world's longest CNTs, optical visualization technique of individual CNTs and monolayer graphene, experimental observation of superlubricity in double-walled carbon nanotubes, etc. (yyzhanggroup.com)
  • In an effort to improve exposure estimates, this study developed and evaluated the performance of several hybrid exposure estimates created by combining information from individual assessment techniques. (cdc.gov)
Limitations3
  • Both types of AI techniques have their strengths and limitations. (dfki.de)
  • A building using a fully precast system can often be built at approximately 10-14 days per floor depending on the area and logistic limitations. (atilla.co)
  • OBJECTIVES: Any exposure estimation technique has inherent strengths and limitations. (cdc.gov)
Quantum7
  • Scientists have overcome a major hurdle facing quantum computing: how to protect quantum information from degradation by the environment while simultaneously performing computation in a solid-state quantum system. (webpronews.com)
  • Solid-state hybrid systems are useful for quantum information processing because they are made up of different types of qubits that each perform different functions, much like different parts of a car combine to move it down the road. (webpronews.com)
  • This type of hybrid system may be particularly good for quantum information processing because electrons move fast, can be manipulated easily, but they also lose quantum information quickly. (webpronews.com)
  • You can see an analogy between this hybrid quantum system and the parts of a classical computer: the processor works fast but doesn't keep information long, while the memory works slowly but stores information for a long time. (webpronews.com)
  • The researchers took the technique one step further and showed that it can be used for small-scale quantum information processing. (webpronews.com)
  • This is the first time a robust quantum computation has been demonstrated using a solid-state system with individual spins," said Dobrovitski. (webpronews.com)
  • We showed that even with the inevitable imperfections of experiments, we can use this system to do quantum information processing in a way that beats its classical counterpart. (webpronews.com)
Algorithms4
  • TACAS is a forum for researchers, developers and users interested in rigorously based tools and algorithms for the construction and analysis of systems. (etaps.org)
  • The conference aims to bridge the gaps between different communities with this common interest and to support them in their quest to improve the utility, reliability, flexibility and efficiency of tools and algorithms for building systems. (etaps.org)
  • The book presents hybrid techniques based on Artificial Neural Network, Fuzzy Sets, Automata Theory, other metaheuristic or classical algorithms, etc. (freecomputerbooks.com)
  • Integrates contrasting techniques of genetic algorithms, artificial immune systems, particle swarm optimization, and hybrid models to solve many real-world problems. (freecomputerbooks.com)
Implementation4
  • In the next step, we use the modular code generator to convert the testing and monitoring automata into code that can be linked with the system code to perform the validation tasks on the implementation level. (upenn.edu)
  • It seems like a win-win scenario but in actuality, the implementation of hybrid-related changes is not easy, especially in marketing that is associated with meeting tight deadlines and working under terms of the high level of project management dependencies . (tmetric.com)
  • This application mainly focusses on the implementation of a system capable of encrypting of browser artefacts using encryption techniques. (ijrte.org)
  • This system will hopefully contribute to a better web browser over the existing techniques by doing some minor changes in the implementation framework. (ijrte.org)
Parameters3
  • This thesis applies recent modelling techniques to represent all parameters which affect the accuracy of a component produced automatically. (hud.ac.uk)
  • The AE monitoring techniques investigated can be categorised into traditional AE parameters of energy, event duration and peak amplitude. (hud.ac.uk)
  • The main properties of the mu FECs are calculated using the actual geometric parameters of the system (emitting nanotip radius similar to 15-20 nm, interelectrode distance similar to 1.5-2 mu m, etc. (ainhibitor.com)
Inherent1
