Tuberculosis vaccines. Medical search

Vaccines or candidate vaccines used to prevent or treat TUBERCULOSIS.

Any of the infectious diseases of man and other animals caused by species of MYCOBACTERIUM.

An active immunizing agent and a viable avirulent attenuated strain of Mycobacterium tuberculosis, var. bovis, which confers immunity to mycobacterial infections. It is used also in immunotherapy of neoplasms due to its stimulation of antibodies and non-specific immunity.

MYCOBACTERIUM infections of the lung.

A species of gram-positive, aerobic bacteria that produces TUBERCULOSIS in humans, other primates, CATTLE; DOGS; and some other animals which have contact with humans. Growth tends to be in serpentine, cordlike masses in which the bacilli show a parallel orientation.

The bovine variety of the tubercle bacillus. It is called also Mycobacterium tuberculosis var. bovis.

Suspensions of killed or attenuated microorganisms (bacteria, viruses, fungi, protozoa), antigenic proteins, synthetic constructs, or other bio-molecular derivatives, administered for the prevention, amelioration, or treatment of infectious and other diseases.

Small synthetic peptides that mimic surface antigens of pathogens and are immunogenic, or vaccines manufactured with the aid of recombinant DNA techniques. The latter vaccines may also be whole viruses whose nucleic acids have been modified.

Administration of vaccines to stimulate the host's immune response. This includes any preparation intended for active immunological prophylaxis.

Suspensions of attenuated or killed bacteria administered for the prevention or treatment of infectious bacterial disease.

Substances elaborated by bacteria that have antigenic activity.

Vaccines in which the infectious microbial nucleic acid components have been destroyed by chemical or physical treatment (e.g., formalin, beta-propiolactone, gamma radiation) without affecting the antigenicity or immunogenicity of the viral coat or bacterial outer membrane proteins.

An infection of cattle caused by MYCOBACTERIUM BOVIS. It is transmissible to man and other animals.

Suspensions of attenuated or killed viruses administered for the prevention or treatment of infectious viral disease.

Any immunization following a primary immunization and involving exposure to the same or a closely related antigen.

Recombinant DNA vectors encoding antigens administered for the prevention or treatment of disease. The host cells take up the DNA, express the antigen, and present it to the immune system in a manner similar to that which would occur during natural infection. This induces humoral and cellular immune responses against the encoded antigens. The vector is called naked DNA because there is no need for complex formulations or delivery agents; the plasmid is injected in saline or other buffers.

One of several skin tests to determine past or present tuberculosis infection. A purified protein derivative of the tubercle bacilli, called tuberculin, is introduced into the skin by scratch, puncture, or interdermal injection.

Live vaccines prepared from microorganisms which have undergone physical adaptation (e.g., by radiation or temperature conditioning) or serial passage in laboratory animal hosts or infected tissue/cell cultures, in order to produce avirulent mutant strains capable of inducing protective immunity.

Two or more vaccines in a single dosage form.

Tuberculosis resistant to chemotherapy with two or more ANTITUBERCULAR AGENTS, including at least ISONIAZID and RIFAMPICIN. The problem of resistance is particularly troublesome in tuberculous OPPORTUNISTIC INFECTIONS associated with HIV INFECTIONS. It requires the use of second line drugs which are more toxic than the first line regimens. TB with isolates that have developed further resistance to at least three of the six classes of second line drugs is defined as EXTENSIVELY DRUG-RESISTANT TUBERCULOSIS.

A genus of gram-positive, aerobic bacteria. Most species are free-living in soil and water, but the major habitat for some is the diseased tissue of warm-blooded hosts.

Substances that augment, stimulate, activate, potentiate, or modulate the immune response at either the cellular or humoral level. The classical agents (Freund's adjuvant, BCG, Corynebacterium parvum, et al.) contain bacterial antigens. Some are endogenous (e.g., histamine, interferon, transfer factor, tuftsin, interleukin-1). Their mode of action is either non-specific, resulting in increased immune responsiveness to a wide variety of antigens, or antigen-specific, i.e., affecting a restricted type of immune response to a narrow group of antigens. The therapeutic efficacy of many biological response modifiers is related to their antigen-specific immunoadjuvanticity.

Vaccines or candidate vaccines containing inactivated HIV or some of its component antigens and designed to prevent or treat AIDS. Some vaccines containing antigens are recombinantly produced.

Proteins found in any species of bacterium.

The major interferon produced by mitogenically or antigenically stimulated LYMPHOCYTES. It is structurally different from TYPE I INTERFERON and its major activity is immunoregulation. It has been implicated in the expression of CLASS II HISTOCOMPATIBILITY ANTIGENS in cells that do not normally produce them, leading to AUTOIMMUNE DISEASES.

Vaccines consisting of one or more antigens that stimulate a strong immune response. They are purified from microorganisms or produced by recombinant DNA techniques, or they can be chemically synthesized peptides.

Semisynthetic vaccines consisting of polysaccharide antigens from microorganisms attached to protein carrier molecules. The carrier protein is recognized by macrophages and T-cells thus enhancing immunity. Conjugate vaccines induce antibody formation in people not responsive to polysaccharide alone, induce higher levels of antibody, and show a booster response on repeated injection.

An acute form of TUBERCULOSIS in which minute tubercles are formed in a number of organs of the body due to dissemination of the bacilli through the blood stream.

Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.

Manifestations of the immune response which are mediated by antigen-sensitized T-lymphocytes via lymphokines or direct cytotoxicity. This takes place in the absence of circulating antibody or where antibody plays a subordinate role.

Antibacterial agent used primarily as a tuberculostatic. It remains the treatment of choice for tuberculosis.

A critical subpopulation of T-lymphocytes involved in the induction of most immunological functions. The HIV virus has selective tropism for the T4 cell which expresses the CD4 phenotypic marker, a receptor for HIV. In fact, the key element in the profound immunosuppression seen in HIV infection is the depletion of this subset of T-lymphocytes.

Either of the pair of organs occupying the cavity of the thorax that effect the aeration of the blood.

The dormant form of TUBERCULOSIS where the person shows no obvious symptoms and no sign of the causative agent (Mycobacterium tuberculosis) in the SPUTUM despite being positive for tuberculosis infection skin test.

Infection of the lymph nodes by tuberculosis. Tuberculous infection of the cervical lymph nodes is scrofula.

Vaccines made from antigens arising from any of the four strains of Plasmodium which cause malaria in humans, or from P. berghei which causes malaria in rodents.

A common name used for the genus Cavia. The most common species is Cavia porcellus which is the domesticated guinea pig used for pets and biomedical research.

Tuberculosis of the bones or joints.

A critical subpopulation of regulatory T-lymphocytes involved in MHC Class I-restricted interactions. They include both cytotoxic T-lymphocytes (T-LYMPHOCYTES, CYTOTOXIC) and CD8+ suppressor T-lymphocytes.

TUBERCULOSIS that involves any region of the GASTROINTESTINAL TRACT, mostly in the distal ILEUM and the CECUM. In most cases, MYCOBACTERIUM TUBERCULOSIS is the pathogen. Clinical features include ABDOMINAL PAIN; FEVER; and palpable mass in the ileocecal area.

Osteitis or caries of the vertebrae, usually occurring as a complication of tuberculosis of the lungs.

Vaccines or candidate vaccines used to prevent PAPILLOMAVIRUS INFECTIONS. Human vaccines are intended to reduce the incidence of UTERINE CERVICAL NEOPLASMS, so they are sometimes considered a type of CANCER VACCINES. They are often composed of CAPSID PROTEINS, especially L1 protein, from various types of ALPHAPAPILLOMAVIRUS.

Tuberculosis of the skin. It includes scrofuloderma and tuberculid, but not LUPUS VULGARIS.

Vaccines or candidate vaccines used to prevent infection with NEISSERIA MENINGITIDIS.

Works about pre-planned studies of the safety, efficacy, or optimum dosage schedule (if appropriate) of one or more diagnostic, therapeutic, or prophylactic drugs, devices, or techniques selected according to predetermined criteria of eligibility and observed for predefined evidence of favorable and unfavorable effects. This concept includes clinical trials conducted both in the U.S. and in other countries.

