Screening techniques first developed in yeast to identify genes encoding interacting proteins. Variations are used to evaluate interplay between proteins and other molecules. Two-hybrid techniques refer to analysis for protein-protein interactions, one-hybrid for DNA-protein interactions, three-hybrid interactions for RNA-protein interactions or ligand-based interactions. Reverse n-hybrid techniques refer to analysis for mutations or other small molecules that dissociate known interactions.
The genetic process of crossbreeding between genetically dissimilar parents to produce a hybrid.
Any cell, other than a ZYGOTE, that contains elements (such as NUCLEI and CYTOPLASM) from two or more different cells, usually produced by artificial CELL FUSION.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Theory and development of COMPUTER SYSTEMS which perform tasks that normally require human intelligence. Such tasks may include speech recognition, LEARNING; VISUAL PERCEPTION; MATHEMATICAL COMPUTING; reasoning, PROBLEM SOLVING, DECISION-MAKING, and translation of language.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
The parts of a macromolecule that directly participate in its specific combination with another molecule.
The adaptive superiority of the heterozygous GENOTYPE with respect to one or more characters in comparison with the corresponding HOMOZYGOTE.
An individual that contains cell populations derived from different zygotes.
A method for ordering genetic loci along CHROMOSOMES. The method involves fusing irradiated donor cells with host cells from another species. Following cell fusion, fragments of DNA from the irradiated cells become integrated into the chromosomes of the host cells. Molecular probing of DNA obtained from the fused cells is used to determine if two or more genetic loci are located within the same fragment of donor cell DNA.
Deliberate breeding of two different individuals that results in offspring that carry part of the genetic material of each parent. The parent organisms must be genetically compatible and may be from different varieties or closely related species.
Any method used for determining the location of and relative distances between genes on a chromosome.
Widely used technique which exploits the ability of complementary sequences in single-stranded DNAs or RNAs to pair with each other to form a double helix. Hybridization can take place between two complimentary DNA sequences, between a single-stranded DNA and a complementary RNA, or between two RNA sequences. The technique is used to detect and isolate specific sequences, measure homology, or define other characteristics of one or both strands. (Kendrew, Encyclopedia of Molecular Biology, 1994, p503)
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
The splitting of an ancestral species into daughter species that coexist in time (King, Dictionary of Genetics, 6th ed). Causal factors may include geographic isolation, HABITAT geometry, migration, REPRODUCTIVE ISOLATION, random GENETIC DRIFT and MUTATION.
A category of nucleic acid sequences that function as units of heredity and which code for the basic instructions for the development, reproduction, and maintenance of organisms.
Fusion of somatic cells in vitro or in vivo, which results in somatic cell hybridization.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Polyploidy with three sets of chromosomes. Triploidy in humans are 69XXX, 69XXY, and 69XYY. It is associated with HOLOPROSENCEPHALY; ABNORMALITIES, MULTIPLE; PARTIAL HYDATIDIFORM MOLE; and MISCARRAGES.
Mapping of the KARYOTYPE of a cell.
Established cell cultures that have the potential to propagate indefinitely.
A phenotypically recognizable genetic trait which can be used to identify a genetic locus, a linkage group, or a recombination event.
The chromosomal constitution of a cell containing multiples of the normal number of CHROMOSOMES; includes triploidy (symbol: 3N), tetraploidy (symbol: 4N), etc.
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
A genus herbs of the Asteraceae family. The SEEDS yield oil and are used as food and animal feed; the roots of Helianthus tuberosus (Jerusalem artichoke) are edible.
Sagittal sectioning and repositioning of the ramus of the MANDIBLE to correct a mandibular retrusion, MALOCCLUSION, ANGLE CLASS III; and PROGNATHISM. The oblique sectioning line consists of multiple cuts horizontal and vertical to the mandibular ramus.
Platforms that provide the ability and tools to create and publish information accessed via the INTERNET. Generally these platforms have three characteristics with content user generated, high degree of interaction between creator and viewer, and easily integrated with other sites.
Recording of visual and sometimes sound signals on magnetic tape.
The grafting or inserting of a prosthetic device of alloplastic material into the oral tissue beneath the mucosal or periosteal layer or within the bone. Its purpose is to provide support and retention to a partial or complete denture.
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
A dental specialty concerned with the diagnosis and surgical treatment of disease, injuries, and defects of the human oral and maxillofacial region.
The storing or preserving of video signals for television to be played back later via a transmitter or receiver. Recordings may be made on magnetic tape or discs (VIDEODISC RECORDING).
The science and technology dealing with the procurement, breeding, care, health, and selection of animals used in biomedical research and testing.
A scanning microscope-based, cytofluorimetry technique for making fluorescence measurements and topographic analysis on individual cells. Lasers are used to excite fluorochromes in labeled cellular specimens. Fluorescence is detected in multiple discrete wavelengths and the locational data is processed to quantitatively assess APOPTOSIS; PLOIDIES; cell proliferation; GENE EXPRESSION; PROTEIN TRANSPORT; and other cellular processes.
The ability to learn and to deal with new situations and to deal effectively with tasks involving abstractions.
Conferences, conventions or formal meetings usually attended by delegates representing a special field of interest.
Computer programs based on knowledge developed from consultation with experts on a problem, and the processing and/or formalizing of this knowledge using these programs in such a manner that the problems may be solved.
Approximate, quantitative reasoning that is concerned with the linguistic ambiguity which exists in natural or synthetic language. At its core are variables such as good, bad, and young as well as modifiers such as more, less, and very. These ordinary terms represent fuzzy sets in a particular problem. Fuzzy logic plays a key role in many medical expert systems.
An abnormal balloon- or sac-like dilatation in the wall of the ABDOMINAL AORTA which gives rise to the visceral, the parietal, and the terminal (iliac) branches below the aortic hiatus at the diaphragm.
A heterogeneous condition in which the heart is unable to pump out sufficient blood to meet the metabolic need of the body. Heart failure can be caused by structural defects, functional abnormalities (VENTRICULAR DYSFUNCTION), or a sudden overload beyond its capacity. Chronic heart failure is more common than acute heart failure which results from sudden insult to cardiac function, such as MYOCARDIAL INFARCTION.
The tearing or bursting of the wall along any portion of the AORTA, such as thoracic or abdominal. It may result from the rupture of an aneurysm or it may be due to TRAUMA.
An abnormal balloon- or sac-like dilatation in the wall of AORTA.
NECROSIS of the MYOCARDIUM caused by an obstruction of the blood supply to the heart (CORONARY CIRCULATION).
A symptom complex characterized by pain and weakness in SKELETAL MUSCLE group associated with exercise, such as leg pain and weakness brought on by walking. Such muscle limpness disappears after a brief rest and is often relates to arterial STENOSIS; muscle ISCHEMIA; and accumulation of LACTATE.
The interaction of persons or groups of persons representing various nations in the pursuit of a common goal or interest.
Authoritative treatises on drugs and preparations, their description, formulation, analytic composition, physical constants, main chemical properties used in identification, standards for strength, purity, and dosage, chemical tests for determining identity and purity, etc. They are usually published under governmental jurisdiction (e.g., USP, the United States Pharmacopoeia; BP, British Pharmacopoeia; P. Helv., the Swiss Pharmacopoeia). They differ from FORMULARIES in that they are far more complete: formularies tend to be mere listings of formulas and prescriptions.
Government sponsored social insurance programs.
An agency of the PUBLIC HEALTH SERVICE concerned with the overall planning, promoting, and administering of programs pertaining to maintaining standards of quality of foods, drugs, therapeutic devices, etc.
Process that is gone through in order for a drug to receive approval by a government regulatory agency. This includes any required pre-clinical or clinical testing, review, submission, and evaluation of the applications and test results, and post-marketing surveillance of the drug.
The collective designation of three organizations with common membership: the European Economic Community (Common Market), the European Coal and Steel Community, and the European Atomic Energy Community (Euratom). It was known as the European Community until 1994. It is primarily an economic union with the principal objectives of free movement of goods, capital, and labor. Professional services, social, medical and paramedical, are subsumed under labor. The constituent countries are Austria, Belgium, Denmark, Finland, France, Germany, Greece, Ireland, Italy, Luxembourg, Netherlands, Portugal, Spain, Sweden, and the United Kingdom. (The World Almanac and Book of Facts 1997, p842)

Huckebein repressor activity in Drosophila terminal patterning is mediated by Groucho. (1/6595)

The Groucho corepressor mediates negative transcriptional regulation in association with various DNA-binding proteins in diverse developmental contexts. We have previously implicated Groucho in Drosophila embryonic terminal patterning, showing that it is required to confine tailless and huckebein terminal gap gene expression to the pole regions of the embryo. Here we reveal an additional requirement for Groucho in this developmental process by establishing that Groucho mediates repressor activity of the Huckebein protein. Putative Huckebein target genes are derepressed in embryos lacking maternal groucho activity and biochemical experiments demonstrate that Huckebein physically interacts with Groucho. Using an in vivo repression assay, we identify a functional repressor domain in Huckebein that contains an FRPW tetrapeptide, similar to the WRPW Groucho-recruitment domain found in Hairy-related repressor proteins. Mutations in Huckebein's FRPW motif abolish Groucho binding and in vivo repression activity, indicating that binding of Groucho through the FRPW motif is required for the repressor function of Huckebein. Taken together with our earlier results, these findings show that Groucho-repression regulates sequential aspects of terminal patterning in Drosophila.  (+info)

Temperature-sensitive RB mutations linked to incomplete penetrance of familial retinoblastoma in 12 families. (2/6595)

The tumor-suppressor activity of the retinoblastoma protein (RB) is encoded within a protein-binding ("pocket") domain that is targeted for mutations in all cases of familial retinoblastoma and in many common adult cancers. Although familial retinoblastoma is a paradigm for a highly penetrant, recessive model of tumorigenesis, the molecular basis for the phenotype of incomplete penetrance of familial retinoblastoma is undefined. We studied the RB pocket-binding properties of three independent, mutant RB alleles that are present in the germline of 12 kindreds with the phenotype of incomplete penetrance of familial retinoblastoma. Each arises from alterations of single codons within the RB pocket domain (designated "delta 480," "661W," or "712R"). Under the same conditions, we studied the properties of wild-type (WT) RB, an RB point mutant isolated from a lung carcinoma sample (706F) and an adjacent, in vitro-generated point mutant (707W). The delta 480, 661W, and 712R mutants lack pocket protein-binding activity in vitro but retain the WT ability to undergo cyclin-mediated phosphorylation in vivo. Each of the low-penetrant RB mutants exhibits marked enhancement of pocket protein binding when the cells are grown at reduced temperature. In contrast, in this temperature range, no change in binding activity is seen with WT RB, the 706F mutant, or the 707W mutant. We have demonstrated that many families with incomplete penetrance of familial retinoblastoma carry unstable, mutant RB alleles with temperature-sensitive pocket protein-binding activity. The variable frequency for tumor development in these families may result from reversible fluctuations in a threshold level of RB pocket-binding activity.  (+info)

MEF-2 function is modified by a novel co-repressor, MITR. (3/6595)

The MEF-2 proteins are a family of transcriptional activators that have been detected in a wide variety of cell types. In skeletal muscle cells, MEF-2 proteins interact with members of the MyoD family of transcriptional activators to synergistically activate gene expression. Similar interactions with tissue or lineage-specific cofactors may also underlie MEF-2 function in other cell types. In order to screen for such cofactors, we have used a transcriptionally inactive mutant of Xenopus MEF2D in a yeast two-hybrid screen. This approach has identified a novel protein expressed in the early embryo that binds to XMEF2D and XMEF2A. The MEF-2 interacting transcription repressor (MITR) protein binds to the N-terminal MADS/MEF-2 region of the MEF-2 proteins but does not bind to the related Xenopus MADS protein serum response factor. In the early embryo, MITR expression commences at the neurula stage within the mature somites and is subsequently restricted to the myotomal muscle. In functional assays, MITR negatively regulates MEF-2-dependent transcription and we show that this repression is mediated by direct binding of MITR to the histone deacetylase HDAC1. Thus, we propose that MITR acts as a co-repressor, recruiting a specific deacetylase to downregulate MEF-2 activity.  (+info)

MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. (4/6595)

The interaction of chromatin with the nuclear matrix via matrix attachment region (MAR) DNA is considered to be of fundamental importance for chromatin organization in all eukaryotic cells. MAR binding filament-like protein 1 (MFP1) from tomato is a novel plant protein that specifically binds to MAR DNA. Its filament protein-like structure makes it a likely candidate for a structural component of the nuclear matrix. MFP1 is located at nuclear matrix-associated, specklelike structures at the nuclear envelope. Here, we report the identification of a novel protein that specifically interacts with MFP1 in yeast two-hybrid and in vitro binding assays. MFP1 associated factor 1 (MAF1) is a small, soluble, serine/threonine-rich protein that is ubiquitously expressed and has no similarity to known proteins. MAF1, like MFP1, is located at the nuclear periphery and is a component of the nuclear matrix. These data suggest that MFP1 and MAF1 are in vivo interaction partners and that both proteins are components of a nuclear substructure, previously undescribed in plants, that connects the nuclear envelope and the internal nuclear matrix.  (+info)

Rpn9 is required for efficient assembly of the yeast 26S proteasome. (5/6595)

We have isolated the RPN9 gene by two-hybrid screening with, as bait, RPN10 (formerly SUN1), which encodes a multiubiquitin chain receptor residing in the regulatory particle of the 26S proteasome. Rpn9 is a nonessential subunit of the regulatory particle of the 26S proteasome, but the deletion of this gene results in temperature-sensitive growth. At the restrictive temperature, the Deltarpn9 strain accumulated multiubiquitinated proteins, indicating that the RPN9 function is needed for the 26S proteasome activity at a higher temperature. We analyzed the proteasome fractions separated by glycerol density gradient centrifugation by native polyacrylamide gel electrophoresis and found that a smaller amount of the 26S proteasome was produced in the Deltarpn9 cells and that the 26S proteasome was shifted to lighter fractions than expected. The incomplete proteasome complexes were found to accumulate in the Deltarpn9 cells. Furthermore, Rpn10 was not detected in the fractions containing proteasomes of the Deltarpn9 cells. These results indicate that Rpn9 is needed for incorporating Rpn10 into the 26S proteasome and that Rpn9 participates in the assembly and/or stability of the 26S proteasome.  (+info)