  • to learn and practice the creation of digital assets, mainly hard surface models, - to understand and know how to use digital lighting as well as to define the correct rendering settings (Arnold render), - to understand the techniques inherent to the creation of digital images and to anticipate postproduction, - to understand the operation of different tools. (speos-photo.com)
Mathematical2
  • In this paper, we formulate a uniform mathematical framework for studying switched systems with piecewise linear partitioned state space and state dependent switching. (semanticscholar.org)
  • So we can get the hybrid suspension mathematical model based on magnetic flux signal feedback. (hindawi.com)
Journal2
  • article{Branicky1998MultipleLF, title={Multiple Lyapunov functions and other analysis tools for switched and hybrid systems}, author={Michael S. Branicky}, journal={IEEE Trans. (semanticscholar.org)
  • Journal Management System. (ac.ir)
Substances1
  • As with the other immunoglobulins, IgY is a class of proteins which are formed by the immune system in reaction to certain foreign substances, and specifically recognize them. (chinaelisa.com)
Characterization1
  • Using two techniques of characterization, neutron reflectometry (for deuterated polyelectrolytes) and absorbance spectroscopy (for ion-sensitive dyes), it is demonstrated that the mineral layer acts as a barrier for the transport of ions along the film normal. (epj.org)
World's1
  • Internships in the Multilingual Engine team offer the opportunity to work with state-of-the-art database and virtual machine technology, and have a direct impact on the world's premier database system. (oracle.com)
Analysis6
  • We introduce some analysis tools for switched and hybrid systems. (semanticscholar.org)
  • IEEE 33 and 69 bus test systems are taken for analysis. (inderscience.com)
  • Image analysis and processing is steadily gaining relevance within the large number of application fields to which genetic and evolutionary computation (GEC) techniques are applied. (freecomputerbooks.com)
  • Two-hybrid techniques refer to analysis for protein-protein interactions, one-hybrid for DNA -protein interactions, three-hybrid interactions for RNA -protein interactions or ligand-based interactions. (bvsalud.org)
  • Reverse n-hybrid techniques refer to analysis for mutations or other small molecules that dissociate known interactions. (bvsalud.org)
  • In the third phase, the system will be improved based on end-user feedback and analysis from a second installation. (swedishmininginnovation.se)
Data10
  • Topics and skills covered include qualitative data collection, customer development communication, and user interview techniques. (concordia.ca)
  • Through collaboration with the health system, NLCHI supports the development of data and technical standards, maintains key health databases, carries out analytics and evaluation, and supports health research. (amazon.com)
  • By handling the data acquisition task, the LTC6802 enables designers to implement state-of-the-art battery management techniques. (analog.com)
  • The milling power was analyzed using the Data Dependent Systems (DDS) technique. (unl.edu)
  • DDS can directly analyze the experimental data using time series modeling and removes the need to fully understand the system being analyzed. (unl.edu)
  • The U.S. Bureau of Mines has developed an intrinsically safe carbon monoxide (CO) monitoring system for mines by coupling a fiber-optic data telemetry system with a prototype electrochemical CO monitor. (cdc.gov)
  • In a communications system that conducts differential data via a pair of wires, AC common mode noise is undesirably coupled to the wires in a noisy environment. (justia.com)
  • A hybrid common mode choke (HCMC) attenuates the AC common mode noise while passing the differential data to a PHY. (justia.com)
  • In 2012 a hybrid electronic medical registry (HEMR) was introduced to capture routine data and to generate reports on morbidity and mortality. (bvsalud.org)
  • A hybrid study combining technological production and methodological research aiming to establish associations between the data and information that are part of a Computerized Nursing Process according to the ICNP® Version 1.0, indicators of patient safety and quality of care. (bvsalud.org)
Combine1
  • However, the project has been a great trip of discovery, helping us understand how crucial it is to have high spatial resolution (i.e. the metamaterial), or the techniques required to combine PATs and metamaterials. (sussex.ac.uk)
Molecular2