A semisynthetic antibiotic produced from Streptomyces mediterranei. It has a broad antibacterial spectrum, including activity against several forms of Mycobacterium. In susceptible organisms it inhibits DNA-dependent RNA polymerase activity by forming a stable complex with the enzyme. It thus suppresses the initiation of RNA synthesis. Rifampin is bactericidal, and acts on both intracellular and extracellular organisms. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1160)

Material coughed up from the lungs and expectorated via the mouth. It contains MUCUS, cellular debris, and microorganisms. It may also contain blood or pus.

Vaccines or candidate vaccines containing inactivated hepatitis B or some of its component antigens and designed to prevent hepatitis B. Some vaccines may be recombinantly produced.

A live attenuated virus vaccine of chick embryo origin, used for routine immunization of children and for immunization of adolescents and adults who have not had measles or been immunized with live measles vaccine and have no serum antibodies against measles. Children are usually immunized with measles-mumps-rubella combination vaccine. (From Dorland, 28th ed)

Tuberculosis of the serous membrane lining the thoracic cavity and surrounding the lungs.

Tuberculosis resistant to ISONIAZID and RIFAMPIN and at least three of the six main classes of second-line drugs (AMINOGLYCOSIDES; polypeptide agents; FLUOROQUINOLONES; THIOAMIDES; CYCLOSERINE; and PARA-AMINOSALICYLIC ACID) as defined by the CDC.

A general term for MYCOBACTERIUM infections of any part of the UROGENITAL SYSTEM in either the male or the female.

A suspension of killed Bordetella pertussis organisms, used for immunization against pertussis (WHOOPING COUGH). It is generally used in a mixture with diphtheria and tetanus toxoids (DTP). There is an acellular pertussis vaccine prepared from the purified antigenic components of Bordetella pertussis, which causes fewer adverse reactions than whole-cell vaccine and, like the whole-cell vaccine, is generally used in a mixture with diphtheria and tetanus toxoids. (From Dorland, 28th ed)

A form of bacterial meningitis caused by MYCOBACTERIUM TUBERCULOSIS or rarely MYCOBACTERIUM BOVIS. The organism seeds the meninges and forms microtuberculomas which subsequently rupture. The clinical course tends to be subacute, with progressions occurring over a period of several days or longer. Headache and meningeal irritation may be followed by SEIZURES, cranial neuropathies, focal neurologic deficits, somnolence, and eventually COMA. The illness may occur in immunocompetent individuals or as an OPPORTUNISTIC INFECTION in the ACQUIRED IMMUNODEFICIENCY SYNDROME and other immunodeficiency syndromes. (From Adams et al., Principles of Neurology, 6th ed, pp717-9)

A pyrazine that is used therapeutically as an antitubercular agent.

Substances obtained from various species of microorganisms that are, alone or in combination with other agents, of use in treating various forms of tuberculosis; most of these agents are merely bacteriostatic, induce resistance in the organisms, and may be toxic.

Vaccines or candidate vaccines containing antigenic polysaccharides from Haemophilus influenzae and designed to prevent infection. The vaccine can contain the polysaccharides alone or more frequently polysaccharides conjugated to carrier molecules. It is also seen as a combined vaccine with diphtheria-tetanus-pertussis vaccine.

A suspension of formalin-inactivated poliovirus grown in monkey kidney cell tissue culture and used to prevent POLIOMYELITIS.

Vaccines or candidate vaccines used to prevent and treat RABIES. The inactivated virus vaccine is used for preexposure immunization to persons at high risk of exposure, and in conjunction with rabies immunoglobulin, for postexposure prophylaxis.

Vaccines or candidate vaccines used to prevent infection with ROTAVIRUS.

Vaccines or candidate vaccines used to prevent infection with VIBRIO CHOLERAE. The original cholera vaccine consisted of killed bacteria, but other kinds of vaccines now exist.

Infection of the spleen with species of MYCOBACTERIUM.

Tuberculous infection of the eye, primarily the iris, ciliary body, and choroid.

Vaccines used to prevent TYPHOID FEVER and/or PARATYPHOID FEVER which are caused by various species of SALMONELLA. Attenuated, subunit, and inactivated forms of the vaccines exist.

A live VACCINIA VIRUS vaccine of calf lymph or chick embryo origin, used for immunization against smallpox. It is now recommended only for laboratory workers exposed to smallpox virus. Certain countries continue to vaccinate those in the military service. Complications that result from smallpox vaccination include vaccinia, secondary bacterial infections, and encephalomyelitis. (Dorland, 28th ed)

Immunoglobulins produced in a response to BACTERIAL ANTIGENS.

Immunoglobulins produced in response to VIRAL ANTIGENS.

Infection of the LIVER with species of MYCOBACTERIUM, most often MYCOBACTERIUM TUBERCULOSIS. It is characterized by localized small tuberculous miliary lesions or tumor-like mass (TUBERCULOMA), and abnormalities in liver function tests.

MYCOBACTERIUM infections of the female reproductive tract (GENITALIA, FEMALE).

A live, attenuated varicella virus vaccine used for immunization against chickenpox. It is recommended for children between the ages of 12 months and 13 years.

A rapid-growing, nonphotochromogenic species of MYCOBACTERIUM originally isolated from human smegma and found also in soil and water. (From Dorland, 28th ed)

A vaccine consisting of DIPHTHERIA TOXOID; TETANUS TOXOID; and whole-cell PERTUSSIS VACCINE. The vaccine protects against diphtheria, tetanus, and whooping cough.

An antitubercular agent that inhibits the transfer of mycolic acids into the cell wall of the tubercle bacillus. It may also inhibit the synthesis of spermidine in mycobacteria. The action is usually bactericidal, and the drug can penetrate human cell membranes to exert its lethal effect. (From Smith and Reynard, Textbook of Pharmacology, 1992, p863)

Vaccines used to prevent infection by MUMPS VIRUS. Best known is the live attenuated virus vaccine of chick embryo origin, used for routine immunization of children and for immunization of adolescents and adults who have not had mumps or been immunized with live mumps vaccine. Children are usually immunized with measles-mumps-rubella combination vaccine.

Schedule giving optimum times usually for primary and/or secondary immunization.

Vaccines or candidate vaccines used to prevent infection with hepatitis A virus (HEPATOVIRUS).

A combined vaccine used to prevent MEASLES; MUMPS; and RUBELLA.

Vaccines or candidate vaccines used to prevent STREPTOCOCCAL INFECTIONS.

A treatment method in which patients are under direct observation when they take their medication or receive their treatment. This method is designed to reduce the risk of treatment interruption and to ensure patient compliance.

Infection of the ENDOCRINE GLANDS with species of MYCOBACTERIUM, most often MYCOBACTERIUM TUBERCULOSIS.

Tuberculosis of the brain, spinal cord, or meninges (TUBERCULOSIS, MENINGEAL), most often caused by MYCOBACTERIUM TUBERCULOSIS and rarely by MYCOBACTERIUM BOVIS. The infection may be limited to the nervous system or coexist in other organs (e.g., TUBERCULOSIS, PULMONARY). The organism tends to seed the meninges causing a diffuse meningitis and leads to the formation of TUBERCULOMA, which may occur within the brain, spinal cord, or perimeningeal spaces. Tuberculous involvement of the vertebral column (TUBERCULOSIS, SPINAL) may result in nerve root or spinal cord compression. (From Adams et al., Principles of Neurology, 6th ed, pp717-20)

Deliberate stimulation of the host's immune response. ACTIVE IMMUNIZATION involves administration of ANTIGENS or IMMUNOLOGIC ADJUVANTS. PASSIVE IMMUNIZATION involves administration of IMMUNE SERA or LYMPHOCYTES or their extracts (e.g., transfer factor, immune RNA) or transplantation of immunocompetent cell producing tissue (thymus or bone marrow).

Vaccines or candidate vaccines used to prevent ANTHRAX.

Vaccines or candidate vaccines used to prevent infection with DENGUE VIRUS. These include live-attenuated, subunit, DNA, and inactivated vaccines.

Tuberculosis involving the larynx, producing ulceration of the VOCAL CORDS and the LARYNGEAL MUCOSA.

Vaccines using VIROSOMES as the antigen delivery system that stimulates the desired immune response.

Deoxyribonucleic acid that makes up the genetic material of bacteria.

Infection of the KIDNEY with species of MYCOBACTERIUM.

Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.

Any vaccine raised against any virus or viral derivative that causes hepatitis.