The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins. (6/6595)

The Rho family of GTPases plays key roles in the regulation of cell motility and morphogenesis. They also regulate protein kinase cascades, gene expression, and cell cycle progression. This multiplicity of roles requires that the Rho GTPases interact with a wide variety of downstream effector proteins. An understanding of their functions at a molecular level therefore requires the identification of the entire set of such effectors. Towards this end, we performed a two-hybrid screen using the TC10 GTPase as bait and identified a family of putative effector proteins related to MSE55, a murine stromal and epithelial cell protein of 55 kDa. We have named this family the Borg (binder of Rho GTPases) proteins. Complete open reading frames have been obtained for Borg1 through Borg3. We renamed MSE55 as Borg5. Borg1, Borg2, Borg4, and Borg5 bind both TC10 and Cdc42 in a GTP-dependent manner. Surprisingly, Borg3 bound only to Cdc42. An intact CRIB (Cdc42, Rac interactive binding) domain was required for binding. No interaction of the Borgs with Rac1 or RhoA was detectable. Three-hemagglutinin epitope (HA(3))-tagged Borg3 protein was mostly cytosolic when expressed ectopically in NIH 3T3 cells, with some accumulation in membrane ruffles. The phenotype induced by Borg3 was reminiscent of that caused by an inhibition of Rho function and was reversed by overexpression of Rho. Surprisingly, it was independent of the ability to bind Cdc42. Borg3 also inhibited Jun kinase activity by a mechanism that was independent of Cdc42 binding. HA(3)-Borg3 expression caused substantial delays in the spreading of cells on fibronectin surfaces after replating, and the spread cells lacked stress fibers. We propose that the Borg proteins function as negative regulators of Rho GTPase signaling.  (+info)

DOT4 links silencing and cell growth in Saccharomyces cerevisiae. (7/6595)

Transcriptional silencing in Saccharomyces cerevisiae occurs at specific loci and is mediated by a multiprotein complex that includes Rap1p and the Sir proteins. We studied the function of a recently identified gene, DOT4, that disrupts silencing when overexpressed. DOT4 encodes an ubiquitin processing protease (hydrolase) that is primarily located in the nucleus. By two-hybrid analysis, the amino-terminal third of Dot4p interacts with the silencing protein Sir4p. Cells lacking DOT4 exhibited reduced silencing and a corresponding decrease in the level of Sir4p. Together, these findings suggest that Dot4p regulates silencing by acting on Sir4p. In strains with several auxotrophic markers, loss of DOT4 ubiquitin hydrolase activity also results in a slow-growth defect. The defect can be partially suppressed by mutations in a subunit of the 26S proteasome, suggesting that Dot4p has the ability to prevent ubiquitin-mediated degradation. Furthermore, wild-type SIR2, SIR3, and SIR4 are required for full manifestation of the growth defect in a dot4 strain, indicating that the growth defect is caused in part by a silencing-related mechanism. We propose that Dot4p helps to restrict the location of silencing proteins to a limited set of genomic loci.  (+info)

Leukemic HRX fusion proteins inhibit GADD34-induced apoptosis and associate with the GADD34 and hSNF5/INI1 proteins. (8/6595)

One of the most common chromosomal abnormalities in acute leukemia is a reciprocal translocation involving the HRX gene (also called MLL, ALL-1, or HTRX) at chromosomal locus 11q23, resulting in the formation of HRX fusion proteins. Using the yeast two-hybrid system and human cell culture coimmunoprecipitation experiments, we show here that HRX proteins interact directly with the GADD34 protein. We have found that transfected cells overexpressing GADD34 display a significant increase in apoptosis after treatment with ionizing radiation, indicating that GADD34 expression not only correlates with apoptosis but also can enhance apoptosis. The amino-terminal third of the GADD34 protein was necessary for this observed increase in apoptosis. Furthermore, coexpression of three different HRX fusion proteins (HRX-ENL, HRX-AF9, and HRX-ELL) had an anti-apoptotic effect, abrogating GADD34-induced apoptosis. In contrast, expression of wild-type HRX gave rise to an increase in apoptosis. The difference observed here between wild-type HRX and the leukemic HRX fusion proteins suggests that inhibition of GADD34-mediated apoptosis may be important to leukemogenesis. We also show here that GADD34 binds the human SNF5/INI1 protein, a member of the SNF/SWI complex that can remodel chromatin and activate transcription. These studies demonstrate, for the first time, a gain of function for leukemic HRX fusion proteins compared to wild-type protein. We propose that the role of HRX fusion proteins as negative regulators of post-DNA-damage-induced apoptosis is important to leukemia progression.  (+info)