  • Both techniques grouped all isolates into eight previously established molecular types. (cdc.gov)
  • The aims of this study were the following: 1) to extend the from the environment, which primarily colonize the lung and molecular epidemiologic survey to other parts of the world, 2) subsequently invade the central nervous system (4). (cdc.gov)
Technology10
  • The Technology segment will generate maximum revenue in the electric and hybrid aircraft propulsion system market. (theautochannel.com)
  • NLCHI supports the regional health authorities, as well as the patients and communities they serve, in the delivery of information technology (IT) and eHealth services applied in the healthcare system to provide quality care. (amazon.com)
  • Some hybrid suspension experiments have been done on CMS04 magnetic suspension bogie of National University of Defense Technology (NUDT) in China. (hindawi.com)
  • designed a detailed discourse upon the key technology involved in maglev system, and the method has been carried out in Shanghai maglev traffic on-site, and the results are very significant [ 6 ]. (hindawi.com)
  • [ 41 ] As the technology improves and familiarity grows with these techniques, it will likely be used in the management of pelvic fractures. (medscape.com)
  • The technology has been in use in radar systems for some time because the wide bandwidth results in very accurate timing and allows accurate ranging. (cdc.gov)
  • They are experts in advanced Diagnostic and fault-finding techniques using the latest technology approved by Toyota. (malones.ie)
  • Nestware is an IoT geolocation company that provides hybrid-signal technology to IoT modem and DSP vendors. (allaboutcircuits.com)
  • A hybrid automated system (HAS) aims to integrate the capabilities of artificially intelligent machines (based on computer technology) with the capacities of the people who interact with these machines in the course of their work activities. (iloencyclopaedia.org)
  • Designers of many hybrid automated systems focus primarily on the computer-aided integration of sophisticated machines and other equipment as parts of computer-based technology, rarely paying much attention to the paramount need for effective human integration within such systems. (iloencyclopaedia.org)
Levitation1
  • The development opens up new potential in ultrasound levitation, which has a distinct advantage over other levitation techniques because it requires no specific physical properties, such as magnetic or electric, in the object to be levitated and can therefore be applied to a far wider range of materials including liquids and food. (sussex.ac.uk)
Magnetic3
  • The long living spin state of single defects can be readout optically and manipulated using well established magnetic resonance technique. (uni-ulm.de)
  • The hybrid suspension system model based on magnetic flux feedback is given in Figure 2 . (hindawi.com)
  • In the case of Dobrovitski's work, the hybrid system includes magnetic moments of an electron and a nucleus. (webpronews.com)
Reduction1
  • Many noise reduction techniques have been developed in the contemporary era to remove noise while preserving image information. (researchgate.net)
Strengths2
  • The resulting embedded database system retains in-memory strengths ( speed , small database footprint , intuitive native API , etc.), yet leverages the potential cost savings and increased durability of an on-disk database. (mcobject.com)
  • In this seminar, we will take a closer look at selected techniques and systems for hybrid learning and reasoning or planning, and discuss their strengths and weaknesses. (dfki.de)
Capacitors1
  • Super Alloy Power II includes premium alloy chokes, solid polymer capacitors ASUS FanConnect II equips 2 hybrid-controlled fan headers for optimal system cooling. (deals499.com)
Model7
  • Literature [ 1 ] founded the hybrid suspension model based on current feedback. (hindawi.com)
  • Simple model of hybrid suspension system. (hindawi.com)
  • Model-Based Testing and Monitoring for Hybrid Embedded Systems" by Li Tan, Jesung Kim et al. (upenn.edu)
  • We propose an integrated framework for testing and monitoring the model-based embedded systems. (upenn.edu)
  • The framework incorporates three components: 1) model-based test generation for hybrid system, 2) run-time verification, and 3) modular code generation for hybrid systems. (upenn.edu)
  • A model is a simplification of a real machine to visualize the dynamics of a mechatronic system. (hud.ac.uk)