A live vaccine containing attenuated poliovirus, types I, II, and III, grown in monkey kidney cell tissue culture, used for routine immunization of children against polio. This vaccine induces long-lasting intestinal and humoral immunity. Killed vaccine induces only humoral immunity. Oral poliovirus vaccine should not be administered to immunocompromised individuals or their household contacts. (Dorland, 28th ed)

Vaccine used to prevent YELLOW FEVER. It consists of a live attenuated 17D strain of the YELLOW FEVER VIRUS.

A suspension of killed Yersinia pestis used for immunizing people in enzootic plague areas.

Includes the spectrum of human immunodeficiency virus infections that range from asymptomatic seropositivity, thru AIDS-related complex (ARC), to acquired immunodeficiency syndrome (AIDS).

Binary classification measures to assess test results. Sensitivity or recall rate is the proportion of true positives. Specificity is the probability of correctly determining the absence of a condition. (From Last, Dictionary of Epidemiology, 2d ed)

Suspensions of attenuated or killed fungi administered for the prevention or treatment of infectious fungal disease.

Comparative affects of plasmid-encoded interleukin 12 and interleukin 18 on the protective efficacy of DNA vaccination against Mycobacterium tuberculosis. (1/350)

Protective immunity against Mycobacterium tuberculosis infection requires the induction and maintenance of mycobacteria-specific, IFN-gamma-secreting CD4+ and CD8+ T lymphocytes. The development of Th1-like T cells is promoted by the early secretion and synergistic action of interleukin (IL)-12 and IL-18. This study compares the effects of plasmid-encoded IL-12 and IL-18 on the immunogenicity and protective efficacy of a DNA vaccine expressing the M. tuberculosis-secreted protein antigen 85B (DNA-85B). Co-immunization with either IL-12- or IL-18-expressing plasmids augmented the IFN-gamma-secreting T-cell response, and the maximum effect was observed with plasmids encoding both cytokines. Further the IL-12, but not the IL-18-expressing plasmid, significantly increased the protective efficacy of DNA-85B against pulmonary M. tuberculosis infection. Therefore co-administration of plasmid-encoded cytokines provides a potential method for optimizing the protective efficacy of DNA vaccination against tuberculosis. (+info)

Immunogenicity of Mycobacterium tuberculosis RD1 region gene products in infected cattle. (2/350)

Current immuno-diagnostic tests for the detection of Mycobacterium bovis infection in cattle rely on the use of tuberculin PPD as antigens. However, the use of a cattle vaccine is effectively prohibited because BCG, the only potentially available cattle TB vaccine, compromises the current tuberculin test. The main objective of this study was to identify specific antigens, which could increase the test sensitivity to levels achieved with tuberculin. Our approach utilized the availability of the genome sequences of Mycobacterium tuberculosis and BCG by applying principles of comparative genomics to the identification of species-specific antigens. Eight open-reading frames (Rv3871 to Rv3878) encoding for putative antigens in the RD1 region of the M. tuberculosis genome, which is deleted in all strains of BCG, were selected and screened in the form of pools of synthetic peptides for immunological reactivity (antigen induced proliferation and IFN-gamma secretion) with peripheral blood mononuclear cells from cattle experimentally infected with M. bovis. Our results confirm the immunodominant role of two RD1 region products, CFP-10 (Rv3874) and ESAT-6 (Rv3875). In addition, we were able to identify 3 more antigens (Rv3871, Rv3872 and Rv3873), which induced immunological reactivity in PBMC from more than 50%M. bovis of infected cattle. (+info)

Production of avirulent mutants of Mycobacterium bovis with vaccine properties by the use of illegitimate recombination and screening of stationary-phase cultures. (3/350)

A better tuberculosis vaccine is urgently required to control the continuing epidemic. Molecular techniques are now available to produce a better live vaccine than BCG by producing avirulent strains of the Mycobacterium tuberculosis complex with known gene deletions. In this study, 1000 illegitimate recombinants of Mycobacterium bovis were produced by illegitimate recombination with fragments of mycobacterial DNA containing a kanamycin resistance gene. Eight recombinant strains were selected on the basis of their inability to grow when stationary-phase cultures were inoculated into minimal medium. Five of these recombinants were found to be avirulent when inoculated into guinea pigs. Two of the avirulent recombinants produced vaccine efficacy comparable to BCG against an aerosol challenge in guinea pigs with M. bovis. One of these recombinants had an inactivated glnA2 gene encoding a putative glutamine synthetase. Transcriptional analysis showed that inactivation of glnA2 did not affect expression of the downstream glnE gene. The other recombinant had a block of 12 genes deleted, including the sigma factor gene sigG. Two avirulent recombinants with an inactivated pckA gene, encoding phosphoenolpyruvate carboxykinase which catalyses the first step of gluconeogenesis, induced poor protection against tuberculosis. It is clear that live avirulent strains of the M. tuberculosis complex vary widely in their ability as vaccines to protect against tuberculosis. Improved models may be required to more clearly determine the difference in protective effect between BCG and potential new tuberculosis vaccines. (+info)

Identification of novel Mycobacterium tuberculosis antigens with potential as diagnostic reagents or subunit vaccine candidates by comparative genomics. (4/350)

An independent review for the British government has concluded that the development of a cattle vaccine against Mycobacterium bovis holds the best long-term prospects for tuberculosis control in British herds. The development of complementary diagnostic tests to differentiate between vaccinated and infected animals is necessary to allow the continuation of test-and-slaughter-based control policies alongside vaccination. Vaccination with M. bovis bacillus Calmette-Guerin (BCG), the only available vaccine, results in tuberculin purified protein derivative sensitivity and has shown varying vaccine efficacies in cattle. Thus, identification of more-specific reagents to distinguish between vaccination and infection, as well as the identification of subunit vaccine candidates for improved tuberculosis vaccines, is a research priority. In the present study, we applied comparative genomics to identify M. bovis-Mycobacterium tuberculosis antigens whose genes had been deleted in BCG Pasteur. In total, 13 open reading frames (ORFs) from the RD1, RD2, and RD14 regions of the M. tuberculosis genome were selected. Pools of overlapping peptides spanning these ORFs were tested in M. bovis-infected (n = 22), BCG-vaccinated (n = 6), and unvaccinated (n = 10) control cattle. All were recognized in infected cattle, with responder frequencies varying between 16 and 86%. In particular, eight highly immunogenic antigens were identified whose potentials as diagnostic reagents or as subunit vaccines warrant further study (Rv1983, Rv1986, Rv3872, Rv3873, Rv3878, Rv3879c, Rv1979c, and Rv1769). (+info)

Mapping of murine Th1 helper T-Cell epitopes of mycolyl transferases Ag85A, Ag85B, and Ag85C from Mycobacterium tuberculosis. (5/350)

BALB/c (H-2(d)) and C57BL/6 (H-2(b)) mice were infected intravenously with Mycobacterium tuberculosis H37Rv or vaccinated intramuscularly with plasmid DNA encoding each of the three mycolyl transferases Ag85A, Ag85B, and Ag85C from M. tuberculosis. Th1-type spleen cell cytokine secretion of interleukin-2 (IL-2) and gamma interferon (IFN-gamma) was analyzed in response to purified Ag85 components and synthetic overlapping peptides covering the three mature sequences. Tuberculosis-infected C57BL/6 mice reacted strongly to some peptides from Ag85A and Ag85B but not from Ag85C, whereas tuberculosis-infected BALB/c mice reacted only to peptides from Ag85A. In contrast, spleen cells from both mouse strains produced elevated levels of IL-2 and IFN-gamma following vaccination with Ag85A, Ag85B, and Ag85C DNA in response to peptides of the three Ag85 proteins, and the epitope repertoire was broader than in infected mice. Despite pronounced sequence homology, a number of immunodominant regions contained component specific epitopes. Thus, BALB/c mice vaccinated with all three Ag85 genes reacted against the same amino acid region, 101 to 120, that was also immunodominant for Ag85A in M. bovis BCG-vaccinated and tuberculosis-infected H-2(d) haplotype mice, but responses were completely component specific. In C57BL/6 mice, a cross-reactive T-cell response was detected against two carboxy-terminal peptides spanning amino acids 241 to 260 and 261 to 280 of Ag85A and Ag85B. These regions were not recognized at all in C57BL/6 mice vaccinated with Ag85C DNA. Our results underline the need for comparative analysis of all three Ag85 components in future vaccination studies. (+info)

Enhanced immunogenicity to Mycobacterium tuberculosis by vaccination with an alphavirus plasmid replicon expressing antigen 85A. (6/350)