The constitutive androstane receptor (CAR) is a transcription factor that belongs to the nuclear receptor superfamily. CAR binds as a heterodimer with the retinoid X receptor α (RXRα) to CAR response elements (CAREs) and regulates the expression of various drug metabolizing enzymes and transporters. To identify CAR/RXRα binding sites in the human genome, we performed a modified yeast one-hybrid assay that enables rapid and efficient identification of genomic targets for DNA-binding proteins. DNA fragments were recovered from positive yeast colonies by PCR and sequenced. A motif enrichment analysis revealed that the most frequent motif was a direct repeat (DR) of RGKTCA-like core sequence spaced by 4 bp. Next, we predicted 149 putative CAR/RXRα binding sites from 414 unique clones, by searching for DRs, everted repeats (ERs) and inverted repeats (IRs) of the RGKTCA-like core motif. Based on gel mobility shift assays, the CAR/RXRα heterodimer could directly interact with the 108 predicted sequences,
In recent years, substantial progress has been made in the identification of proteins involved in peroxisome biogenesis. However, with the exception of the peroxisome-targeting signal receptors and the receptor docking proteins, the function of most of these proteins, called peroxins, remains largely unknown. One step toward elucidating the function of a protein is to identify its interacting partners. We have used a non-transcription-based bacterial two-hybrid system to analyze the interactions among a set of 12 mammalian peroxins and a yeast protein three-hybrid system to investigate whether proteins that interact with the same peroxin and have overlapping binding sites cooperate or compete for this site. Here we report a detailed interaction map of these peroxins and demonstrate that (i) farnesylation, and not the CAAX motif, of Pex19p strongly enhances its affinity for Pex13p; (ii) the CAAXmotif, and not farnesylation, of Pex19p strongly enhances its affinity for Pex11pβ; and (iii) the ...
To capture the Myo1p-interacting proteins for in vitro validation of the physical interactions identified by iMYTH, and for their subsequent identification by coimmunoprecipitation (coIP), we employed a modified pull-down approach (Babu et al. 2009) using a TAP epitope fused to the Myo1p C-terminus (Myo1-TAP). The Myo1-TAP bait strain was transformed with a full-length prey protein in expression vector BG1805, a URA3 multicopy 2 μ plasmid containing a GAL1 promoter (Gelperin et al. 2005), using the standard lithium acetate procedure (Gietz and Woods 2006). The Myo1 protein was captured using the calmodulin-binding peptide in the TAP epitope. Briefly, 40 ml of culture was grown for 2 d in YPD at 30° at 200 rpm. Subsequently, the cells were centrifuged at 3000 rpm for 3 min, and washed twice with 20 ml IPLB buffer (20 mM Hepes KOH, pH 7.4, 150 mM KOAc, 2 mM Mg(Ac)2, 2 mM CaCl2, and 10% glycerol). For plasmid expression, cells were resuspended in YP-GAL, and incubated for 2-4 hr. The yeast cells ...
Easy two-hybrid library construction enriched for longer inserts. Two highly specialized yeast strains that are optimized for exceptionally stringent two-hybrid library screening and two-hybrid library construction.
Four proteins namely U2AF35, SRp40, mDomino and Ddx1 were identified as PHF5a interacting partners by using the murine 11.5-days embryo yeast two-hybrid library screening.PHF5a interacting domains of SR proteins U2AF35 and SRp40 were restricted to Cterminal arginine-serine rich domains (RS).Other members of the SR protein family namely SRp20, SRp30c and ASF/SF2 were shown that they can not bind to the PHF5a protein by using a directed yeast twohybrid assay and the a-galactosidase assay.Protein interactions between PHF5a and U2AF35, SRp40, mDomino and Ddx1 were verified by using in vitro coimmmunoprecipitation assays.Mapping of binding sites by using coimmunoprecipitation experiments and a directed yeast two-hybrid assay demonstrated that both ATP-dependent helicases mDomino and Ddx1 interact with the C-terminal segment of PHF5a. In addition, the N-terminal part of PHF5a was identified as a region responsible for binding to splicing proteins U2AF35 and SRp40. By using the yeast-three hybrid assay ...
proteins function in similar ways. AGS1 binds to the Gβ1 subunit of heterotrimeric G proteins and we have used yeast two-hybrid studies to show that Rhes binds selectively to Gβ1, Gβ2 and Gβ3 subunits. Binding to the Gβ subunits involves the cationic regions of AGS1 and Rhes, and we used Rhes-AGS1 chimeras to show that their different cationic regions determine the Gβ-specificity of the interactions. Possible implications of this interaction for the activity of Rhes are discussed.. ...
If you are regularly doing ChIP-qPCR, ChIP-RNAseq or luciferase reporter assays to measure protein-DNA interactions, then this article is for you! ChIP
PMID: 14559993. SRrp86 is a unique member of the SR protein superfamily containing one RNA recognition motif and two serine-arginine (SR)-rich domains separated by an unusual glutamic acid-lysine (EK)-rich region. Previously, we showed that SRrp86 could regulate alternative splicing by both positively and negatively modulating the activity of other SR proteins and that the unique EK domain could inhibit both constitutive and alternative splicing. These functions were most consistent with the model in which SRrp86 functions by interacting with and thereby modulating the activity of target proteins. To identify the specific proteins that interact with SRrp86, we used a yeast two-hybrid library screen and immunoprecipitation coupled to mass spectrometry. We show that SRrp86 interacts with all of the core SR proteins, as well as a subset of other splicing regulatory proteins, including SAF-B, hnRNP G, YB-1, and p72. In contrast to previous results that showed activation of SRp20 by SRrp86, we now ...
Protein-protein interactions mediate fundamental biological processes. Yeast two-hybrid assays can be used to detect protein-protein interactions in a fast and large-scale manner. However, in traditional yeast-two hybrid assays, the prey and bait proteins must be located in the nucleus to activate reporter genes. This requirement limits the application of this assay in detecting membrane protein ...
Molecular Partners AG-Product Pipeline Review-2015. Summary. Global Markets Directs, Molecular Partners AG-Product Pipeline Review-2015, provides an overview of the Molecular Partners AGs pharmaceutical research and development focus.. This report provides comprehensive information on the current therapeutic developmental pipeline of Molecular Partners AGs, complete with comparative analysis at various stages, therapeutics assessment by drug target, mechanism of action (MoA), route of administration (RoA) and molecule type. It also reviews latest updates, and featured news and press releases, along with special features on late-stage and discontinued projects.. Global Markets Directs report features investigational drugs from across globe covering over 20 therapy areas and nearly 3,000 indications. The report is built using data and information sourced from Global Markets Directs proprietary databases, Company/University websites, SEC filings, investor presentations and featured press ...
Sanofi and GlaxoSmithKline have begun enrolling participants into a Phase III clinical study of their adjuvanted recombinant-protein Covid-19 vaccine candidate. The global randomised, double-blinded, placebo-controlled study will include about 35,000 volunteers aged 18 years and older from different countries, including sites in Asia, Africa, the US and Latin America. The study will assess vaccine formulations targeting the original D.614 virus and the B.1.351 variant across geographies. A booster trial is likely to begin in the coming weeks, with the vaccine expected to be approved by the end of 2021.. Novartis and Switzerland-based biopharma Molecular Partners have commenced the EMPATHY clinical trial, a Phase II and III study exploring the use of its DARPin therapeutic candidate ensovibep (MP0420) for treating Covid-19. Novartis is expected to conduct the clinical trial programme, with Molecular Partners as sponsor of the trials. Molecular Partners reported positive results from its initial ...
We present a technological advancement for the estimation of the affinities of Protein-Protein Interactions (PPIs) in living cells. A novel set of vectors is introduced that enables a quantitative yeast two-hybrid system based on fluorescent fusion proteins. The vectors allow simultaneous quantification of the reaction partners (Bait and Prey) and the reporter at the single-cell level by flow cytometry. We validate the applicability of this system on a small but diverse set of PPIs (eleven protein families from six organisms) with different affinities; the dissociation constants range from 117 pM to 17 µM. After only two hours of reaction, expression of the reporter can be detected even for the weakest PPI. Through a simple gating analysis, it is possible to select only cells with identical expression levels of the reaction partners. As a result of this standardization of expression levels, the mean reporter levels directly reflect the affinities of the studied PPIs. With a set of PPIs with known
Research in our lab is focused on membrane protein-protein interactions (PPIs), with a particular interest in disease progression due to altered signalling pathways. To this end, the lab has developed two new technologies to enable research in this notoriously difficult environment.. The first was the Membrane Yeast Two-Hybrid (MYTH) system. Based on the split-ubiquitin principle, bait and prey proteins are fused to Cub (C-terminal ubiquitin domain) plus a transcription factor (TF) and NubG (N-terminal domain, I13G mutation), respectively. A bait and prey interaction brings the two domains of ubiquitin into close proximity, forming pseudo-ubiquitin. This is recognized by deubiquitinating enzymes, which cleave off the TF. The TF enters the nucleus and activates a reporter system, allowing detection of interacting proteins.. MYTH has been successfully used in a number of studies, including building a comprehensive map of the yeast ABC transporter interactome (Snider et al. [2013] Nature ...
Alternative splicing of precursor mRNA is a fundamental mechanism to generate multiple proteins from a single gene. Although constitutive and alternative mRNA splicing is temporally and spatially regulated, deregulation of mRNA splicing could cause development, progression, and metastasis of tumors. Through yeast two-hybrid screening of a human breast cDNA library using estrogen receptor- (ER) as bait, we identified a novel nuclear receptor box containing full-length protein, nuclear protein E3-3 (NPE3-3). Our results revealed that NPE3-3 associates with not only ER but also with splicing factors, serine/arginine-rich protein (SRp)-30c, SRp40, and splicing factor SC-35, suggesting that NPE3-3 is likely to be involved in regulation of mRNA splicing. Accordingly, transient expression of NPE3-3 in cells resulted in expected splicing of the CD44 control minigene. We also discovered that NPE3-3-overexpressing clones produced a novel, previously unrecognized, alternatively spliced variant of ER ...
Dear colleagues, We are maintaining a Web page devoted to the yeast two-hybrid system. An integral part of this page is a database of false positives, isolated in two-hybrid screenings. We are also trying to analyze the parameters of YTH screens to suggest the optimal settings. We are asking for a favor: if you completed a YTH screen (does not matter if it was a success or a failure), please fill out our questionnaire on the Web page. It is our sincere hope that analysis of these data will be helpful for the scientific community. Our Web page also contains a lot of YTH-related information: list of plasmids, libraries, maps, sequences, protocols etc. http://www.fccc.edu/research/labs/golemis/InteractionTrapInWork.html Best regards, Ilya Serebriiskii ______________O_________oO_____________oO______o_______oO___________________ YEAST bionet newsgroup see: http://www.bio.net/hypermail/YEAST/ YEAST e-mail: messages sent to yeast at net.bio.net subscribe: e-mail biosci-server at net.bio.net with: ...
Activation of PXR by Tian Xian in Cell-Based Assays. To determine the extent to which the extract of tian xian activated human PXR we used a previously described cell-based reporter gene assay (Brobst et al., 2004). In CV-1 cells, 10 μM rifampicin activated the XREM-LUC reporter gene in the presence of transfected human PXR (Fig. 1). A stock extract of tian xian (250 mg/ml) was used to treat transfected CV-1 cells. A clear concentration response was also observed with increasing amounts of tian xian extract (Fig. 1). Thus, in CV-1 cells an extract of tian xian produced efficacious activation of human PXR. The activation of PXR by tian xian at the highest concentrations examined was comparable with that of 10 μM rifampicin, a well known PXR ligand.. Modulation of PXR-Cofactor Interactions in the Mammalian Two-Hybrid System. The interaction between accessory protein cofactors and PXR is modulated by the presence of activating ligands in cells. Specifically, in the absence of activating ligands ...
The Bcl-2-associated athanogene (BAG) family is an evolutionarily conserved, multifunctional group of cochaperones that perform diverse cellular functions ranging from proliferation to growth arrest and cell death in yeast, in mammals, and, as recently observed, in plants. The Arabidopsis genome contains seven homologs of the BAG family, including four with domain organization similar to animal BAGs. In the present study we show that an Arabidopsis BAG, AtBAG7, is a uniquely localized endoplasmic reticulum (ER) BAG that is necessary for the proper maintenance of the unfolded protein response (UPR). AtBAG7 was shown to interact directly in vivo with the molecular chaperone, AtBiP2, by bimolecular fluorescence complementation assays, and the interaction was confirmed by yeast two-hybrid assay. Treatment with an inducer of UPR, tunicamycin, resulted in accelerated cell death of AtBAG7-null mutants. Furthermore, AtBAG7 knockouts were sensitive to known ER stress stimuli, heat and cold. In these ...
The fluorescent two-hybrid assay (F2H) is a technique for the validation and characterization of protein-protein interactions in vivo. It can be used for studying the modulation of interactions with inhibitors or activators, for compound screening and for confirmation of results from other protein-protein interaction screens such as co-immunoprecipitation studies.. In short, two proteins, bait and prey protein, are fused to GFP and RFP, respectively. A BHK cell line is transformed with ChromoTeks F2H platform reagent and two DNA plasmids coding for the GFP-bait protein and the RFP-prey protein. The interaction of bait protein and prey protein can be detected by co-localization of a green and a red fluorescent spot in the nucleus of the BHK cells with an epi-fluorescence microscope.. PRODUCTS ...
The fluorescent two-hybrid assay (F2H) is a technique for the validation and characterization of protein-protein interactions in vivo. It can be used for studying the modulation of interactions with inhibitors or activators, for compound screening and for confirmation of results from other protein-protein interaction screens such as co-immunoprecipitation studies.. In short, two proteins, bait and prey protein, are fused to GFP and RFP, respectively. A BHK cell line is transformed with ChromoTeks F2H platform reagent and two DNA plasmids coding for the GFP-bait protein and the RFP-prey protein. The interaction of bait protein and prey protein can be detected by co-localization of a green and a red fluorescent spot in the nucleus of the BHK cells with an epi-fluorescence microscope.. PRODUCTS ...
OUTLINE: Using molecular laboratory techniques, this study examines the biochemical mechanisms by which LZAP activates transcriptional, tumor suppressive activity (both p53-dependent and p53-independent) of ARF and inhibits transcriptional, tumorigenic activity of NF-kB. LZAP regulation of newly identified ARF activities, such as S-phase delay and ARF-mediated B23 degradation are also evaluated. LZAPs tumor suppressive activity is assessed in vivo using a conditional knockout vector to target LZAP in mice and to observe for spontaneous and induced tumor formation. Laboratory analyses used to determine study endpoints include standard recombinant DNA, recombinant protein expression and purification, cell culture and transfection, cell labeling, reporter assays, flow cytometry, yeast-two hybrid, immunoprecipitation, immunoblotting, immunofluorescence, TUNEL assay, ELISA assay, Southern blotting, and protein and gene expression. ...