  • The hybrid workplace model, aside from the task of managing work hours with efficiency, imposes a challenging mission of coordinating team efforts regardless of differences in team members' location in real-time. (tmetric.com)
IEEE1
  • 6] S. Mondal and D. Kastha, ''Maximum active and reactive power capability of a matrix converter-fed DFIG-based wind energy conversion system,'' IEEE J. Emerg. (ijoscience.com)
Discrete2
  • In this paper, a new multiple Lyapunov function is proposed to obtain the improved stability conditions for discrete-time switched systems. (semanticscholar.org)
  • This paper addresses the stability of the switched systems with discrete and distributed time delays. (semanticscholar.org)
Monitoring5
  • Power Quality Monitoring of Low Voltage Distribution System Towards Smart Distribution Grid Through IoT 4. (routledge.com)
  • Health Monitoring of Transformer in Smart Distribution Systems using IoT 5. (routledge.com)
  • A novel machine feed drive condition monitoring system using acoustic emission (AE) signals has been proposed. (hud.ac.uk)
  • In Schools, Colleges, Institutions there is a problem of irregularity of system in form of attendance this paper clears the idea of attendance monitoring used specifically in home automation system For this home automation and security system we are targeting Android platform since it has huge market and open source. (ijariie.com)
  • Building an editing and post-production system: which gear is involved (computer, storage requirements, display and video monitoring, audio monitoring). (speos-photo.com)
Robustness2
  • Converse Lyapunov theorems for a finite family of pairwise commuting semistable systems are developed and some robustness results for asymptotic stability and semistability of switched systems are derived. (semanticscholar.org)
  • Obviously, the robustness and stability of hybrid suspension system have been enhanced. (hindawi.com)
Decomposition1
  • We propose a Mixed In- teger Linear Program (MILP) to address the problem of optimal scheduling of a mixed fleet of electric and hybrid / non-electric buses, coupled with an ad-hoc decomposition scheme aimed at enhancing the scalability of the proposed MILP. (uni.lu)
Surgical techniques2
  • If these percutaneous techniques are to be considered as alternatives to traditional surgical methodologies in low-risk to medium-risk patients, they must demonstrate hemodynamic effects, safety, and durability comparable to those of the current highly refined surgical techniques. (medscape.com)
  • Endometriosis: Advanced management and surgical techniques. (cdc.gov)
Clinically1
  • n\nConclusion: Mobisante MobiUS system was able to acquire clinically useful images of the suprahyoid airway and muscular architecture in the mouth floor and allowed accurate measurements Batimastat mw of linear distances. (ainhibitor.com)
Theories1
  • The course will begin with a general survey of basic legal concepts, practical theories and judicial systems that are commonly used around the world today. (arava.org)
Frequency1
  • This includes an overview of failure types and frequency in current HPC systems. (insidehpc.com)
Part III - Practical Internet Groupware [Book]
Part III - Practical Internet Groupware [Book] (oreilly.com)
SoCPaR 2013 : Soft Computing and Pattern Recognition
SoCPaR 2013 : Soft Computing and Pattern Recognition (wikicfp.com)
(dealnews.com)
Orchestration and Reconfguration Control Architecture | ORCA Project | Results | H2020 | CORDIS | European Commission
Orchestration and Reconfguration Control Architecture | ORCA Project | Results | H2020 | CORDIS | European Commission (cordis.europa.eu)
Luke Lambourne, Ph.D. | Harvard Catalyst Profiles | Harvard Catalyst
Luke Lambourne, Ph.D. | Harvard Catalyst Profiles | Harvard Catalyst (connects.catalyst.harvard.edu)
(researchgate.net)
TACAS
TACAS (etaps.org)
IoT, Machine Learning and Blockchain Technologies for Renewable Energy
IoT, Machine Learning and Blockchain Technologies for Renewable Energy (routledge.com)
سامانه نشر مجلات علمی دانشگاه تهران
سامانه نشر مجلات علمی دانشگاه تهران (journals.ut.ac.ir)
US20180054319A9 - Method, Apparatus, And System For Establishing A Dedicated Communication - Google Patents
US20180054319A9 - Method, Apparatus, And System For Establishing A Dedicated Communication - Google Patents (patents.google.com)
5 November 2015, Innovative Otago research supported by prestigious Marsden funding, Media releases, University of Otago, New...