The immunogenicity of a plasmid DNA vaccine incorporating Sindbis virus RNA replicase functions (pSINCP) and expressing antigen 85A (Ag85A) from Mycobacterium tuberculosis was compared with a conventional plasmid DNA vector encoding Ag85A. pSINCP-85A was highly immunogenic in mice and gave enhanced long-term protection against M. tuberculosis compared with the conventional vector. (+info)

Cutting edge: Mycobacterium tuberculosis blocks Ca2+ signaling and phagosome maturation in human macrophages via specific inhibition of sphingosine kinase. (7/350)

One-third of the world's population is infected with Mycobacterium tuberculosis (Mtb), and three million people die of tuberculosis each year. Following its ingestion by macrophages (MPs), Mtb inhibits the maturation of its phagosome, preventing progression to a bactericidal phagolysosome. Phagocytosis of Mtb is uncoupled from the elevation in MP cytosolic Ca(2+) that normally accompanies microbial ingestion, resulting in inhibition of phagosome-lysosome fusion and increased intracellular viability. This study demonstrates that the mechanism responsible for this failure of Ca(2+)-dependent phagosome maturation involves mycobacterial inhibition of MP sphingosine kinase. Thus, inhibition of sphingosine kinase directly contributes to survival of Mtb within human MPs and represents a novel molecular mechanism of pathogenesis. (+info)

The Apa protein of Mycobacterium tuberculosis stimulates gamma interferon-secreting CD4+ and CD8+ T cells from purified protein derivative-positive individuals and affords protection in a guinea pig model. (8/350)

The search to identify Mycobacterium tuberculosis antigens capable of conferring protective immunity against tuberculosis has received a boost owing to the resurgence of tuberculosis over the past two decades. It has long been recognized that lymphoid cells are required for protection against M. tuberculosis. While traditionally the CD4(+) populations of T cells were believed to predominantly serve this protective function, a pivotal role for CD8(+) T cells in this task has been increasingly appreciated. We show that the 50- to 55-kDa Apa protein, specified by the Rv1860 gene of M. tuberculosis, can elicit both lymphoproliferative response and gamma interferon (IFN-gamma) production from peripheral blood mononuclear cells (PBMC) of purified protein derivative (PPD)-positive individuals, with significant differences recorded in the levels of responsiveness between PPD-positive healthy controls and pulmonary tuberculosis patients. Flow cytometric analysis of whole blood stimulated with the recombinant Apa protein revealed a sizeable proportion of CD8(+) T cells in addition to CD4(+) T cells contributing to IFN-gamma secretion. PBMC responding to the Apa protein produced no interleukin-4, revealing a Th1 phenotype. A DNA vaccine and a poxvirus recombinant expressing the Apa protein were constructed and tested for their ability to protect immunized guinea pigs against a challenge dose of virulent M. tuberculosis. Although the DNA vaccine afforded little protection, the poxvirus recombinant boost after DNA vaccine priming conferred a significant level of protective immunity, bringing about a considerable reduction in mycobacterial counts from the challenge bacilli in spleens of immunized guinea pigs, a result comparable to that achieved by BCG vaccination. (+info)

... tuberculosis-based vaccine to enter clinical trials". Vaccine. 31 (42): 4867-4873. doi:10.1016/j.vaccine.2013.07.051. PMID ... Tuberculosis (TB) vaccines are vaccinations intended for the prevention of tuberculosis. Immunotherapy as a defence against TB ... Today, the only effective tuberculosis vaccine in common use is the Bacillus Calmette-Guérin (BCG) vaccine, first used on ... MVA85A rBCG30 72F fusion protein MTBVAC New vaccines are being developed by the Tuberculosis Vaccine Initiative, including TBVI ...

https://en.wikipedia.org/wiki/Tuberculosis_vaccines

August 2006). "Early clinical trials with a new tuberculosis vaccine, MVA85A, in tuberculosis-endemic countries: issues in ... Tuberculosis deaths per million persons in 2012 Tuberculosis deaths by region, 1990 to 2017. Tuberculosis has existed since ... Tuberculosis (TB) is an infectious disease usually caused by Mycobacterium tuberculosis (MTB) bacteria. Tuberculosis generally ... Tuberculosis at Curlie "Tuberculosis (TB)". Centers for Disease Control and Prevention (CDC). 24 October 2018. "Tuberculosis ( ...

https://en.wikipedia.org/wiki/Tuberculosis

Advisory Board on Global Drug Policy Open Society Foundations (OSF). Board Tuberculosis Vaccine Initiative (TBVI). Official ... Member of Advisory Board on Global Drug Policy Tuberculosis Vaccine Initiative (TBVI), Member of the Board UN Press Release " ... From February 2007 to March 2012 he was director of The Global Fund to Fight AIDS, Tuberculosis and Malaria. On July 20, 2012, ... From 2005 until 2006 Kazatchkine served The Global Fund to Fight AIDS, Tuberculosis and Malaria as a vice chair. He became the ...

https://en.wikipedia.org/wiki/Michel_Kazatchkine

Andersen P, Woodworth JS (August 2014). "Tuberculosis vaccines--rethinking the current paradigm". Trends in Immunology. 35 (8 ... The vaccine was further developed and manufactured by the Danish company Bavarian Nordic, resulting in the vaccine MVA-BN, ... "Monkeypox Update: FDA Authorizes Emergency Use of Jynneos Vaccine to Increase Vaccine Supply" (Press release). U.S. Food and ... 2020). "Deletion of Vaccinia Virus A40R Gene Improves the Immunogenicity of the HIV-1 Vaccine Candidate MVA-B". Vaccines. 8 (1 ...

https://en.wikipedia.org/wiki/Modified_vaccinia_Ankara

"Tuberculosis Vaccine Initiative". "International Union Against Tuberculosis and Lung Disease - Tuberculosis". "World Health ... Save Lives" Epidemiology of tuberculosis The Global Fund to Fight AIDS, Tuberculosis and Malaria "Global Tuberculosis Report" ( ... Tuberculosis: a killer that can't be kept behind bars, ICRC News release, 22 March 2010 Tuberculosis: stopping a killer that ... Tuberculosis is a common ailment that affects the lungs and is damaging.Tuberculosis: The Greatest Story Never Told. ...

https://en.wikipedia.org/wiki/World_Tuberculosis_Day

"Tuberculosis vaccine hopes dashed". BBC News. Retrieved 4 February 2013. "Effects of MVA85A vaccine on tuberculosis challenge ... is a vaccine against tuberculosis developed by researchers led by Professor Helen McShane at Oxford University. This vaccine ... "Early clinical trials with a new tuberculosis vaccine, MVA85A, in tuberculosis-endemic countries: issues in study design". ... 2008). "Safety and immunogenicity of a new tuberculosis vaccine, MVA85A, in healthy adults in South Africa". J Infect Dis. 198 ...

https://en.wikipedia.org/wiki/MVA85A

Because of this, it is primarily used in high tuberculosis incidence regions, and is not a recommended vaccine in the United ... TB database: an integrated platform for Tuberculosis research Photoblog about Tuberculosis "Mycobacterium tuberculosis". NCBI ... "Tuberculosis vaccine drawing attention in fight against coronavirus". Kyodo News+. Wikimedia Commons has media related to ... The BCG, according to an article of the Kyodo News (April 14, 2020) titled "Tuberculosis vaccine drawing attention in fight ...

https://en.wikipedia.org/wiki/Mycobacterium_tuberculosis

Vaccines are being researched for AIDS and tuberculosis. Genes associated with type 1 diabetes and certain types of cancer have ...

https://en.wikipedia.org/wiki/Immortality

Tuberculosis Vaccine Initiative (TBVI), member. UNICEF/UNDP/World Bank/ WHO Special Programme for Research and Training in ... immune response against Mycobacterium tuberculosis and cancer immunotherapy. Professor Dieli has been involved in over 150 ...

https://en.wikipedia.org/wiki/Francesco_Dieli

Anthrax vaccine Cholera vaccine Plague vaccine Salmonella vaccine Tuberculosis vaccine Typhoid vaccine Live attenuated ... vaccine Polio vaccine Rotavirus vaccine Rubella vaccine Smallpox vaccine Varicella vaccine Yellow fever vaccine Zoster/shingles ... mumps and rubella vaccine, varicella vaccine, yellow fever vaccine) Intradermal (e.g. tuberculosis vaccine, smallpox vaccine) ... oral polio vaccine, recombinant live attenuated cholera vaccine, oral typhoid vaccine, oral rotavirus vaccine) Oral vaccines or ...