I have a protein-protein interaction that I have originally detected in bacterial two-hybrid system and pull-down experiments with bacterially expressed proteins also show positive interaction. Now I would like to confirm this interaction also in eukaryotic cells by coimmunoprecipitating the two. Since I do not have antibodies for these proteins, I am using GFP -(Bait) and HA-tagged (target) proteins and thus transfected cells. I have performed the experiment couple of times, and it kind of looks promising: I have positive interaction when the two proteins are present and all negative controls are negative. What makes me doubt is that I do not concentrate the target protein in the immunoprecipitation, that is that my band is weaker in the immunoprecipitation sample than in the original cell lysate sample. In order to have positive interaction do I have to be able to concentrate the target protein? So, what do you think, are these two proteins interacting ...
This new class of molecules opens the door for transforming new drug formats.. Molecular Partners has established a robust platform to discover and develop DARPin-based product candidates targeting indications in ophthalmology, oncology and immunology. The most advanced DARPin product candidate, called abicipar pegol, is out-licensed to Allergan and is expected to enter Phase III clinical studies for the treatment of wet age-related macular degeneration in the second quarter of 2015 and is currently in Phase II clinical development for the treatment of diabetic macular edema. The other DARPin product candidates in the pipeline are currently being developed by Molecular Partners either on its own or together with renowned pharmaceutical companies through strategic partnerships.. Molecular Partners has the exclusive license to develop DARPin-based product candidates. The vision of Molecular Partners is to pioneer the development of DARPins to create multi-benefit therapeutics transforming the ...
RNA-protein interactions are pivotal in fundamental cellular processes such as translation, mRNA processing, early development, and infection by RNA viruses. However, in spite of the central importance of these interactions, few approaches are available to analyze them rapidly in vivo. We describe a yeast genetic method to detect and analyze RNA-protein interactions in which the binding of a bifunctional RNA to each of two hybrid proteins activates transcription of a reporter gene in vivo. We demonstrate that this three-hybrid system enables the rapid, phenotypic detection of specific RNA-protein interactions. As examples, we use the binding of the iron regulatory protein 1 (IRP1) to the iron response element (IRE), and of HIV trans-activator protein (Tat) to the HIV trans-activation response element (TAR) RNA sequence. The three-hybrid assay we describe relies only on the physical properties of the RNA and protein, and not on their natural biological activities; as a result, it may have broad ...
The S. cerevisiae membrane protein Jen1 is a monocarboxylate-proton symporter which after the addition of glucose to lactic acid-grown cells triggers loss of Jen1p activity and repression of JEN1 gene expression (Paiva et al., 2002; Andrade et al., 2001). This downregulation of the permease is dependent on phosphorylation and ubiquitylation mechanisms, both of which are dependent on proteins interacting with the Jen1p. To identify the proteins involved in this process we developed a system combined structure prediction and the yeast two-hybrid system to overcome the difficulties associated to measuring protein interactions with membrane proteins. Measuring protein interactions between membrane proteins or between membrane proteins and other proteins has proved to be very difficult. The commonly used yeast two-hybrid systems are inefficient for membrane proteins since the interaction must take place in the cell nucleus between soluble proteins. An advantage of the strategy used in our approach is ...
HIV-1 tat, a strong transactivator, is essential for the HIV-1 replication and AIDS progression. The Tat function is markedly inhibited by human anti-oncogene p53. This work was initiated to identify the p53-associated inhibitory mechanism on tat-mediated transactivation. Inhibitory function of P53 was confirmed by co-transfection of tat-expressing Jurkat cells with LTR-CAT plasmid, or H3Tl cells (LTR-CAT integrated HeLa cells) with different ratio of pSV-tat/pCDNA-p53 plasmids. Results from the direct protein-protein .interaction between soluble p53 and tat, and yeast two-hybrid experiments showed that the co-suppression mechanism is unlikely to be due to the direct interaction. CAT activity was not affected by tat in Jurkat cells which were transfected with p53-promoter-CAT or p53-enhancer-CAT, suggesting that the tat-mediated p53 suppression is not directly associated with p53-promoter. Finally, we have tested protein kinase activity in p53-tranfected Jurkat cells, which might phosphorylate ...
Epidermal growth factor-like domain 7 (EGFL7) is a secreted protein that has been implicated in cell migration and blood vessel formation. The receptor that EGFL7 binds is unknown. The Notch pathway is involved in both angiogenesis and neural development. Notch is a transmembrane receptor that is cleaved to release the transcriptional regulator NICD (the Notch intracellular domain) in response to ligands, such as Jagged. Schmidt et al. showed by yeast two-hybrid experiments and coimmunoprecipitation and binding assays that EGFL7 and the extracellular domain of Notch interacted and that the interaction could be mediated by either the Emilin-like domain (EMI) or the EGF-like domains of EGFL7 and required the EGF-like repeats on Notch. When Jagged and Notch were coexpressed with increasing amounts of EGFL7, the interaction between Jagged and Notch was disrupted. EGFL7 decreased Notch signaling in response to Jagged. In a more physiological setting, the effect of EGFL7 on cultured murine neural stem ...
Read reviews and compare manufacturers of Cell Based Assays / In vitro > Yeast Two-Hybrid Systems products in the SelectScience products and suppliers directory
In several cases, the homologous WDR proteins are highly conserved throughout the length of the proteins, and appear to operate in highly analogous mechanisms, with specificity in function conferred by changes in upstream signaling pathways and/or downstream effectors. One case is AGB1, the only clear Arabidopsis ortholog of Gβ [31] (Fig. 1). Loss of AGB1 function leads to developmental pleiotropy including shortened fruits [32] and changes in patterns of cell division in the hypocotyl and root [33]. These phenotypes are associated with the derepression of genes that are normally turned on by auxin, suggesting a role for AGB1 as a negative regulator of auxin signaling [33]. There appears to be one Gα-like protein (GPA1) and two Gγ-like proteins (AGG1 and AGG2) in the Arabidopsis proteome [31], and molecular modeling and yeast two-hybrid studies of potential interactions among AGB1, GPA1 and AGG1 are not inconsistent with the possibility that these could form a heterotrimeric protein [33, 34]. ...
To decipher the mechanism affecting this response, the authors examined Pi signaling-related transcription factors, finding that mutants affecting PHOSPHATE STARVATION RESPONSE2 (PHR2) did not alter the response of leaf angle to Pi, but mutants affecting the SPX (Syg1/Pho81/XPR1) domain proteins SPX1 and SPX2 did. The spx1 and spx2 mutants had a wider leaf angle and longer lamina joint cells than wild-type rice, and the overexpressors had smaller cells, narrower leaf angles, and thus more-erect leaves. SPX proteins generally interact with and inhibit transcription factors. Therefore, the authors next used yeast two-hybrid assays to identify proteins interacting with SPX1. They found the transcription factor REGULATOR OF LEAF INCLINATION1 (RLI1), which shows some similarity to PHR family genes, but lacks the coiled-coil domains. They confirmed the SPX1-RLI1 interaction by coimmunoprecipitation and bimolecular fluorescence complementation.. Mutant and overexpression studies supported the ...
BioAssay record AID 747467 submitted by ChEMBL: Agonist activity at human estrogen receptor-beta by yeast two-hybrid assay in presence of SRC1.
Purpose: : To search for proteins that bind to the Usher syndrome type 3 protein Clarin-1. Methods: : Yeast two-hybrid screening (Fields method) was performed using three baits representing the two predicted extra-cellular loops and the intracellular C-terminal region of the mouse Clarin-1 protein. The expression of recombinant GAL4-baits was confirmed by Western blot analysis. Suitability of the baits for screening was additionally confirmed by transactivation activity tests. Each of the baits was used to screen approximately 1.5 million mouse brain cDNAs for interaction. Isolated positive clones were identified by DNA sequencing and database searching. Potential interaction partners of Clarin-1 were subjected to the mating assay. Results: : Screening the mouse cDNA library with three GAL4-Clarin-1 baits identified 125 positive clones that potentially bind to Clarin-1. 110 of the clones were sequenced, of which 41 were in the correct reading frame with GAL4. Most of those 41 clones were ...
Fingerprint Dive into the research topics of Protocols for screening for binding partners of CCN proteins: Yeast two-hybrid system. Together they form a unique fingerprint. ...
Lehner B، Semple JI، Brown SE، وآخرون. (2004). Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region. Genomics. 83 (1): 153-67. PMID 14667819. doi:10.1016/S0888-7543(03)00235-0. ...
TY - JOUR. T1 - RhoB induces apoptosis via direct interaction with TNFAIP1 in HeLa cells. AU - Kim, Dong Myung. AU - Chung, Kyung Sook. AU - Choi, Shin Jung. AU - Jung, Yu Jin. AU - Park, Song Kyu. AU - Han, Gyoon Hee. AU - Ha, Jae Seok. AU - Song, Kyung Bin. AU - Choi, Nam Song. AU - Kim, Hwan Mook. AU - Won, Misun. AU - Seo, Yeon Soo. PY - 2009/12/1. Y1 - 2009/12/1. N2 - RhoB, a tumor suppressor, has emerged as an interesting cancer target, and extensive studies aimed at understanding its role in apoptosis have been performed. In our study, we investigated the involvement of RhoB-interacting molecules in apoptosis. To identify RhoB-interacting proteins, we performed yeast-two hybrid screening assays using RhoB as a bait and isolated TNFAIP1, a TNFα-induced protein containing the BTB/POZ domain. The interaction between RhoB and TNFAIP1 was demonstrated in vivo through coimmunoprecipitation studies and in vitro binding assays. RFP-TNFAIP1 was found to be partially colocalized with EGFP-RhoB. ...
A split-EGFP bimolecular fluorescence complementation assay was used to visualise and locate three interacting pairs of proteins from the GAL genetic switch of the budding yeast, Saccharomyces cerevisiae. Both the Gal4p-Gal80p and Gal80p-Gal3p pairs were found to be located in the nucleus under indu …
Yeast two-hybrid analysis. The two-hybrid assay was performed as described previously (Kim et al., 1995). The last 7 aa residues (amino acids 1144-1150; AGRETTV) of KIF1Bα in pBHA bait vector were used in the screen. For the yeast two-hybrid assay against various PDZ domains, wild-type and mutant (the last amino acid V to A) KIF1Bα (amino acids 1083-1150) in pBHA were used. The PDZ domains in pGAD10 are as follows: PDZ1 (amino acids 203-327), PDZ2 (304-425), and PDZ3 (454-553) of SAP97; PDZ0 (16-103), PDZ1 (424-505), PDZ2 (607-683), PDZ3 (777-863), PDZ4 (919-1023), and PDZ5 (1139-1224) of S-SCAM; Shank1 PDZ (585-691); PDZ1-2 (51-245) and PDZ2-3 (148-339) of glutamate receptor-interacting protein-2 (GRIP2) and PDZ1 (13-106) and PDZ2 (142-249) of Na+/H+exchanger regulatory factor-1 (NHERF1). The pGAD10 constructs containing the PDZ domains of PSD-95 have been described previously (Kim et al., 1995).. Antibodies. Anti-peptide KIF1Bα antibodies were raised against the following synthetic ...
The pFN11A (BIND) Flexi® Vector is a component of the CheckMate™/Flexi® Vector Mammalian Two-Hybrid System. This ampicillin-resistant vector is designed to express a fusion protein comprised of a DNA-binding domain of the yeast GAL4 gene, a linker segment and an in-frame protein-coding sequence, under the control of the human cytomegalovirus (CMV) immediate early promoter. The pFN11A (BIND) Flexi® Vector encodes a |em>Renilla|/em> luciferase gene which may be used to normalize for transfection differences between samples within an experiment.
Figure 6. ERF17 regulates Chl degradation-related genes. A, Yeast one-hybrid assay showing the activity of LacZ reporters driven by the PPH and NYC promoters and activated by activation domain (AD) fusion with ERF17-8S and ERF17-3S (blue color). The empty vectors pB42AD and pLacZi were used as negative controls (white color). BD, Binding domain. B, Gel-shift analysis of ERF17-8S and ERF17-3S binding to the promoters of PPH and NYC. EMSAs of a GST-labeled probe with ERF17-8S and ERF17-3S proteins are shown. DNA probes represent the promoters of PPH and NYC (probe sequences are shown in Supplemental Table S3). Protein/DNA complexes are indicated by arrows. C, SPR binding profiles of ERF17-8S and ERF17-3S proteins to the promoters of PPH and NYC. Protein concentrations were 275 nm in all lines but the bottom line, for which it was 17.2 nm. RU, Response units. ...
Shop FERM and PDZ domain-containing protein ELISA Kit, Recombinant Protein and FERM and PDZ domain-containing protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
We create rare bioactive fatty acids from sustainable sources. A new source of fatty acids though engineered yeast cells and a fermentation bioprocess.
The low-density lipoprotein receptor related protein 1 (LRP1) has been implicated in Alzheimers disease (AD) but its signalling has not been fully evaluated. There is good evidence that the cytoplasmic domain of LRP1 is involved in protein-protein interactions, important in the cell biology of LRP1. We carried out three yeast two-hybrid screens to identify proteins that interact with the cytoplasmic domain of LRP1. The screens included both conventional screens as well as a novel, split-ubiquitin-based screen in which an LRP1 construct was expressed and screened as a transmembrane protein. The split-ubiquitin screen was validated in a screen using full-length amyloid protein precursor (APP), which successfully identified FE65 and FE65L2, as well as novel interactors (Rab3a, Napg, and ubiquitin b). Using both a conventional screen as well as the split-ubiquitin screen, we identified NYGGF4 as a novel LRP1 interactor. The interaction between LRP1 and NYGGF4 was validated using two-hybrid assays,
ZURICH-SCHLIEREN, SWITZERLAND / ACCESSWIRE / March 15, 2019 / Molecular Partners AG (SWX: MOLN), a clinical-stage biotech company pioneering the use of DARPin®
All of the non-structural proteins of poliovirus, including their processing precursors, are involved in the replication of the viral RNA genome. These proteins assemble into a replication complex, which also contains the viral RNA and cellular factors. An understanding of how these viral proteins interact with each other would enhance our understanding of the molecular events occurring during poliovirus infection of the cell. Previously, we have employed the yeast two-hybrid system to construct two separate linkage maps for the polioviral P2 and P3 proteins, respectively. In the present study, we have searched for interacting pairs between the P2 and P3 proteins in a similar inducible yeast two-hybrid system. Although, the primary functions of the proteolytic products of the P2 and P3 domains of the polyprotein in the viral life cycle are different, we observed significant interactions between 2CATPase and 3AB; 2Apro and 3A, 3Cpro or 3Dpol; 2B and 3A or 3AB. All of the interactions were measured in the
In this report, we provide several lines of evidence that p130Cas is a downstream mediator of FAK-promoted cell migration. First, a mutation of P712/715A in FAK abolished its ability to promote CHO cell migration (Fig. 3). The proline-rich region on FAK spanning amino acids 712-718 has been mapped as the primary binding site for p130Cas through its SH3 domain (Polte and Hanks, 1995; Harte et al., 1996), although a second proline-rich region (amino acids 875-884) can also mediate FAK binding to p130Cas (Harte et al., 1996; Polte and Hanks, 1997). In vivo coimmunoprecipitation experiments showed that FAK/ p130Cas association was reduced but not abolished by the P712/715A mutation (Fig. 6), indicating that the second proline-rich region on FAK may mediate some binding to p130Cas, as demonstrated previously (Harte et al., 1996; Polte and Hanks, 1997). However, binding of p130Cas to an alternative site clearly does not allow for FAK-promoted migration. It has also been suggested that p130Cas may ...
Yeast Two Hybrid system uses a reporter gene to detect the interaction of pair of proteins inside the yeast cell nucleus. In the yeast Two Hybrid System, The interaction of target protein to the protein will bring together transcriptional activator, which then switches on the expression of reporter gene.
I assume you mean all the interactions occur outside the cell? One of the advantages of standard yeast two hybrid systems is that they level the playing field with respect to protein localization. This can lead to false positives (extra-cellular/ intra-cellular etc.) but should not be a problem for you. The problem of course is if the interaction you are looking for is dependent on a post-translational modification not applied to intracellular proteins (glycosylation etc...). If your matrix protein contains a transmembrane domain I would suggest removing it as well. There are other membrane based two hybrid systems out there which mount the bait protein onto the intracellular leaf of the cell membrane. These systems work by triggering a signal transduction cascade when the bait/ prey interact. Of course they are also internal so are bound by the same limitations as the standard transcription factor methods. Cheers Martin , Helo, I hope some people here in this forum familar with yeast , ...