5 November 2015, Innovative Otago research supported by prestigious Marsden funding, Media releases, University of Otago, New... (otago.ac.nz)
MeSH Browser
MeSH Browser (meshb.nlm.nih.gov)
Gesamtpublikationsliste | Max-Planck-Institut für Polymerforschung
Gesamtpublikationsliste | Max-Planck-Institut für Polymerforschung (mpip-mainz.mpg.de)
US20010021914A1 - Personalized recommendations of items represented within a database - Google Patents
US20010021914A1 - Personalized recommendations of items represented within a database - Google Patents (patents.google.com)
How NLCHI provides hybrid access to their EHR system through AWS PrivateLink | AWS Public Sector Blog
How NLCHI provides hybrid access to their EHR system through AWS PrivateLink | AWS Public Sector Blog (aws.amazon.com)
Differences in Architects and Nonarchitects' Perception of Urban Design: An Application of Kansei Engineering Techniques
Differences in Architects and Nonarchitects' Perception of Urban Design: An Application of Kansei Engineering Techniques (riunet.upv.es)
PDF] A Hybrid Data-Driven Deep Learning Technique for Fluid-Structure Interaction | Semantic Scholar
PDF] A Hybrid Data-Driven Deep Learning Technique for Fluid-Structure Interaction | Semantic Scholar (semanticscholar.org)
DS-4000™ Digital Squeegee® Hybrid Printing System :: Textile Screen Printing Equipment
DS-4000™ Digital Squeegee® Hybrid Printing System :: Textile Screen Printing Equipment (mrprint.com)
High Voltage Battery Stack Monitor Supports Hybrid/Electric Vehicles & Battery Backup Systems | Analog Devices
High Voltage Battery Stack Monitor Supports Hybrid/Electric Vehicles & Battery Backup Systems | Analog Devices (analog.com)
Akhilesh Pandey - Research output - Mayo Clinic
Akhilesh Pandey - Research output - Mayo Clinic (mayoclinic.pure.elsevier.com)
Jos Alberto Ben tez-Andrades - Google Scholar
Jos Alberto Ben tez-Andrades - Google Scholar (scholar.google.es)
True Black Hybrid Planetarium
True Black Hybrid Planetarium (zeiss.com)
Sustainability | Free Full-Text | Remediation of Polluted River Water by Biological, Chemical, Ecological and Engineering...
Sustainability | Free Full-Text | Remediation of Polluted River Water by Biological, Chemical, Ecological and Engineering... (mdpi.com)
Design of Magnetic Flux Feedback Controller in Hybrid Suspension System
Design of Magnetic Flux Feedback Controller in Hybrid Suspension System (hindawi.com)
Model-Based Testing and Monitoring for Hybrid Embedded Systems by Li Tan, Jesung Kim et al.
"Model-Based Testing and Monitoring for Hybrid Embedded Systems" by Li Tan, Jesung Kim et al. (repository.upenn.edu)
12136008 | Yearbooks 2019 | University of Pretoria
12136008 | Yearbooks 2019 | University of Pretoria (up.ac.za)
Research on calibration method of hybrid Body-in-White online measurement system | (2020) | Jia | Publications | Spie
Research on calibration method of hybrid Body-in-White online measurement system | (2020) | Jia | Publications | Spie (spie.org)
PDF) Biotechnological strategies for the recovery of valuable and critical raw materials from waste electrical and electronic...
PDF) Biotechnological strategies for the recovery of valuable and critical raw materials from waste electrical and electronic... (researchgate.net)
Keyword: Soft computing technique
Keyword: Soft computing technique (easychair.org)
OVGU - Forschungsportal-Portrait: Prof. Diedrich
OVGU - Forschungsportal-Portrait: Prof. Diedrich (ovgu.de)
IIITM Gwalior
IIITM Gwalior (iiitm.ac.in)