https://en.wikipedia.org/wiki/Attenuated_vaccine

It was formed in 1954 to oppose tuberculosis vaccines. The organization denies the benefits of vaccinations while promoting ... is a French anti-vaccine advocacy organization which opposes all government vaccine requirements. ...

https://en.wikipedia.org/wiki/National_League_for_Liberty_in_Vaccination

"Drying a tuberculosis vaccine without freezing". Proceedings of the National Academy of Sciences. 104 (8): 2591-2505. Bibcode: ... Edwards designs inhalable medicines, vaccines and victuals. In 2001, Edwards was elected a member of the National Academy of ... Bradt, Steve (13 March 2008). "Inhaled TB vaccine more effective than traditional shot". The Harvard Gazette. Retrieved 23 ... such as tuberculosis. In 2020, Edwards founded the company Sensory Cloud. Sensory Cloud released a nasal inhalable product ...

https://en.wikipedia.org/wiki/David_Edwards_(engineer)

"Gates Foundation Commits $82.9 Million to Develop New Tuberculosis Vaccines". February 12, 2004. Archived from the original on ... Aeras Global TB Vaccine Foundation: The foundation gave the Aeras Global TB Vaccine Foundation more than $280 million to ... Children's Vaccine Program: The Children's Vaccine Program, run by the Program for Appropriate Technology in Health (PATH), ... The GAVI vaccine alliance: The foundation gave the GAVI Alliance (formerly the "Global Alliance for Vaccines and Immunization ...

https://en.wikipedia.org/wiki/Bill_&_Melinda_Gates_Foundation

It is similar to the vaccines for tuberculosis and rubella. "How ICAR's new vaccine against Lumpy Skin Disease, the viral ... v t e (Articles with short description, Short description matches Wikidata, Animal vaccines, Live vaccines, Bovine health, All ... "Indigenous vaccine for lumpy skin disease ready, says Modi". The Tribune. Retrieved 2022-10-09. "Lumpy skin disease has not ... Lumpi-ProVacInd is a live attenuated vaccine for cattle, made by two institutes of Indian Council of Agricultural Research for ...

https://en.wikipedia.org/wiki/Lumpi-ProVacInd

His vaccine against tuberculosis is currently in phase III clinical trial assessment. A phase III vaccine trial to test ... Since 2018 he is member of the Governance Board of the TuBerculosis Vaccine Initiative (TBVI) [8]. Kaufmann headed a team that ... Gilla Kaplan, Ph.D. (2005-10-13). "Rational Vaccine Development - A New Trend in Tuberculosis Control". New England Journal of ... Insciences "Clinical trial for new tuberculosis vaccine". Max Planck Society. 2008-09-11. Retrieved 2010-06-19. ...

https://en.wikipedia.org/wiki/Stefan_H._E._Kaufmann

A 2020 Vision for vaccines against HIV, tuberculosis and malaria. Nature 473: 463. He Y, Xiang Z, Mobley H. Vaxign: the first ... Later, the vaccine was proven to be safe and effective in adult humans. During the development of the MenB vaccine, scientists ... A Streptococcus and B Streptococcus vaccines were two of the first Reverse Vaccines created. Because those bacterial strains ... Vaccine Design: Methods and Protocols: Volume 1: Vaccines for Human Diseases, New York, NY: Springer Publishing; Humana Press, ...

https://en.wikipedia.org/wiki/Reverse_vaccinology

He would later develop vaccines for tetanus, typhoid, tuberculosis and rabies. Also nominated were José Gómez Ocaña and August ... Others were on the verge of being nominated, such as Jaime Ferrán y Clúa, discoverer of the cholera vaccine, which put an end ... with the aim of bringing the smallpox vaccine to all continents, a disease that was causing thousands of deaths of children ...

https://en.wikipedia.org/wiki/Science_and_technology_in_Spain

"JRF Vacancy in Project on Development of Vaccines for M. tuberculosis". Rasayanika. 2018-05-13. Retrieved 2018-05-13. "On ... He has undertaken vaccine development projects as the principal investigator. His studies have been documented by way of a ... "Vaccine and Infectious Disease Research Center (VIDRC)". thsti.res.in. 2018-05-13. Retrieved 2018-05-13. (Articles with hCards ... Known for his studies on the pathogenesis of Mycobacterium tuberculosis, he is a former research fellow of the National ...

https://en.wikipedia.org/wiki/Ramandeep_Singh_(medical_scientist)

The BCG vaccine for tuberculosis is first developed. Richard Oldham argues that the Earth has a molten interior. Construction ...

https://en.wikipedia.org/wiki/1906

He worked on vaccine therapy, tuberculosis and pneumonia. At the outbreak of the First World War he was appointed as a captain ...

https://en.wikipedia.org/wiki/Leonard_Colebrook

"Bacille de Calmette-Guérin, or BCG Vaccine for Tuberculosis". ActiveHistory.ca. 2015-03-31. Archived from the original on 2018- ... Tuberculosis moved more slowly, but by 1950, one in five Inuit were infected. Mortality rates in the 1930s and 1940s rose ... Although treatment for tuberculosis in non-Indigenous patients improved during the 1940s and 1950s, these innovations were not ... "Tuberculosis in Inuit Nunangat". University of Alberta Faculty of Law Blog. Archived from the original on 2018-11-03. Retrieved ...

https://en.wikipedia.org/wiki/Indian_hospital

... is a candidate tuberculosis vaccine created by Statens Serum Institut (SSI). The 72F fusion protein ... v t e (Tuberculosis vaccines, Protein subunit vaccines, All stub articles, Immunology stubs). ... vaccination strategies against AIDS and tuberculosis". Nature Medicine. 11 (4 suppl): S33-S44. doi:10.1038/nm1221. PMC 7095892 ... is composed of the Rv0125 and Rv1196 proteins derived from Mycobacterium tuberculosis. Phase I clinical trials were completed ...

https://en.wikipedia.org/wiki/72F_fusion_protein_vaccine

Sendai virus is used as a backbone for vaccine development against Mycobacterium tuberculosis that causes tuberculosis, against ... SeV is currently used in preclinical studies as a backbone vector for vaccine against tuberculosis. Mucosal vaccination with ... December 2019). "Heterologous prime-boost vaccination against tuberculosis with recombinant Sendai virus and DNA vaccines". ... is engaged in development of the vaccine for COVID-19 prevention. SeV serves as a vaccine backbone vector in the project. SeV ...

https://en.wikipedia.org/wiki/Murine_respirovirus

Bacillus Calmette-Guérin (BCG) vaccine is a vaccine primarily used against tuberculosis (TB). It is named after its inventors ... It remains the only vaccine licensed against tuberculosis, which is an ongoing pandemic. Tuberculosis elimination is a goal of ... The main use of BCG is for vaccination against tuberculosis. BCG vaccine can be administered after birth intradermally. BCG ... Previously, the vaccine was also given at ages 8 and 15, although this is no longer common practice. Philippines: BCG vaccine ...

https://en.wikipedia.org/wiki/BCG_vaccine

Her dissertation was titled Progress towards development of new diagnostic tests and vaccines for bovine tuberculosis. Bosio's ... Mans, Catharine Ann (1998). Progress towards development of new diagnostic tests and vaccines for bovine tuberculosis (Thesis ... Bosio researches innate immunity to F. tularensis, vaccine development for pneumonic tularemia, and modulation of human cells ... studying innate immunity to Mycobacterium tuberculosis, Francisella tularensis, Marburg virus, and Zaire ebolavirus. Bosio was ...

https://en.wikipedia.org/wiki/Catharine_Mans_Bosio

... were enrolled in a trial to test the tuberculosis vaccine. In both the control and treatment groups nearly a fifth died from ... tuberculosis, and the Qu'Appelle BCG Vaccine Trial". Canadian Bulletin of Medical History. 15 (2): 277-295. doi:10.3138/cbmh. ... Many Nigerians mistrust the use of medical vaccines and also refuse to participate in medical trials. In 1994 United States ...

https://en.wikipedia.org/wiki/Unethical_human_experimentation

... and efficacy testing of tuberculosis vaccines, for which children were infected with tuberculosis pathogens. Many patients who ...