This article discusses the pull-down technique, which is an invaluable tool for scientists interested in studying cellular pathways via protein-protein interactions.
Profacgen provides One-Stop-Service on Membrane-based Yeast Two-Hybrid Screening service. Our service can be tailored according to your specialized requirements.
At Euromedex we constantly collaborate with french leading researchers to bring new life science products to the scientific community. Therefore we can propose worldwide. -Bacth kit ref EUK001 developed by Mr Ladant (Institut Pasteur). Euromedex bacterial two-hybrid (BACTH, for Bacterial Adenylate Cyclase-based Two-Hybrid) system is a simple and fast approach to detect and characterize protein-protein interactions in vivo.. -Monoclonals Antibodies for studies of genetic diseases and Transcription Factors (developed by IGBMC - Strasbourg).. EUROMEDEX is continuously looking for high quality products to expand its product portfolio. Please contact us when you are searching for partners to sell you products to the bioscience research community. ...
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
Unlike for other retroviruses, only a few host cell factors that aid the replication of foamy viruses (FVs) via interaction with viral structural components are known. Using a yeast-two-hybrid (Y2H) screen with prototype FV (PFV) Gag protein as bait we identified human polo-like kinase 2 (hPLK2), a member of cell cycle regulatory kinases, as a new interactor of PFV capsids. Further Y2H studies confirmed interaction of PFV Gag with several PLKs of both human and rat origin. A consensus Ser-Thr/Ser-Pro (S-T/S-P) motif in Gag, which is conserved among primate FVs and phosphorylated in PFV virions, was essential for recognition by PLKs. In the case of rat PLK2, functional kinase and polo-box domains were required for interaction with PFV Gag. Fluorescently-tagged PFV Gag, through its chromatin tethering function, selectively relocalized ectopically expressed eGFP-tagged PLK proteins to mitotic chromosomes in a Gag STP motif-dependent manner, confirming a specific and dominant nature of the Gag-PLK ...
SAP47 ist ein Synapsenassoziiertes Protein von 47 kDa aus Drosophila melanogaster, das zu einer neuen Proteinfamilie gehört. Um eine Sap47 Mutante zu erzeugen wurden drei Methoden eingesetzt: Gezielte Mutagenese durch homologe Rekombination, RNA interference (RNAi) und Transposon Remobilisierung. Um einen Interaktionspartner für das SAP47 Protein zu identifizieren wurden ein Yeast-Two-Hybrid System und das CytoTrap Verfahren eingesetzt ...
Warmth shock transcription factors (HSFs) are mainly involved in the activation of genes in response to heat stress as well as other abiotic and biotic stresses. localized in the nucleus, indicating their related subcellular distributions as transcription factors. Our candida one-hybrid assay suggested that FaTHSFA2a offers trans-activation activity, whereas FaTHSFB1a expresses trans-repression 218916-52-0 supplier function. …Read More. ...
The December issues of Cold Spring Harbor Protocols features four protocols on how to prepare reagents for yeast one-hybrid analysis. An important question when studying gene regulation is which transcription factors (TFs) interact with which cis-regulatory elements, such as promoters … Continue reading →. ...
Pbp1p Binding Protein; Interacts Strongly With Pab1p-binding Protein 1 (Pbp1p) In The Yeast Two-hybrid System; Also Interacts With Lsm12p In A Copurification Assay; Relative Distribution To The Nucleus Increases Upon DNA Replication Stress
Research topic: Characterization of genes in the human deaf population and corresponding mouse models; the regulation by microRNAs in the auditory and vestibular systems and their targets; networks of genes and proteins in the auditory system using transcriptomics and proteomics; the correlation between anxiety and balance defects in mouse models.. Research methods: Deep sequencing/massively parallel sequencing, gene cloning, quantitative RT-PCR, immunofluorescence, yeast two-hybrid assays, cell culture, scanning electron microscopy, mass spectrometry, in situ hybridization, bioinformatics.. Main projects in the lab include:. ...
To dissect how NSM00158 functions, we evaluated its effects on the interactions of CtBP2-p300, CtBP2-E1A, p300-c-MYC and p300-c-JUN in yeast cells. The CtBP2-p300 interaction, and the interactions of CtBP2-E1A, p300-c-MYC and p300-c-JUN were previously reported in other publications (Faiola et al., 2005; Lee et al., 1996; Zhao et al., 2008). Accordingly, we cotransformed different combinations of plasmids, including pGADT7-CtBP2 + pGBKT7-p300, pGADT7-CtBP2 + pGBKT7-E1A-Flag, pGADT7-c-MYC + pGBKT7-p300, and pGADT7-c-JUN + pGBKT7-p300, into AH109 yeast cells. After determining the protein levels in positive colonies (Supplementary Fig. S3A), we examined and verified protein interactions in the SC-HTL medium (Supplementary Fig. S3B, top panel). We next evaluated the effects of NSM00158 on these interactions. As shown in Supplementary Fig. S3B (bottom panel), supplementation with 4 μM NSM00158 inhibited the growth of the cells coexpressing pGADT7-CtBP2 + pGBKT7-p300 or pGADT7-CtBP2 + ...
This gene encodes a protein that contains a PDZ (post synaptic density protein (PSD95), Drosophila disc large tumor suppressor (Dlg1), and zonula occludens-1 protein (zo-1) domain at the N-terminus followed by a FERM domain. The encoded protein is involved in signal transduction. The PDZ domain is thought to function in protein-protein interactions, mainly by binding to specific C-terminal peptides of other proteins. The FERM domain is found in proteins that are localized to the plasma membrane and are associated with the cytoskeleton. [provided by RefSeq, May 2017 ...
MGCNMCVVQKPEEQYKVMLQVNGKELSKLSQEQTLQALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVDS 1 - 70 GTQTDITFEHIMALGKLRPPTPPMVILEPPPISHEYYDPAEFMEGGPQEADRLDELEYEEVELYKSSHRD 71 - 140 KLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGVDVQNREEAVAILSQEENTNISLL 141 - 210 VARPESQLAKRWKDSDRDDFLDDFGSENEGELRARKLKSPPAQQPGNEEEKGAPDAGPGLSNSQELDSGV 211 - 280 GRTDESTRNEESSEHDLLGDEPPSSTNTPGSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGGDVPGLT 281 - 350 DEEYERYRELLEIKCHLENGNQLGLLFPRASGGNSALDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQ 351 - 420 KMQQLRERCMKAWLLEEESLYDLAASEPKKHELSDISELPEKSDKDSTSAYNTGESCRSTPLLVEPLPES 421 - 490 PLRRAMAGNSNLNRTPPGPAVATPAKAAPPPGSPAKFRSLSRDPEAGRRQHAEERGRRNPKTGLTLERVG 491 - 560 PESSPYLSRRHRGQGQEGEHYHSCVQLAPTRGLEELGHGPLSLAGGPRVGGVAAAATEAPRMEWKVKVRS 561 - 630 DGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQHLIRAREQRKRREFMMQ 631 - 700 SRLECLREQQNGDSKPELNIIALSHRKTMKKRNKKILDNWITIQEMLAHGARSADGKRVYNPLLSVTTV 701 - 769 ...
CiteSeerX - Scientific documents that cite the following paper: Sastry: An Algebraic Geometric Approach to the Identification of a Class of Linear Hybrid Systems,
It doesnt matter. McCain doesnt have a chance. Osamas too good. The debates will be one-sided. He has a better chance against Hillary. I can get into the explanation that the gods only use their power to hurt the disfavored, but youve already heard it. Consistant with this, expect gas to climb to $4 if not $5 this summer, ensuring the election is delivered to the wrong candidate::::Theyve used the price of gas to punish the people for electing the wrong person. In addition, public response to recent poor economic reports ensures conservative behavior, another factor which is intentionally damaging to McCains chances ...
Steve A. Kay is the author of this article in the Journal of Visualized Experiments: A Modified Yeast-one Hybrid System for Heteromeric Protein Complex-DNA Interaction Studies
Hi,I am running a bending active hybrid system optimization where i have 9 values as a genome input that control various heights. Fitness value is obtained af…
References for Abcams Recombinant Human PIST protein (ab93743). Please let us know if you have used this product in your publication
However, some systems adapt to the given channel error conditions: some instances of hybrid automatic repeat-request use a ... Use of interleaving techniques increases total delay. This is because the entire interleaved block must be received before the ... Bell System Tech. J. USA: AT&T. 29 (2): 147-160. doi:10.1002/j.1538-7305.1950.tb00463.x. Retrieved 4 December 2012.. ... Most telecommunication systems use a fixed channel code designed to tolerate the expected worst-case bit error rate, and then ...
The technique eventually became a staple of composing and arranging in salsa and Latin jazz. According to Kevin Moore: Clave ... Cuban folkloric musicians do not use the 3-2/2-3 system. Many Cuban performers of popular music do not use it either. The great ... During the nineteenth century, African music and European music sensibilities were blended in original Cuban hybrids. Cuban ... the clave matrix is a comprehensive system for organizing music-Toussaint (2013).[25] ...
Time-of-flight (TOF) PET: For modern systems with a higher time resolution (roughly 3 nanoseconds) a technique called "Time-of- ... "Magnetic Resonance-Based Attenuation Correction for PET/MR Hybrid Imaging Using Continuous Valued Attenuation Maps". ... Positron-emission tomography (PET)[1] is a nuclear medicine functional imaging technique that is used to observe metabolic ... The system detects pairs of gamma rays emitted indirectly by a positron-emitting radioligand, most commonly fluorine-18, which ...
1983). A History of Engineering and Science in the Bell System, Physical Science (1925-1980). AT&T Bell Laboratories. p. 102.. ... Other packaging techniques for discrete transistors as chips include Direct Chip Attach (DCA) and Chip On Board (COB).[96] ... Unpackaged transistor chips (die) may be assembled into hybrid devices.[96] The IBM SLT module of the 1960s is one example of ... The Bell Systems Memorial on Transistors. *IEEE Global History Network, The Transistor and Portable Electronics. All about the ...
C. acnes' ability to bind and activate a class of immune system receptors known as toll-like receptors (TLRs), especially TLR2 ... The Leeds acne grading technique counts acne lesions on the face, back, and chest and categorizes them as inflammatory or non- ... "Oral Spironolactone for Acne Vulgaris in Adult Females: A Hybrid Systematic Review". American Journal of Clinical Dermatology ... "The Leeds Revised Acne Grading System" (PDF). The Leeds Teaching Hospitals. Archived from the original (PDF) on 25 November ...
... such as the immune system and the many techniques pathogens have developed to evade it. For example, the parasite Trypanosoma ... This tremendous complexity allows the parasite to constantly change its surface and thus evade the immune system through ...
Narrative technique[edit]. The show's pilot episode is told almost entirely in retroversions to three different time frames. ... Sean and Vicky are able to prevent the sleepers from releasing the virus into the air circulation system of a mall. However, ... As Sophia's people are completely immune, a hybrid - Leila - will be used to incubate a mutated strain. Meanwhile, Lee seeks ... The doctor concludes that although her sleeper-half is immune, her human immune system is constantly fighting and may take days ...
In intercropping systems - a practice commonly used in lentil cultivation - herbicides may be needed to assure crop health.[11] ... However, plant growth regulators and/or embryo rescue allows the growth of viable hybrids between groups. Even if crosses are ... other biotechnology techniques which may impact on lentil breeding are micro-propagation using meristamatic explants, callus ...
The Crank-Connecting Rod System in a Continuously Rotating Machine, History of Science and Technology in Islam. ... G. R. Tibbetts (1973), "Comparisons between Arab and Chinese Navigational Techniques", Bulletin of the School of Oriental and ... Dia menjelaskan suatu hybrid trebuchet yang dia berkata mempunyai tenaga hurling sama seperti sebuah mesin seretan (traction) ... Badr, Gamal Moursi (Spring, 1978), "Islamic Law: Its Relation to Other Legal Systems", The American Journal of Comparative Law ...
Each individual will have similar immune systems, as immune systems are genetically based. When a species becomes endangered, ... In plant breeding, inbred lines are used as stocks for the creation of hybrid lines to make use of the effects of heterosis. ... Inbreeding is a technique used in selective breeding. For example, in livestock breeding, breeders may use inbreeding when ... Thus, similar immune systems may be more vulnerable to infectious diseases (see Major histocompatibility complex and sexual ...
These techniques rely on metal halide and boron halide precursors (such as TiCl4 and BCl3) in the gaseous phase and use H2 as a ... Sinclair, John (1974). "Compatibility of Refractory Materials for Nuclear Reactor Poison Control Systems". NASA Tm X-2963.. ... 2006). "New Route to Synthesize Ultra‐Fine Zirconium Diboride Powders Using Inorganic-Organic Hybrid Precursors". Journal of ... Production of a hafnium diboride set of fins via robocasting, a 3D Printing technique. 0.41mm nozzle, 4x speed. ...
Hybrid Fusion-FISH[edit]. Hybrid Fusion FISH (HF-FISH) uses primary additive excitation/emission combination of fluorophores to ... FISH is a very general technique. The differences between the various FISH techniques are usually due to variations in the ... the fragments were added into a system of continually replicating bacteria populations. Clonal populations of bacteria, each ... This technique is used routinely in telomere length research. Flow-FISH[edit]. Flow-FISH uses flow cytometry to perform FISH ...
"Implementing a Novel Approach an Convert Audio Compression to Text Coding via Hybrid Technique" (PDF). International Journal of ... IEEE Transactions on Circuits and Systems for Video Technology. IEEE. 22 (12). Retrieved 2017-08-12.. ... If the frame contains areas where nothing has moved, the system can simply issue a short command that copies that part of the ... There is a close connection between machine learning and compression: a system that predicts the posterior probabilities of a ...
The "creativity" of this hybrid swarm system has been analysed under the philosophical light of the "rhizome" in the context of ... Swarm Intelligence-based techniques can be used in a number of applications. The U.S. military is investigating swarm ... Examples in natural systems of SI include ant colonies, bird flocking, animal herding, bacterial growth, fish schooling and ... SI systems consist typically of a population of simple agents or boids interacting locally with one another and with their ...
... its imperial examination system and mandarin bureaucracy.[43] However, implementation of a foreign administrative system and ... "Employing the techniques Hitler used to inflame hatred against the Jews" as reported by the U.S. News and World Report's Ray ... Minh Hương were ethnically hybrid Chinese and Vietnamese descended from Chinese men and Vietnamese women. They lived in rural ... Wicks, Robert S. (1992). Money, markets, and trade in early Southeast Asia: the development of indigenous monetary systems to ...
Combined laboratory systems for measuring Brix and CO2 in soft drinks and Plato, CO2, % alcohol, pH, and color in beer are ... Due to higher accuracy and the ability to couple it with other measuring techniques (%CO2 and %alcohol), most soft drink ... which is the oldest of the three systems and therefore mostly found in older textbooks, but also still in use in some parts of ... techniques. In the former case, in-line instruments are available which allow constant monitoring of sugar content in sugar ...
... and RAD51 proteins in a yeast two-hybrid system". Genomics. 37 (2): 183-6. doi:10.1006/geno.1996.0540. PMID 8921390.. ... Daniel DC (Oct 2002). "Highlight: BRCA1 and BRCA2 proteins in breast cancer". Microscopy Research and Technique. 59 (1): 68-83 ...
However, later genetic work showed that it is a hybrid between Chinese small leaf tea and assam type tea.[63] Darjeeling tea ... 1996). The World's Writing Systems. Oxford University Press. p. 203. ISBN 978-0-19-507993-7.. ... Through the centuries, a variety of techniques for processing tea, and a number of different forms of tea, were developed. ... Using the Chinese planting and cultivation techniques, the British launched a tea industry by offering land in Assam to any ...
a b c d Petty, M. D., Windyga, P. S. (1999). A High Level Architecture-based Medical Simulation System. SIMULATION, 73, 281-287 ... a b c Kincaid, J.P., Donovan, J., & Pettitt, B. (2003). Simulation Techniques for Training Emergency Response. International ... Examples of Hybrid Simulation ModelsEdit. *Standized Patients and Full-scale Manniquins ... To Err Is Human: Building a Safer Health System. Institute of Medicine (IOM). 2000.. ...