https://en.wikipedia.org/wiki/Am_Spiegelgrund_clinic

He researched aerosolised vaccines for tuberculosis and graduated with a bachelor's degree in 2010. During his time at Harvard ...

https://en.wikipedia.org/wiki/David_Moinina_Sengeh

Tuberculosis vaccine by Albert Calmette and Camille Guérin in 1921 (BCG). Antipsychotics in 1952 by Henri Laborit ( ... Rabies vaccine by Louis Pasteur and Émile Roux in 1885. Antibiotics by Louis Pasteur and Jean Paul Vuillemin (by means of ... of the BCG vaccine: safety, efficacy, proof, and standards, 1921-1933". Stud Hist Philos Biol Biomed Sci. 36 (4): 696-721. doi: ...

https://en.wikipedia.org/wiki/List_of_French_inventions_and_discoveries

With the development of antibiotics and vaccines for tuberculosis, the need for a sanatorium diminished. The last patient was ... The Saskatoon Sanatorium was a tuberculosis sanatorium established in 1925 by the Saskatchewan Anti-Tuberculosis League as the ... The Saskatchewan Anti-Tuberculosis League evolved into The Lung Association of Saskatchewan and focused on other respiratory ... "Tuberculosis". University of Saskatchewan. Retrieved 2011-02-20. "The Lung Association of Saskatchewan 100-year Timeline". The ...

https://en.wikipedia.org/wiki/Saskatoon_Sanatorium

... vaccine available small pox bubonic plague: slim non-nil risk pneumonic plague: 1910-11 Manchurian plague tuberculosis ... vaccine available mumps: vaccine available chicken pox: ...

https://en.wikipedia.org/wiki/Human-to-human_transmission

While the tuberculosis rate is decreasing in the rest of the world, it is increasing by rate of 6 percent per year in Sub- ... Malaria vaccines are an area of intensive research. Intestinal parasites are extremely prevalent in tropical areas. These ... Tuberculosis is the leading cause of death around the world for an infectious disease. This disease is especially prevalent in ... Tuberculosis: Commentary on a Reemergent Killer. Barry R. Bloom and Christopher J. L. Murray. Centers for Disease Control and ...

https://en.wikipedia.org/wiki/Diseases_of_poverty

Leslie Collier, virologist who helped to create the first heat stable smallpox vaccine key in the eventual eradication of the ... physician and expert on tuberculosis "History of UCL Medical School". UCL. Retrieved 12 April 2014. "Royal Free Association - ... pathologist whose research contributed to the development of the polio and measles vaccines Ben Goldacre, academic and science ...

https://en.wikipedia.org/wiki/UCL_Medical_School

Pai's work is around global health, specifically advocacy for better treatment for tuberculosis with a focus on South Africa ... Valentine, Ashish (2021-12-09). "Fix the global vaccine rollout or face even worse COVID variants, experts warn". NPR. ... Jennifer Furin; Helen Cox; Madhukar Pai (20 March 2019). "Tuberculosis". The Lancet. 393 (10181): 1642-1656. doi:10.1016/S0140- ... Tuberculosis, Health equity, Year of birth missing (living people), Living people, Decolonization, University of California, ...

https://en.wikipedia.org/wiki/Madhukar_Pai

... investing in vaccine and microbicide research; eliminating school fees for primary education; using microcredit money pots for ... Tuberculosis and Malaria through donations from private-sector organizations that profit from Africa (e.g. pharmaceutical ...

https://en.wikipedia.org/wiki/Race_Against_Time:_Searching_for_Hope_in_AIDS-Ravaged_Africa

Rigby, Wendy (21 August 2017). "San Antonio Scientist Wins Big Grant To Develop Novel Tuberculosis Vaccine". Texas Public Radio ... Research on preventing and treating Mycobacterium tuberculosis with particular emphasis on TB and aging, diabetes, and vaccine ... Developed vaccines, antibodies and antitoxins for deadly agents of bioterrorism such as Ebola, botulinum neurotoxins, and ... Developing vaccine strategies for Ebola, HIV, Lassa virus, West Nile virus, Japanese encephalitis viruses, and herpes. ...

https://en.wikipedia.org/wiki/Texas_Biomedical_Research_Institute

In July 2021, she joined the Multilateral Leaders Task Force on COVID-19 Vaccines, Therapeutics, and Diagnostics for Developing ... Tuberculosis and Malaria, press release of 12 February 2007. GFI Advisory Board Member, Ngozi Okonjo-Iweala, to Be Nominated ... "WTO Director-General Ngozi Okonjo-Iweala Discusses Vaccines". The World: Public Radio. Retrieved 24 June 2021. "Prince William ... Joint Statement of the Multilateral Leaders Task Force on COVID-19 Vaccines, Therapeutics, and Diagnostics for Developing ...

https://en.wikipedia.org/wiki/Ngozi_Okonjo-Iweala

Immunization, Vaccines and Biologicals: The Expanded Programme on Immunization. World Health Organization. 2015. Retrieved ... The International Journal of Tuberculosis and Lung Disease. 2: 54-58. Henderson, DA (1998), "The siren song of eradication", ... This success gave impetus to WHO's global Expanded Program on Immunization, which targeted other vaccine-preventable diseases, ... "jThe Albert B. Sabin Gold Medal Award". Sabin Vaccine Institute. 2014. Retrieved August 24, 2015. Anniversary Discourse & ...

https://en.wikipedia.org/wiki/Donald_Henderson

"2009 Hope is a Vaccine Award Ceremony". Gaia Vaccine Foundation. Retrieved 2020-07-16. (CS1 maint: others, CS1 maint: url- ... Sequella focuses on clinical stage antibiotic development, in particular against Mycobacterium tuberculosis (TB). Nacy was the ... Hope is a Vaccine, by the Global Alliance for Immunization against Aids (GAIA) for her work to create new drugs for TB. Nacy is ...

https://en.wikipedia.org/wiki/Carol_A._Nacy

... diarrheal diseases vaccine preventable diseases such as tuberculosis nutritional deficiencies upper respiratory tract ...

https://en.wikipedia.org/wiki/Public_health_problems_in_the_Aral_Sea_region

This was the result of a belief that infectious diseases had largely been vanquished by antibiotics and vaccines, and that ... As of 2020 there are nine quarantinable diseases: Cholera Diphtheria Infectious tuberculosis Plague Smallpox Yellow fever Viral ... that could cause a pandemic Several vaccine-controllable diseases are not on the list, including measles, mumps, rubella, and ...

https://en.wikipedia.org/wiki/Division_of_Global_Migration_and_Quarantine

In 1953, she came to work in the Department of Microbiology with the hope of developing an improved vaccine for tuberculosis. ... Instead, Hsiung secured a job testing bacterial and viral vaccines for use in animals at the Epizootic Prevention Bureau of the ... where she developed the first vaccine for infectious bronchitis virus in chickens. ...

https://en.wikipedia.org/wiki/G._D._Hsiung

A tuberculosis outbreak infecting 14 children and caused by an infected teacher at a nursery school in Garden City (DFP-4); A ... report by researchers at Wayne State University that they had developed a cancer vaccine (APS-8); and An April boycott by ...

https://en.wikipedia.org/wiki/1966_in_Michigan

... that makes a patient bruise or bleed easily Recent transfusion of blood or blood products Tuberculosis Receiving other vaccines ... standalone vaccine) Measles and rubella combined vaccine (MR vaccine) Mumps, measles and rubella combined vaccine (MMR vaccine ... a combination with the rubella vaccine and mumps vaccine) or the MMRV vaccine (a combination of MMR with the chickenpox vaccine ... MMRV vaccine) Most health insurance plans in the United States cover the cost of vaccines, and Vaccines for Children Program ...

https://en.wikipedia.org/wiki/Measles_vaccine

"Paralysis Vaccine is 85% Successful". The New York Times. January 25, 1935. "A Good School Program". The New York Times. ... In 1951 the Foundation funded research that led to the development of isoniazid, the first anti-tuberculosis drug. In 1954 the ... 3,000 given by the New York Foundation to the New York City Bureau of Laboratories led to the development of a vaccine ... National Tuberculosis Association 1922: Peabody College for Teachers 1922: Tuskegee Normal and Industrial Institute 1923: Fisk ...

https://en.wikipedia.org/wiki/New_York_Foundation

Vaccines that are on the existing immunization schedule of the government are free of charge. According to the recent 'WHO ... Vaccination Unit Vector-borne and Zoonotic Diseases Unit Tuberculosis Unit Microbiology Laboratories Unit Tobacco and other ... "WHO vaccine-preventable diseases: monitoring system. 2017 global summary". apps.who.int. "WHO-Diabetes Country Profiles 2016" ( ... On 2 November, the Turkish Health Ministry began administering vaccines against H1N1 influenza, starting with health workers. ...

https://en.wikipedia.org/wiki/Health_in_Turkey

"Rules for flying with tuberculosis disputed". The Washington Times. Retrieved 2020-09-09. "BCG vaccine prevents TB infection in ... He leads the E-DETECT TB project in Europe for the early detection of tuberculosis, which in Romania has led to the expansion ... He served as the chair of the WHO Strategic and Technical Advisory Group for Tuberculosis (STAG TB) from 2016 to 2019 and co- ... "Despite progress, tuberculosis persists in West European cities". Reuters. 2014-03-07. Retrieved 2020-09-09. " ...

https://en.wikipedia.org/wiki/Ibrahim_Abubakar

The WHO's one-metre recommendation stems from research into droplet-based transmission of tuberculosis by William F. Wells, ... Smith, Richard (2007-06-30). "Social measures may control pandemic flu better than drugs and vaccines". British Medical Journal ... Updated 29 April 2020 Gammon, Katharine (2020-04-16). "How the Anti-Vaccine Community Is Responding to Covid-19". Undark. ... Riley, R. L. (1983-01-22). "The contagiosity of tuberculosis". Schweizerische Medizinische Wochenschrift. 113 (3): 75-79. ISSN ...

https://en.wikipedia.org/wiki/Social_distancing

"History of Vaccines - A Vaccine History Project of The College of Physicians of Philadelphia". Archived from the original on 19 ... Notable among these was a 75% decline in deaths due to tuberculosis. During the years 1940-1955, the rate of decline in the U.S ... In 1885, Louis Pasteur and Pierre Paul Émile Roux created the first rabies vaccine. The first diphtheria vaccines were produced ... The vaccine process was never patented but was instead given to pharmaceutical companies to manufacture as a low-cost generic. ...

https://en.wikipedia.org/wiki/Pharmaceutical_industry

However, Koch used tuberculin as a vaccine. This caused serious reactions and deaths in individuals whose latent tuberculosis ... Vaccine hesitancy is a delay in acceptance, or refusal, of vaccines despite the availability of vaccine services. The term ... when the routine vaccine schedule could contain more than 3,000 antigens (in a single shot of DTP vaccine). The vaccine ... the more vaccines offered, the higher the likelihood of vaccine deferral). The use of combination vaccines to protect against ...

https://en.wikipedia.org/wiki/Vaccine_hesitancy

The Cuban vaccine is used throughout Latin America. After outbreaks of meningitis B in the United States, the U.S. Treasury ... such as tuberculosis, hepatitis and chicken pox. Other campaigns included a program to reduce the infant mortality rate in 1970 ... When polio is eliminated in a country, they must stop using the live vaccine, because it has a slight risk of reverting to the ... "Iran-Cuba vaccine enters phase three clinical trials". Tehran Times. 26 April 2021. Retrieved 7 January 2022. "ABDALA Clinical ...

https://en.wikipedia.org/wiki/Healthcare_in_Cuba

... the experiences of other countries with this vaccine as well as Colombia's own experience with vaccines from other ... tuberculosis, obesity and others were included in Stage 3 along with the population aged 50-59. Furthermore, Stage 4 was ... to continue administering the vaccine, confirming that the vaccine's benefits still outweighed its potential risks. On 15 June ... The first vaccine in Colombia was given to a nurse on 17 February 2021. Over 70 percent of the population is fully vaccinated. ...

https://en.wikipedia.org/wiki/COVID-19_vaccination_in_Colombia

His research made the development of a vaccine against papilloma possible, which will drastically reduce cervical cancer in ... He became famous for isolating Bacillus anthracis (1877), the tuberculosis bacillus (1882), and Vibrio cholerae (1883), and for ...

https://en.wikipedia.org/wiki/List_of_German_inventors_and_discoverers

A murderer poisons bank employees by pretending to be a government official administering a dysentery vaccine. Gradually, ... and tuberculosis using live human subjects; for this purpose, a prison was constructed to contain around three to four hundred ...

https://en.wikipedia.org/wiki/Unit_731

World Bank (IX). "Incidence of tuberculosis (per 100,000 people), graph". Archived from the original on 9 April 2016. Retrieved ... to Rwanda are highly recommended to take preventive malaria medication as well as make sure they are up to date with vaccines ... and incidence of tuberculosis has dropped from 101 to 69 per 100,000 people. The country's progress in healthcare has been ...

https://en.wikipedia.org/wiki/Rwanda

... tuberculosis, immunization and tobacco control. Ministry of Healthcare Azerbaijan cooperates with the member countries of OIC ... ministry organized an immunization campaign and vaccine program with support of foundation. As a result, indications of the ...

https://en.wikipedia.org/wiki/Ministry_of_Healthcare_(Azerbaijan)

Subunit vaccines, live attenuated vaccines. There are also new vaccine technologies such as viral vector vaccines and DNA/RNA ... Various forms of the common cold and tuberculosis also are adaptations of strains originating in other species.[citation needed ... There are a variety of vaccine varieties, including traditional inactivated pathogen vaccines, ... "Why vaccines matter in the fight against zoonotic diseases". www.thepigsite.com. Retrieved 7 June 2022. Information in this ...

https://en.wikipedia.org/wiki/Zoonosis

The first randomised curative trial was carried out at the MRC Tuberculosis Research Unit by Sir Geoffrey Marshall (1887-1982 ... Conducting clinical trials of vaccines during epidemics and pandemics is subject to ethical concerns. For diseases with high ... Similar experiments performed by Edward Jenner over his smallpox vaccine were equally conceptually flawed. The first proper ... These approaches may include drugs, vitamins or other micronutrients, vaccines, or lifestyle changes. Screening trials test for ...

https://en.wikipedia.org/wiki/Clinical_trial

WHO preferred product characteristics for new tuberculosis vaccines World Health Organization (‎World Health Organization, ... Preferred product characteristics for therapeutic vaccines to improve tuberculosis treatment outcomes World Health ... Estrategia mundial de investigación e innovación contra la tuberculosis Organización Mundial de la Salud (‎Organización ... Proceedings of the fourth Global Vaccine Research Forum World Health Organization (‎World Health OrganizationWorld Health ...

https://apps.who.int/iris/browse?authority=Tuberculosis+Vaccines&type=mesh

... status of TB vaccine development, preclinical obstacles for TB candidate vaccines, challenges in TB vaccine evaluation, ... Notice to Readers International Symposium on Tuberculosis Vaccine Development and Evaluation The 1998 International Symposium ... on Tuberculosis Vaccine Development and Evaluation will be held August 26-28, 1998, in San Francisco, California. The symposium ... Information on the symposium is available from CDCs National Vaccine Program Office, telephone (404) 639-4168. ...

https://www.cdc.gov/mmwr/preview/mmwrhtml/00053842.htm

https://extranet.who.int/iris/restricted/browse?authority=Tuberculosis+Vaccines&type=mesh

... more effective vaccines against TB (7,8). Vaccines currently under development include subunit vaccines (9), naked DNA vaccines ... Gates grant boosts tuberculosis vaccine research. US82.0 million dollars grant will double global spending on new tuberculosis ... Flow-diagram of preexposure tuberculosis (TB) vaccine model. States and processes that relate to the vaccine are shown in red. ... Flow-diagram of preexposure tuberculosis (TB) vaccine model. States and processes that relate to the vaccine are shown in red. ...

https://wwwnc.cdc.gov/eid/article/10/9/03-0921_article

A Joint Statement by the ACIP and the Advisory Committee for Elimination of Tuberculosis ... Use of BCG Vaccines in the Control of Tuberculosis: ... ACIP: Use of BCG Vaccines in the Control of Tuberculosis: A ... Trial of BCG vaccines in south India for tuberculosis prevention: tuberculosis prevention trial, Madras. Indian J Med Res 1980; ... Replaces previous recommendation on BCG vaccines (MMWR 1979;28:241-4). References. * Romanus V. Tuberculosis in Bacillus ...