... communications while in heliocentric orbit and show low-thrust trajectory control techniques by employing a hybrid ion thruster ... "Solar System Exploration Research Virtual Institute. NASA. 2015. Retrieved 23 May 2015.. This article incorporates text from ... For Artemis 1, the Orion spacecraft will be outfitted with a complete life support system and crew seats, but will be left ... Artemis 1 will use the Block 1 variant of the Space Launch System. The Block 1 will use 5-segment solid rocket boosters ...
... by nullifying the magnetic field which normally triggers the mines fusing system. A similar demagnetizing system was carried on ... Eventually though, torpedo-bombing was dispensed with, because only one Seiran pilot had mastered the technique.[27] ... The Hybrid Warship. London:Conway Maritime Press, 1991. ISBN 0-85177-555-1. ... A special trim system was fitted to the boats, allowing them to loiter submerged and stationary while awaiting the return of ...
Components within a diesel fuel system interact with the fuel in a way to ensure efficient operation of the fuel system and so ... "Mustard Hybrids for Low-Cost Biodiesel and Organic Pesticides" (PDF). Archived from the original (PDF) on 2011-07-26. Retrieved ... Further, it was reported that "the technique is not difficult" and that "there is so much coffee around that several hundred ... The traditional inline injection system is more forgiving to poorer quality fuels as opposed to the common rail fuel system. ...
As a hybrid technique, GISAS combines concepts from transmission small-angle scattering (SAS), from grazing-incidence ... Systems studied by GISAS include quantum dot arrays,[1] growth instabilities formed during in-situ growth,[2] self-organized ... The technique was further developed by Naudon[9] and coworkers to study metal agglomerates on surfaces and in buried interfaces ... This was soon to be followed by soft matter systems such as ultrathin polymer films,[11] polymer blends, block copolymer films ...
Yoshimitsu then mastered a technique for killing with a single blow. Through such great efforts, he mastered the essence of ... dissected corpses brought back from wars in order to explore human anatomy and mastered a decisive counter-technique as well as ... Eclectic / hybrids. *American Kenpo. *Chun Kuk Do. *Jeet Kune Do. *Shooto. *Shorinji Kempo ... Alternative medical systems. *Mind-body intervention. *Biologically-based therapy. *Manipulative methods. *Energy therapy ...
... in the DOS file system and inodes in many UNIX file systems, as well as other operating system data structures (also known as ... "MJM Data Recovery Ltd: Hard Disk Bad Sector Mapping Techniques". Datarecovery.mjm.co.uk. Archived from the original on February ... Some systems may use hidden partitions for system recovery, reducing the capacity available to the end user. ... Small Computer System Interface (SCSI), originally named SASI for Shugart Associates System Interface, was standard on servers ...
... have similar hybrid AF systems, Canon is the only manufacturer that offers such technology in DSLRs. ... Phase-detection autofocus is typically faster than other passive techniques. As the phase sensor requires the same light going ... Dust reduction systems[edit]. Main article: Dust reduction system. A method to prevent dust entering the chamber, by using a " ... Cameras for this system have the same sensor size as the Four Thirds System but do not have the mirror and pentaprism, so as to ...
James Dwight Dana, a leading geologist of his time, first published his System of Mineralogy in 1837; as of 1997, it is in its ... In diamond, the carbons are in sp3 hybrid orbitals, which means they form a framework where each carbon is covalently bonded to ... is observable with various techniques, such as thin-section petrography.[87] ... The hexagonal crystal family is also split into two crystal systems - the trigonal, which has a three-fold axis of symmetry, ...
The dip coating technique is used for making thin films by self-assembly and with the sol-gel technique. Self-assembly can give ... This gel is a bi-phasic system containing both a liquid phase (solvent) and a solid phase (integrated network, typically ... Dip coating have been utilized for example in the fabrication of bioceramic nanoparticles, biosensors, implants and hybrid ... Sol-gel technique[edit]. Dip coating of inorganic sols (or so-called sol-gel synthesis) is a way of creating thin inorganic or ...
What is solar system for home and how much will the cost of on grid solar and off grid solar system? ... One upconversion technique is to incorporate lanthanide-doped materials (Er3+. , Yb3+. , Ho3+. or a combination), taking ... In 2016, a new approach was described for producing hybrid photovoltaic wafers combining the high efficiency of III-V multi- ... Cells, modules, panels and systems[edit]. Main article: Photovoltaic system. Multiple solar cells in an integrated group, all ...
... and installation technique. Longer cables can be coiled at an intermediate point and pulled farther into the duct system as ... Coherent receivers use a local oscillator laser in combination with a pair of hybrid couplers and four photodetectors per ... Repeaters add substantial cost to a communication system, and so system designers attempt to minimize their use. ... Cisco Systems. Retrieved 2006-12-31.. *^ Charles E. Spurgeon (2014). Ethernet: The Definitive Guide (2nd ed.). O'Reilly Media. ...
Angio System Supports Hybrid Technique http://www.diginfo.tv/v/12-0061-n-en.php DigInfo TV - http://diginfo.tv 13/4/2012 ITME ... Angio System Supports Hybrid Technique. http://www.diginfo.tv/v/12-0061-n-en.php. DigInfo TV - http://diginfo.tv. 13/4/2012 ... The Pediatric Hybrid Cath Lab , Insights and Innovations (NBC) - Duration: 0:31. Montefiore Health System 1,763 views ... Maquet Hybrid OR solutions - from concept to implementation with Philips - Duration: 3:50. MAQUET GETINGE GROUP - NON-US ...
High impact information on Two-Hybrid System Techniques. *Chemical compound and disease context of Two-Hybrid System Techniques ... High impact information on Two-Hybrid System Techniques. *ZYG-12 is able to bind the dynein subunit DLI-1 in a two-hybrid assay ... Chemical compound and disease context of Two-Hybrid System Techniques. *By using a yeast two-hybrid assay, cyclic AMP-response- ... Analytical, diagnostic and therapeutic context of Two-Hybrid System Techniques. *Yeast two-hybrid assay, in vitro binding, in ...
Two-Hybrid System Techniques * Subject Areas on Research. * A CDC6 protein-binding peptide selected using a bacterial two- ... hybrid-like system is a cell cycle inhibitor. * A Rac homolog functions downstream of Ras1 to control hyphal differentiation ... Identifying Gene Regulatory Networks in Arabidopsis by In Silico Prediction, Yeast-1-Hybrid, and Inducible Gene Profiling ... Identification of putative direct effectors for G alpha o, using yeast two-hybrid method. ...
A Hybrid Modeling Technique for Partially-Known Systems Using Linear Regression and Neural Network Andrew J. Joslin, Andrew J. ... "A Hybrid Modeling Technique for Partially-Known Systems Using Linear Regression and Neural Network." Proceedings of the ASME ... In this paper a hybrid modeling and system identification method, combining linear least squares regression and artificial ... neural network techniques, is presented to model a type of dynamic systems which have an incomplete analytical model ...
... of symbolic and sub-symbolic techniques aimed at the construction of highly robust and reliable problem-solving techniques. ... The Third International Workshop on Hybrid Artificial Intelligence Systems (HAIS 2008) presented the most recent developments ... hybrid intelligent systems for multi-robot and multi-agent systems; applications of hybrid artificial intelligence in ... learning systems, algorithms and applications; hybrid systems based on negotiation and social network modelling; real world ...
Hybrid Technique for Real-Time Simulation of High-Frequency-Switched Electrical Systems. 2016-09-20 ... The cost and complexity of aircraft power systems limit the number of integrated system evaluations that can be performed in ... Movement toward more-electric architectures in military and commercial airborne systems has led to electrical power systems ( ... Regression Techniques for Parameter Estimation of a Synchronous Machine from Sudden Short-Circuit Testing. 2019-03-19 ...
The two LNAI volumes 6678 and 6679 constitute the proceedings of the 6th International Conference on Hybrid Artificial ... Intelligent Systems, HAIS 2011, held in Wroclaw, Poland, in May 2011. The 114 papers published in these proceedings were ... A Simple Proactive Provider Participation Technique in a Mesh-Based Peer-to-Peer Streaming Service ... intelligent systems for data mining and applications; systems, man, and cybernetics; hybrid artificial intelligence systems in ...
Yeast two-hybrid screens are an important method for mapping pairwise physical interactions between proteins. The fraction of ... Two-Hybrid System Techniques* Grant support * R41GM073492/GM/NIGMS NIH HHS/United States ... Where have all the interactions gone? Estimating the coverage of two-hybrid protein interaction maps PLoS Comput Biol. 2007 Nov ... Yeast two-hybrid screens are an important method for mapping pairwise physical interactions between proteins. The fraction of ...
... as well as techniques for developing intelligent systems to solve practical problems. Covering the full spectrum of… ... and their hybrids.. Using clear and concise language, Intelligent Systems for Engineers and Scientists, Third Edition features ... Covering the full spectrum of intelligent systems techniques, it incorporates knowledge-based systems, computational ... The first part of the book describes key techniques of artificial intelligence-including rule-based systems, Bayesian updating ...
Molecular techniques.Plasmid DNA was purified by the method of Lee and Rasheed (34). E. coli strains were transformed by the ... Substrate Specificities of Hybrid Naphthalene and 2,4-Dinitrotoluene Dioxygenase Enzyme Systems. Rebecca E. Parales, Matthew D ... Hybrid dioxygenases containing various β subunits were generated by using a two-plasmid expression system in E. coli. The genes ... Of the six hybrids constructed, three were active. The hybrid enzymes NDO-βTDO and DNTDO-βTDO were not active with any of the ...
Hybrid Learning. * Hybrid Genetic Programming for Optimal Approximation of High Order and Sparse Linear Systems ... and real-world applications of evolutionary computation techniques. ... The topics covered are evolutionary learning; evolutionary optimisation; hybrid learning; adaptive systems; theoretical issues ... Alife Scheduling adaptive systems algorithms ant colonies ant colony optimization ants artificial life artificial neural ...
Two-Hybrid System Techniques * Zonula Occludens-2 Protein * beta-Galactosidase / metabolism Substances * Matrix Attachment ... Our results from two-hybrid assays and in vivo co-immunoprecipitation studies provide evidence to suggest that ZO-2 associates ...
Magnet systems {, e.g. undulators, wigglers (free-electron laser H01S 3/0903)}; Energisation thereof [2016-08] ... PLASMA TECHNIQUE (fusion reactors G21B; ion-beam tubes H01J 27/00; magnetohydrodynamic generators H02K 44/08; producing X-rays ... Circuits or systems for supplying or feeding radio-frequency energy (radio-frequency generators H03B) [2013-01] ... Arrangements for beam delivery or irradiation (irradiation systems per se G21K 5/00)} [2013-01] ...
Establishing the service evaluation and selection system for emerging culture festival events using the hybrid MCDM technique. ... Establishing the service evaluation and selection system for emerging culture festival events using the hybrid MCDM technique. ... Establishing the service evaluation and selection system for emerging culture festival events using the hybrid MCDM technique. ... Establishing the service evaluation and selection system for emerging culture festival events using the hybrid MCDM technique. ...
When both iliac systems are occluded below an abdominal aortic aneurysm: hybrid techniques on the cutting edge. Posted on April ... techniquesTagged aorto-uni-iliac, AUI, AUI-FEM-FEM, EIA endoRE, endoRE, hybrid techniqueLeave a comment Post navigation. ... Typically, the hybrid repair involves sewing in a conduit to deliver the main body of a bifurcated or unibody stent graft when ... The iliac limbs of some stent graft systems will have proximal flares and can be used in a telescoping manner to create an ...
Systems for and methods of hybrid pyrosequencing. US8926065. 21 Sep 2011. 6 Jan 2015. Advanced Liquid Logic, Inc.. Droplet ... Microfluidic system including a virtual wall fluid interface port for interfacing fluids with the microfluidic system. ... Microfluidic system including a virtual wall fluid interface port for interfacing fluids with the microfluidic system. ... Method, system, and program product for controlling chemical reactions in a digital microfluidic system. ...
The two LNAI volumes 6678 and 6679 constitute the proceedings of the 6th International Conference on Hybrid Artificial ... Intelligent Systems, HAIS 2011, held in Wroclaw, Poland, in May 2011. The 114 pap ... Systems, Man, and Cybernetics by SOCO-Workshop. * Supervised Rule Based Thermodynamic Cycles Design Technique ... Hybrid Systems for Context-Based Information Fusion. * RT-MLR: A Hybrid Framework for Context-Aware Systems ...
Two-hybrid System Techniques. Screening techniques first developed in yeast to identify genes encoding interacting proteins. ... Two-hybrid techniques refer to analysis for protein-protein interactions, one-hybrid for DNA-protein interactions, three-hybrid ... Reverse n-hybrid techniques refer to analysis for mutations or other small molecules that dissociate known interactions. ... restorative system with a micro hybrid resin based composite in extended sized class II cavities.... ...
... is to present a novel hybrid GA-GSA algorithm to permit the reliability analyst to increase the performance of the system ... A Hybrid GA-GSA Algorithm for Optimizing the Performance of an Industrial System by Utilizing Uncertain Data: 10.4018/978-1- ... In P. Vasant (Ed.), Handbook of Research on Artificial Intelligence Techniques and Algorithms (pp. 620-654). Hershey, PA: IGI ... "A Hybrid GA-GSA Algorithm for Optimizing the Performance of an Industrial System by Utilizing Uncertain Data." In Handbook of ...
TECHNIQUES ...................395/600 FILE MAINTENANCE OPERATIONS ....395/600 FILE MANAGEMENT SYSTEM .........395/600 HYBRID ... CONTROL SYSTEMS ................364/130+ DATABASE MANAGEMENT SYSTEMS ....395/600 DATABASE MANAGEMENT TECHNIQUES .395/600 ... COMPUTATIONAL SYSTEMS ........364/400+ MEASURING SYSTEM, ELECTRICAL .364/481+ MEASURING SYSTEMS, PHYSICAL ..364/550+ ARRAY ... SYSTEM UTILITIES ...............395/700 SYSTEMS CONTROLLED BY DATA BEARING RECORDS ..............235/375+ TASK SCHEDULING ...
Artificial intelligence techniques have long been applied to financial investing scenarios to determine market inefficiencies, ... Hybrid System: A system which employs a combination of techniques and methods. ... AI techniques, such as knowledge-based, machine learning, and natural language processing, are integrated into systems that ... Future trends will continue to integrate hybrid artificial intelligence techniques into financial investing, portfolio ...
Embedded software and systems are incre- ingly becoming a key technological component of all kinds of complex technical systems ... With the advent of VLSI system level integration and system-on-chip, the center of gravity of the computer industry is now ... climate control systems, etc. The ICESS 2005 conference provided a premier international forum for - searchers, developers and ... and to promote embedded software and system - dustrialization and wide applications on all aspects of embedded software and ...
... is now introducing its MiniMed 670G hybrid closed loop insulin delivery system to the U.S. market. The ... Theme: "Exploring the latest Techniques in Orthopedics and Osteoporosis". This conference concentrates on the newest and ... is now introducing its MiniMed 670G hybrid closed loop insulin delivery system to the U.S. market. The first such system to ... Medtronics MiniMed 670G Hybrid Closed Loop Insulin Delivery System Now Available in U.S.. June 8th, 2017 Editors Medicine, ...
SBC: ADCOM SYSTEMS TECHNOLOGY,INC. Topic: N/A INNOVATIVE TECHNIQUES ARE PROPOSED FOR INVESTIGATION IN A PHASE I EFFORT TO ... A HYBRID NEURAL NETWORK/EXPERT SYSTEM APPROACH TO MULTIPLE TARGET RECOGNITION SBC: Charles River Analytics, Inc. Topic: N/A ... SBC: RCT Systems, Inc. Topic: N/A EXISTING OPTICAL FIBER GUIDANCE PAYOUT TENSION AND TORQUE MEASUREMENT SYSTEMS (TTMS) HAVE ... VIBRATIONS LIMIT SYSTEMS USING AIR BEARINGS AND CALIBRATED LOAD CELLS TO SAMPLING RATES ONTHE ORDER OF TEN HERTZ. MOUNTING THE ...
Two-hybrid System Techniques. Screening techniques first developed in yeast to identify genes encoding interacting proteins. ... Two-hybrid techniques refer to analysis for protein-protein interactions, one-hybrid for DNA-protein interactions, three-hybrid ... Reverse n-hybrid techniques refer to analysis for mutations or other small molecules that dissociate known interactions. ... PERIPHERAL NERVOUS SYSTEM DISEASES; SPINAL CORD DISEASES; and BRAIN DISEASES may be associated with impaired or abnormal ...
In this study, we detected the interaction between XAF1 and FHL2 by using the yeast two-hybrid system. We identified FHL2 as a ... Hypoxia and p53 in the Cardiovascular system BIOCARTA. Data from KEGG and BioCarta [BIOCARTA terms] via CGAP [Hide] ...
The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. Cryptochromes are blue/ultraviolet-A ( ... Two-Hybrid System Techniques. Ubiquitin-Protein Ligases / metabolism. Chemical. Reg. No./Substance: 0/Arabidopsis Proteins; 0/ ... Previous Document: An experimental system to study responses of Medicago truncatula roots to chitin oligomers of high d.... ... The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. Cryptochromes are blue/ultraviolet-A ( ...
Two-Hybrid System Techniques. Chemical. Reg. No./Substance: 0/Capsid Proteins; 0/VP3 protein, Chicken anemia virus; EC 5.2.1.-/ ... Through a yeast two-hybrid screen, we identified human Peptidyl-prolyl isomerase-like 3 (Ppil3) as one of the Apoptin- ...
Analysis of RNA-Protein Interactions Using a Yeast Three-Hybrid System. Co-Immunoprecipitation Techniques for Assessing RNA- ... Flexible - Read on multiple operating systems and devices. Easily read eBooks on smart phones, computers, or any eBook readers ... Expert researchers introduce the most advanced technologies and techniques *Offers step-by-step lab instructions, including ...
Considering four key enzymes, a modified fourteen-dimensional nonlinear hybrid dynamic system is established to describe the ... A novel quantitative definition of biological robustness is proposed to characterize the systems resilience when system ... In this way, the definition can be used as an objective function of the system identification model due to the lack of data on ... It not only considers the expectation of system output data after parameter disturbance but also considers the influence of the ...
  • It includes expanded and separated chapters on genetic algorithms and single-candidate optimization techniques, while the chapter on neural networks now covers spiking networks and a range of recurrent networks. (routledge.com)
  • Handbook of Research on Artificial Intelligence Techniques and Algorithms. (igi-global.com)
  • In P. Vasant (Ed.), Handbook of Research on Artificial Intelligence Techniques and Algorithms (pp. 620-654). (igi-global.com)
  • Therefore, a hybrid model that combines genetic algorithms and support vector machines is suggested in such a way that, when using SVM as a fitness function of the Genetic Algorithm (GA), the most representative variables for a specific classification problem can be selected. (hindawi.com)
  • These tools are often limited with respect to the number as well as the functionalities of the provided hybrid simulation algorithms. (biomedcentral.com)
  • Snoopy's hybrid simulator provides a wide range of state-of-the-art hybrid simulation algorithms. (biomedcentral.com)
  • As a combined approach, hybrid simulation [ 9 - 15 ] merges exact stochastic and approximate algorithms. (biomedcentral.com)
  • In this paper a hybrid modeling and system identification method, combining linear least squares regression and artificial neural network techniques, is presented to model a type of dynamic systems which have an incomplete analytical model description. (asme.org)
  • This approach in modeling nonlinear, partially-understood systems is particularly useful to the study of manufacturing processes, where the linear regression portion of the hybrid model is established using a known mathematical model for the process and the neural network is constructed using the residuals from the least squares regression, therefore ensuring a more precise process model for the specific machining setup, tooling selection, workpiece properties, etc. (asme.org)
  • 3. The system according to claim 1, wherein said processing means comprises a neural network configured to perform said processing. (google.com)
  • Covering the full spectrum of intelligent systems techniques, it incorporates knowledge-based systems, computational intelligence, and their hybrids. (routledge.com)
  • Hybrid simulation of (computational) biochemical reaction networks, which combines stochastic and deterministic dynamics, is an important direction to tackle future challenges due to complex and multi-scale models. (biomedcentral.com)
  • Inherently hybrid computational models of biochemical networks entail two time scales: fast and slow. (biomedcentral.com)
  • Using this tool, a computational model of biochemical networks can be constructed using a (coloured) hybrid Petri net's graphical notations, or imported from other compatible formats (e.g. (biomedcentral.com)
  • A Hybrid GA-GSA Algorithm for Optimizing the Performance of an Industrial System by Utilizing Uncertain Data. (igi-global.com)
  • The main objective of this chapter is to present a novel hybrid GA-GSA algorithm to permit the reliability analyst to increase the performance of the system by utilizing the uncertain data. (igi-global.com)
  • Therefore, to handle this issue, the proposed algorithm maximizes the Reliability, Availability, and Maintainability (RAM) parameters simultaneously for increasing the performance and productivity of the system. (igi-global.com)
  • The first such system to become available, the MiniMed 670G utilizes Medtronic's SmartGuard HCL algorithm to deduce when and how much insulin to deliver, yet allowing the patients themselves to make changes when necessary. (medgadget.com)
  • To smooth out short- and long-term fluctuations, this paper presents a coordinated control algorithm using model predictive control (MPC) to manage a hybrid energy storage system (HESS) consisting of ultra-capacitor (UC) and lithium-ion battery (LB) banks. (mdpi.com)
  • Through a yeast two-hybrid screen, we identified human Peptidyl-prolyl isomerase-like 3 (Ppil3) as one of the Apoptin-associated proteins. (biomedsearch.com)
  • Characterization of presenilin-amyloid precursor interaction using bacterial expression and two-hybrid systems for human membrane proteins. (harvard.edu)
  • We isolated the barley ELMO Domain Containing Protein, HvELMOD{_}C, in a yeast two hybrid screen for proteins interacting with HvMAGAP1 (Microtubule Associated ROP-GTPase Activating Protein 1). (tum.de)
  • The type III secretion system (T3SS) is a specialized apparatus evolved by Gram-negative bacteria to deliver effector proteins into host cells, thus facilitating the establishment of an infection. (diva-portal.org)
  • The term "two-hybrid" is coined from the two classes of hybrid or chimeric proteins. (news-medical.net)
  • The variations in the Y2H system depend on the interaction of proteins. (news-medical.net)
  • The repressed transactivator (RTA) Y2H system was created to identify interactions that involve transcriptional activator proteins genetically. (news-medical.net)
  • The Polymerase III (Pol III) transcription system allows interaction of transcription factors with proteins by activating transcription that is based on RNA polymerase II. (news-medical.net)
  • Screening for interactions between extracellular proteins system (SCINEX-P system) permits the analysis of protein interactions that take place in the oxidizing environment of endoplasmic reticulum. (news-medical.net)
  • In this system, fusion takes place between the mutated Ire1p proteins and the proteins of interest, where mutated Ire1p proteins lack their luminal domain. (news-medical.net)
  • The interaction that occurs between the two hybrid proteins results in reconstitution of Ire1p dimerization and activation of unfolded protein response (UPR) downstream signaling. (news-medical.net)
  • The show will be held on 18-21 Oct 2017 in Beijing, China.Profile of exhibit based on New energy automobiles: Plug-in hybrid electric vehicles, Electric vehicles (BEV, including solar cars), Fuel cell vehicles (FCEV), hydrogen engine vehicles, air vehicles, magnetic electric vehicles and other new energy vehicles. (autonews.com)
  • IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems, 2017, 36(11), 1883-1896. (liu.se)
  • L. Liu , Y. N. Wang , L. Hou and X. R. Feng , Easy encoding and low bit-error-rate chaos communication system based on reverse-time chaotic oscillator, Iet Signal Processing , 11 (2017), 869-876. (aimsciences.org)
  • S. Nazari-Shirkouhi , S. Miri-Nargesi and A. Ansarinejad , A fuzzy decision making methodology based on fuzzy ahp and fuzzy topsis with a case study for information systems outsourcing decisions, Journal of Intelligent & Fuzzy Systems , 32 (2017), 3921-3943. (aimsciences.org)
  • The experimental results show that f-HNT functions only as an additive in the hybrid gels and does not demonstrate gelator behavior. (rsc.org)
  • This volume constitutes the proceedings of the Third International Workshop on Hybrid Artificial Intelligence Systems, HAIS 2008, held in Burgos, Spain, during September 24-26, 2008. (springer.com)
  • The two LNAI volumes 6678 and 6679 constitute the proceedings of the 6th International Conference on Hybrid Artificial Intelligent Systems, HAIS 2011, held in Wroclaw, Poland, in May 2011. (springer.com)
  • The RAS recruitment system involves fusion of active mammalian RAS and the soluble protein X. The system requires only the membrane location and does not involve the Ras guanyl exchange factors' activity. (news-medical.net)
  • A hybrid moving bed biofilm reactor-membrane bioreactor (hybrid MBBR-MBR) system was studied as an alternative solution to conventional activated sludge processes and membrane bioreactors. (environmental-expert.com)
  • Artificial intelligence techniques have long been applied to financial investing scenarios to determine market inefficiencies, criteria for credit scoring, and bankruptcy prediction, to name a few. (igi-global.com)
  • In this paper, we propose the use of a prediction hybrid system combining GA and SVM. (hindawi.com)
  • Here we show for the first time that nuclear ZO-2 directly interacts with the DNA-binding protein scaffold attachment factor-B (SAF-B). Our results from two-hybrid assays and in vivo co-immunoprecipitation studies provide evidence to suggest that ZO-2 associates with the C-terminal portion of SAF-B via its PDZ-1 domain. (nih.gov)
  • The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. (biomedsearch.com)
  • and novel approaches to genetic fuzzy systems. (springer.com)
  • and hybrid intelligent approaches in cooperative multi-robot systems. (springer.com)
  • We define the Context-Oriented Decomposition (COD) of an ontology as a technique that combines the benefits of both approaches: it allows authors to identify relevant fragments, while guaranteeing the strong semantic properties of the logic-based Atomic Decomposition. (easychair.org)
  • There are various approaches to capture reaction firings as well as their effects on the system state. (biomedcentral.com)
  • Considering four key enzymes, a modified fourteen-dimensional nonlinear hybrid dynamic system is established to describe the microbial continuous culture with enzyme-catalytic and genetic regulation. (aimsciences.org)
  • The yeast two-hybrid (Y2H) system is a genetic technique used to determine protein-protein interactions. (news-medical.net)
  • 2 Real-world use of the Guardian Sensor 3 also demonstrates continued strong performance and reliability of the company's most accurate sensor to date with a MARD of 10.56 percent against BG 3 - confirming why it's the only continuous glucose monitor trusted and approved by the FDA to power a hybrid closed loop system. (medgadget.com)
  • K. K. Gao , X. Zhang , E. M. Feng and Z. L. Xiu , Sensitivity analysis and parameter identification of nonlinear hybrid systems for glycerol transport mechanisms in continuous culture, Journal of Theoretical Biology , 347 (2014), 137-143. (aimsciences.org)
  • We propose a new statistical approach to analyzing stochastic systems against specifications given in a sublogic of continuous stochastic logic (CSL). (psu.edu)
  • Consider the continuous linear system x ˙ ( t ) = A ( t ) x ( t ) + B ( t ) u ( t ) {\displaystyle {\dot {\mathbf {x} }}(t)=A(t)\mathbf {x} (t)+B(t)\mathbf {u} (t)} y ( t ) = C ( t ) x ( t ) + D ( t ) u ( t ) . {\displaystyle \mathbf {y} (t)=C(t)\mathbf {x} (t)+D(t)\mathbf {u} (t). (wikipedia.org)
  • These control systems are generally understood as reactive systems that intermix discrete and continuous components, and, depending on the context, they are referred to as digital or hybrid control systems. (rug.nl)
  • In particular, we examine continuous systems with embedded supervisory controllers that experience abrupt, partial or full failure of component devices. (sciweavers.org)
  • Discrete & Continuous Dynamical Systems - S , 2019, 12 (4&5) : 1355-1369. (aimsciences.org)
  • Hybrid simulation works by first partitioning the set of reactions into stochastic and deterministic ones and correspondingly classifying the set of species into discrete and continuous ones. (biomedcentral.com)
  • These requirements lead to reconsider data management and processing of complex and numerous continuous queries over data streams, as current database systems and data processing methods are nit suitable. (iaria.org)
  • The third edition of this bestseller examines the principles of artificial intelligence and their application to engineering and science, as well as techniques for developing intelligent systems to solve practical problems. (routledge.com)
  • Using clear and concise language, Intelligent Systems for Engineers and Scientists, Third Edition features updates and improvements throughout all chapters. (routledge.com)
  • The author provides sufficient detail to help you develop your own intelligent systems for real applications. (routledge.com)
  • Whether you are building intelligent systems or you simply want to know more about them, this book provides you with detailed and up-to-date guidance. (routledge.com)
  • Over the past few decades, ML techniques have been widely used in intelligent healthcare systems, especially for breast cancer (BC) diagnosis and prognosis. (mdpi.com)
  • The intelligent healthcare system is therefore a valuable and important domain. (mdpi.com)
  • The intelligent healthcare system can assist physicians to diagnose patients with greater accuracy or provide more meaningful benchmarks, and further it can aid people to plan for their physical condition into the future. (mdpi.com)
  • IEEE Transaction on Intelligent Transportation Systems. (us.es)
  • These techniques include: single processor with watchdog, dual processors, dual core processor, and asymmetric processor (intelligent watchdog). (sae.org)
  • Welcome to the proceedings of the 2005 International Conference on Emb- ded Software and Systems (ICESS 2005) held in Xian, China, December 16-18, 2005. (google.com)
  • Proceedings of the Advances in Neural Information Processing Systems 8 Conference (NIPS 8). (berkeley.edu)
  • Proceedings of the 9th Annual Conference on Neural Information Processing Systems (NIPS 1995). (berkeley.edu)
  • modeling of complex systems through hybrid systems and automata. (rug.nl)
  • A novel quantitative definition of biological robustness is proposed to characterize the system's resilience when system parameters were perturbed. (aimsciences.org)
  • Y. J. Guo , E. M. Feng , L. Wang and Z. L. Xiu , Complex metabolic network of 1, 3-propanediol transport mechanisms and its system identification via biological robustness, Bioprocess and Biosystems Engineering , 37 (2014), 677-686. (aimsciences.org)
  • Snoopy's hybrid simulator is a platform-independent tool providing an accurate and efficient simulation of hybrid (biological) models. (biomedcentral.com)
  • The optimal design parameters corresponding to each component of the system are evaluated by solving a nonlinear optimization problem and compared their results with other methods. (igi-global.com)
  • We use low and mild processing methods and no protein extrusion techniques. (foodnavigator.com)
  • Unlike past numerical and statistical analysis methods, we assume that the system under investigation is an unknown, deployed black-box that can be passively observed to obtain sample traces, but cannot be controlled. (psu.edu)
  • Then, we will describe the methods used to develop the proposed system. (hindawi.com)
  • Fourier-Motzkin methods for fault diagnosis in discrete event systems. (bham.ac.uk)
  • After an introduction to electronic voting, we will describe the current techniques for e-voting protocols analysis and review the key challenges towards a fully automated verification. (easychair.org)
  • Over the past decade, several techniques have been published about controller safety and integrity verification. (sae.org)
  • Fast vectorless power grid verification using an approximate inverse technique. (rwth-aachen.de)
  • IEEE Transactions on Aerospace and Electronic Systems. (us.es)
  • IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems, 2016, 35(1), 100-113. (liu.se)
  • IEEE Transactions on Very Large Scale Integration (vlsi) Systems, 2015, 23(11), 2417-2430. (liu.se)
  • IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems, 2014, 33(6), 931-944. (liu.se)
  • The following are examples of variations of controllability notions which have been introduced in the systems and control literature: State controllability Output controllability Controllability in the behavioural framework The state of a deterministic system, which is the set of values of all the system's state variables (those variables characterized by dynamic equations), completely describes the system at any given time. (wikipedia.org)
  • SysCOLA: a framework for co-development of automotive software and system platform. (rwth-aachen.de)
  • The modeling method is then simulated for a macro-scale hard turning process, and the result proves the effectiveness of the proposed hybrid modeling method. (asme.org)
  • From a system effectiveness viewpoint, reliability and maintainability jointly provide system availability and dependability. (igi-global.com)
  • This study analyzes the effectiveness of such a hybrid system. (nature.com)
  • Effectiveness of Bi-Needle Technique (Hybrid Yeung Endoscopic Spine System/Transforaminal Endoscopic Spine System) for Percutaneous Endoscopic Lumbar Discectomy. (pubfacts.com)
  • The paper will be broken down into four topics: 1) the development of a solution to target behavioral-level models to an advanced, real-time simulation device, 2) the development of a high-bandwidth, high-power emulation capability, 3) the integration of the real-time simulation device and the APE, and 4) the application of the emulation system (simulator and emulator) in an xHIL experiment. (sae.org)
  • An efficient approach for system-level timing simulation of compiler-optimized embedded software. (rwth-aachen.de)
  • Trace-driven workload simulation method for Multiprocessor System-On-Chips. (rwth-aachen.de)
  • We present Snoopy's hybrid simulator, an efficient hybrid simulation software which builds on Snoopy, a tool to construct and simulate Petri nets. (biomedcentral.com)
  • SBML), and afterwards executed via dynamic or static hybrid simulation. (biomedcentral.com)
  • A vector representing the state of a system serves to track the species concentrations and/or the corresponding number of molecules as the simulation advances with respect to time. (biomedcentral.com)
  • The chosen simulation procedure determines how the system state vector is updated as well as the progression of the simulation time. (biomedcentral.com)
  • Several recent studies have evaluated the use of computer technologies such as expert systems and neural networks in management fraud detection. (aisnet.org)
  • The purpose of this paper is to extend this line of research by investigating the utility of neural fuzzy systems in management fraud detection. (aisnet.org)
  • These two classes form the basis of the protein-protein interaction detection system. (news-medical.net)
  • Since the analysis based on the collected data mostly contains a lot of uncertainties, the corresponding results obtained do not tell the exact nature of the system. (igi-global.com)
  • In this context, ML techniques can take over some complex manual works from the physicians, for instance, text and voice analysis, which have been applied to identify/code patient emotions corresponding to healthcare professionals' responses. (mdpi.com)
  • Analysis of phosphorylation-dependent protein-protein interactions using a bacterial two-hybrid system. (harvard.edu)
  • Bacterial two-hybrid analysis of interactions between region 4 of the sigma(70) subunit of RNA polymerase and the transcriptional regulators Rsd from Escherichia coli and AlgQ from Pseudomonas aeruginosa. (harvard.edu)
  • The students will learn advanced techniques for the analysis and design of digital and hybrid control systems. (rug.nl)
  • The course aims at providing an introduction to advanced tools that can be used for the analysis, modeling and design of these kind of systems. (rug.nl)
  • Application and development of finite element techniques for transducer design and analysis. (bham.ac.uk)
  • This Y2H system has been successfully implemented for analysis of interaction between Calnexin and protein disulfide isomerase ERp57, and interactions between antibodies and antigens. (news-medical.net)
  • Designing heterogeneous ECU networks via compact architecture encoding and hybrid timing analysis. (rwth-aachen.de)
  • ESOP is an annual conference devoted to fundamental issues in the specification, analysis, and implementation of programming languages and systems. (etaps.org)
  • This paper discusses an overview of five controller integrity techniques, and then provides a detailed discussion of an asymmetric processor approach. (sae.org)
  • hybrid systems and automata. (rug.nl)
  • The book also provides extended coverage of fuzzy logic, including type-2 and fuzzy control systems. (routledge.com)
  • C. X. Gao , Y. Lang , E. M. Feng and Z. L. Xiu , Nonlinear impulsive system of microbial production in fed-batch culture and its optimal control, Journal of Applied Mathematics and Computing , 19 (2005), 203-214. (aimsciences.org)
  • C. Karakuzu, Fuzzy controller training using particle swarm optimization for nonlinear system control, ISA Transactions , 48 (2009), Page 245. (aimsciences.org)
  • Controllability is an important property of a control system, and the controllability property plays a crucial role in many control problems, such as stabilization of unstable systems by feedback, or optimal control. (wikipedia.org)
  • In particular, no information on the past of a system is needed to help in predicting the future, if the states at the present time are known and all current and future values of the control variables (those whose values can be chosen) are known. (wikipedia.org)
  • Complete state controllability (or simply controllability if no other context is given) describes the ability of an external input (the vector of control variables) to move the internal state of a system from any initial state to any other final state in a finite time interval. (wikipedia.org)
  • L4 Implement digital and switching control systems in MatLab/Simulink. (rug.nl)
  • Nowadays, even refrigerators, washing machines and temperature control units use highly sophisticated control systems and logical decision-making components. (rug.nl)
  • More generally, applications range from automotive and process control to embedded and networked control systems. (rug.nl)
  • Event-based digital control systems (part I). (rug.nl)
  • The course unit assumes prior knowledge acquired from Linear Algebra (IEM, PTL track), Signals and Systems (IEM, PTL and PPT tracks, BSc LS&T: Major Biomedical Technology), Control Engineering (IEM, PTL track), Digital and Hybrid Control Systems (IEM, PTL track). (rug.nl)
  • Students are required to design a digital/hybrid control system, implement it using MatLab/Simulink software packages, and write a report. (rug.nl)
  • Each question consists in designing a digital/hybrid control system, and contains a certain number of sub-questions. (rug.nl)
  • Embedded controllers and digital signal processors are increasingly being used in automotive safety critical control systems. (sae.org)
  • Sensors will also be central to hybrid autonomous manufacturing to control the processes and maintain and assure quality. (weforum.org)
  • Further, power quality is often difficult to assess directly during experiments and aircraft operation or during data post-processing for the integrated electric power system (including sources, distribution, and loads). (sae.org)
  • AI techniques, such as knowledge-based, machine learning, and natural language processing, are integrated into systems that simultaneously address data identification, asset valuation, and risk management. (igi-global.com)
  • Data from the pivotal trial of the MiniMed 670G system published in the Journal of the American Medical Association (JAMA) demonstrated less glycemic variability, more time in the target range, less exposure to hypoglycemia and hyperglycemia, and reduced A1c for patients on the system. (medgadget.com)
  • It not only considers the expectation of system output data after parameter disturbance but also considers the influence of the variance of these data. (aimsciences.org)
  • In this way, the definition can be used as an objective function of the system identification model due to the lack of data on the concentration of intracellular substances. (aimsciences.org)
  • QYResearchReports's latest report on the Hybrid Powertrain Systems market offers insights via a methodical and data-backed study of the market. (mynewsdesk.com)
  • A comparison of data collected in both systems shows the synergistic action of f-HNT and the gel matrix in controlling the release of CPT in the media and maintaining the drug in its active form. (rsc.org)
  • A hybrid surface mount component inspection system which includes both vision and infrared inspection techniques to determine the presence of surface mount components on a printed wiring board, and the quality of solder joints of surface mount components on printed wiring boards by using data level sensor. (google.com)
  • Similarly, cost reduction is obtained, taking into account a temporal perspective as well as the one regarding the system complexity for data acquisition, since we are dealing with a smaller amount of information. (hindawi.com)
  • Low power gated bus synthesis using shortest-path Steiner graph for system-on-chip communications. (rwth-aachen.de)
  • With the advent of VLSI system level integration and system-on-chip, the center of gravity of the computer industry is now moving from personal c- puting into embedded computing. (google.com)
  • Low Power High Fault Coverage Test Techniques for Digital VLSI Circuits. (bham.ac.uk)
  • Switching between stable and unstable systems. (rug.nl)
  • and to promote embedded software and system - dustrialization and wide applications on all aspects of embedded software and systems. (google.com)
  • In this paper, we aim to review ML techniques and their applications in BC diagnosis and prognosis. (mdpi.com)
  • This study suggests a suitable strategy to obtain two-component gel hybrids based on nanocarriers with controlled drug carrier capacity for biomedical applications. (rsc.org)
  • Typically, the hybrid repair involves sewing in a conduit to deliver the main body of a bifurcated or unibody stent graft when endovascular access is not possible. (vascsurg.me)
  • The SOS recruitment system involves the fusion of a soluble protein X into the mammalian SOS. (news-medical.net)
  • Hybrid autonomous manufacturing involves automated systems that use multiple tools and techniques to build high-quality components on demand. (weforum.org)
  • Known as hybrid autonomous manufacturing, this process involves automated systems that seamlessly use multiple tools and techniques to build high-quality components where and when they are needed. (weforum.org)
  • Contributing expert authors look at key techniques in the design flow as well as selected codesign tools and design environments, building on basic knowledge to consider the latest techniques. (springer.com)
  • Readers are invited to follow the progress of design techniques through this work, which assists readers in following current research directions and learning about state-of-the-art techniques. (springer.com)
  • Based on these optimal design parameters, an investigation has been done for finding the most critical component of the system for saving money, manpower, and time, as well as increasing the performance of the system. (igi-global.com)
  • Then, we design a parallel computing method to solve the system identification model. (aimsciences.org)
  • With the emergence of new systems disrupting the market including Advanced Driver Assistance Systems (ADAS) and Autonomous Vehicles, learn how to design for the vehicle dynamics of the future. (autonews.com)
  • This course is an introduction to mathematical modeling techniques used in the design of electronic systems. (nottingham.ac.uk)
  • it is constructed via a systematic plan that demands familiarity with analytical techniques, architectural design methodologies, implementation polices, and testing techniques. (iaria.org)
  • We describe a NOTES hybrid transvaginal upper pole heminephrectomy in a 24-year old with recurrent infections in a poorly functioning right upper pole moiety. (elsevier.es)
  • We describe the technique for transvaginal Hybrid-NOTES heminephrectomy. (elsevier.es)
  • We then describe an adaptable software safety process for automotive safety-critical systems based on these common elements. (sae.org)
  • In addition, we describe how the proposed process may be integrated into a proposed system safety process, and how it may be integrated with an existing software development process. (sae.org)
  • aims to bring together leading academic scientists, researchers and research scholars to exchange and share their experiences and research results on all aspects of Advances in Urban Energy Systems. (waset.org)
  • Also, high quality research contributions describing original and unpublished results of conceptual, constructive, empirical, experimental, or theoretical work in all areas of Advances in Urban Energy Systems are cordially invited for presentation at the conference. (waset.org)
  • ICAUES 2022 has teamed up with the Special Journal Issue on Advances in Urban Energy Systems . (waset.org)
  • Advances in wireless communications, model-based diagnostics, human-machine interfaces, electronics and embedded system technologies have created the foundation for a dramatic shift in the way the vehicles are diagnosed and maintained. (sae.org)
  • Studying protein-protein interactions using a bacterial two-hybrid system. (harvard.edu)
  • A bacterial two-hybrid system that utilizes Gateway cloning for rapid screening of protein-protein interactions. (harvard.edu)
  • Modifications in this system enable it to be used for monitoring inhibitors of protein-protein interactions that involve libraries of small molecule compounds. (news-medical.net)
  • Structure and Interpretation of Systems and Signals - Spring 2007. (nottingham.ac.uk)
  • A camera component of the system photographically records the image on monochromatic film to provide a high resolution photograph from which electronic luminance signals are derived, and also utilizes an image sensor for providing lower resolution chrominance signals which are recorded on a medium, such as a magnetic stripe, that may be formed on the film unit. (google.com)
  • The photograph and chrominance signal recording are transferred to a reproduction component of the system which derives the luminance information signals from the photograph and combines it with the chrominance signals to provide three primary color signals which are utilized to drive a hard copy printer or an electronic image display device. (google.com)
  • It can reduce the information needed for transmission, and only need to transmit a small amount of error correction signals on the channel to achieve synchronization of the receiving and the transmitting system, which greatly suppress the drawback of the traditional method. (aimsciences.org)
  • The need for these techniques arises, as noted, from the emergence of certain predictive variables that may become irrelevant or redundant. (hindawi.com)
  • Research details Global Hybrid Powertrain Systems Industry 2016 by. (mynewsdesk.com)
  • Furthermore, we examined the interaction between MdCRY2 and AtCOP1 using a yeast two-hybrid assay and a bimolecular fluorescence complementation assay. (biomedsearch.com)
  • GAG3 encodes a novel WD40-repeat protein previously found to interact with Dnm1p in a two-hybrid assay. (nih.gov)
  • The Intel Arria 10 SoC, based on TSMC's 20 nm process technology, combines a dual-core ARM Cortex*-A9 MPCore* Hard Processor System (HPS) with industry-leading programmable logic technology that includes hardened floating-point digital signal processing (DSP) blocks . (intel.com)
  • The present invention relates to the field of image recording and reproduction and, more particularly, to a hybrid type of image recording and reproduction system which combines aspects of both photography and electronic imaging. (google.com)
  • Finally, a healthcare system model of our recent work is also shown. (mdpi.com)
  • We refine these diagnoses using parameter estimation and model fitting techniques. (sciweavers.org)
  • Based on this, a hybrid self-synchronization chaotic system model is proposed. (aimsciences.org)
  • Furthermore, our ability to model and reason about the architectural properties of a system built from existing components is of great concern to modern system developers. (iaria.org)
  • 1 Importantly, real-world use of the system in the Customer Training Phase has shown consistent improved outcomes across several important areas including Time in Range (74 percent) and greater median time in Auto Mode (92 percent). (medgadget.com)
  • Capturing the impedance of loads and sources is important for accurately assessing the small-signal stability of a system. (sae.org)

No images available that match "two hybrid system techniques"