https://wonder.cdc.gov/wonder/prevguid/p0000192/p0000192.asp

Tuberculosis vaccine candidates are entering clinical studies in areas where BCG fails. This is a high-risk strategy. We ... DOI: 10.1016/j.vaccine.2005.01.069 Abstract Tuberculosis vaccine candidates are entering clinical studies in areas where BCG ... Do successful tuberculosis vaccines need to be immunoregulatory rather than merely Th1-boosting? Vaccine. 2005 Mar 18;23(17-18 ... A successful vaccine, rather than driving a Th1 response, might need to suppress this pre-existing subversive Th2-like ...

https://pubmed.ncbi.nlm.nih.gov/15755581/

Thus, vaccination by RUTI® has potential for both the prophylaxis and immunotherapy of tuberculosis. ... based on fragmented cells of Mycobacterium tuberculosis, has been evaluated in respect to aerosol challenge with virulent ...

https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0020404

... provides only partial protection against both tuberculosis and leprosy, so a more potent vaccine is needed to combat both ... Worldwide there are approximately 233,000 new cases of leprosy per year, with nearly all of them occurring where tuberculosis ... The currently available century-old vaccine Bacille Calmette-Guerin, or BCG, ... New Vaccine Shows Promise as Stronger Weapon Against Tuberculosis and Leprosy. .social-ris-container { display: flex; justify- ...

https://www.infectioncontroltoday.com/view/new-vaccine-shows-promise-stronger-weapon-against-tuberculosis-and-leprosy

Thomas Evans on Developing tuberculosis vaccines - challenges and strategies 2, part of a collection of multimedia lectures. ... Developing tuberculosis vaccines - challenges and strategie… Developing tuberculosis vaccines - challenges and strategies 1 ... Other Talks in the Series: Vaccines. HIV vaccine development HIV vaccine development ... Developing tuberculosis vaccines - challenges and strategies 2. Part 2 of 2 *Part 1 of 2 ...

https://hstalks.com/t/3064/developing-tuberculosis-vaccines-challenges-and-st/

Study finds that a century-old tuberculosis vaccine could be used in the treatment and prevention of COVID-19. ... A group of researchers at Cedars-Sinai Medical Center in Los Angeles have found evidence that a tuberculosis vaccine has been ... Study finds that a century-old tuberculosis vaccine could be used in the treatment and prevention of COVID-19. ... The vaccine could be a potential bridge offering some benefit until a more effective and safer COVID-19 vaccine is made widely ...

https://www.contagionlive.com/view/tuberculosis-vaccine-could-play-role-in-covid-19-prevention

This website uses cookies to improve your experience while you navigate through the website. Out of these, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may affect your browsing experience ...

https://www.cmr.ro/anmdmr-informare-bcg-10-anti-tuberculosis-vaccine_4582/

Developing effective tuberculosis (TB) vaccines is a high priority. We use mathematical models to predict the potential public ... Title : Potential Public Health Impact of New Tuberculosis Vaccines Personal Author(s) : Ziv, Elad;Daley, Charles L.;Blower, ... Postexposure vaccines would initially have a substantially greater impact, compared to preexposure vaccines, on reducing the ... We show that preexposure vaccines would be almost twice as effective as postexposure vaccines in reducing the number of new ...

https://stacks.cdc.gov/view/cdc/14531

The Oxford/AstraZeneca COVID-19 vaccine * Development of the ChAdOx vaccine platform ...

https://www.jenner.ac.uk/publications/167566?8110e3ee-6d6c-11ed-855f-061b866677b4

This is a protection that we see with other vaccines. On all the so-called vaccines "living" (those inoculated with the still ... The study of the academy of sciences (PNAS) - American-British team - concludes that a vaccine even nonspecific "could have ... Not to mention the production of vaccines, abandoned by the last French producer, Sanofi. ... is currently developing a new vaccine, also live, against whooping cough: in the laboratory, vaccinated rats find themselves ...

https://rebelinkpress.com/the-bcg-vaccine-protects-well-beyond-tuberculosis/

Here we show that a live recombinant vaccine, rBCG30, which expresses large amounts of the Mycobacterium tuberculosis 30kDa ... it has potential as a vaccine against bovine tuberculosis in domesticated animals and in wild animal reservoirs. (c) 2005 ... is more efficacious against bovine tuberculosis than BCG in the highly demanding guinea pig model of pulmonary tuberculosis. ... A recombinant BCG vaccine overexpressing the identical M. bovis 30kDa protein, rBCG30Mb, also induced greater cell-mediated and ...

https://escholarship.org/uc/item/6p6663p1

cbs gene product [Mycobacterium tuberculosis H37Rv]. Sequence. MRIAQHISELIGGTPLVRLNSVVPDGAGTVAAKVEYLNPGGSSKDRIAVK. ...

https://webs.iiitd.edu.in/raghava/mtbveb/protein.php?gi=57116820

https://wwwnc-origin.cdc.gov/eid/article/10/9/03-0921_article

A Phase I, Open-Label Trial, Evaluating the Safety and Immunogenicity of Candidate Tuberculosis Vaccines AERAS-402 and MVA85A, ... A Phase I, Open-Label Trial, Evaluating the Safety and Immunogenicity of Candidate Tuberculosis Vaccines AERAS-402 and MVA85A, ... It takes a village: developing a vaccine * Oxford University Overseas Clinical Research Units: what do we do and why do we do ...

https://www.ndm.ox.ac.uk/publications/580273

Animal models of tuberculosis for vaccine development. Indian Journal of Medical Research. 2009 Jan; 129(1): 11-8. ... Animal models for testing different vaccine candidates have been developed since a long time for studying tuberculosis. Mice, ... Efforts should continue to develop a vaccine which can replace/outperform the presently available vaccine BCG. ... Each model has its own merits for studying human tuberculosis, and none completely mimics the human disease. Different animal ...

https://imsear.searo.who.int/handle/123456789/25478

Tuberculosis Vaccines [‎1]‎. United Nations [‎14]‎. Vital Statistics [‎2]‎. Water Supply [‎2]‎. ...

https://apps.who.int/iris/handle/10665/86419/browse?rpp=20&etal=-1&sort_by=-1&type=mesh&starts_with_previous=0&starts_with=Q&order=ASC

Tuberculosis Vaccine. Taking DHEA might reduce the effects of the tuberculosis vaccine. Do not take DHEA if you are receiving a ... tuberculosis vaccine.. Minor. Be watchful with this combination.. Estrogens. DHEA might increase estrogen levels in the body. ...

https://medlineplus.gov/druginfo/natural/331.html

Tuberculosis Research Office , International Tuberculosis Campaign.. Material type: Text; Format: print Publication details: ... Vaccination against tuberculosis : sixth report of the Expert Committee on Tuberculosis [meeting held in Copenhagen from 30 ... Results of search for ccl=su:{Tuberculosis} and su-to:BCG vaccine ... Métodos de control de la tuberculosis / A. Rouillon ... [et al.] by Rouillon, Annik , Perdrizet, R , Parrot, R , Waaler, H , ...

https://kohahq.searo.who.int/cgi-bin/koha/opac-search.pl?q=ccl=su%3A%7BTuberculosis%7D%20and%20su-to%3ABCG%20vaccine&sort_by=relevance_dsc&count=20&limit=su-to:BCG%20vaccine

A more effective vaccine is urgently needed. The immune response against tuberculosis relies, at least in part, on CD4+ T cells ... Protective vaccines require the induction of antigen-specific CD4+ T cells via mycobacterial peptides presented by MHC class-II ... Three antigens were expressed in viral vectors, and evaluated as vaccine candidates alone or in combination in a murine aerosol ... The only available vaccine, bacillus Calmette-Guérin (BCG), has variable efficacy throughout the world. ...

https://www.well.ox.ac.uk/publications/1081309?33a15b42-768c-11ed-857f-061b866677b4

First used 100 years ago, the BCG vaccine against the disease contains attenuated pathogens of cattle tuberculosis. "We know ... No other infectious disease has killed more people than tuberculosis. Currently, only one vaccine is available to prevent ... Especially infants and immunocompromised patients are therefore in urgent need for more effective tuberculosis vaccines. A ... 312 of them received VPM1002, and 104 received the BCG vaccine. As the study showed, VPM1002 triggered fewer vaccine-related ...

https://www.max-planck-innovation.com/max-planck-innovation/news/press-releases/press-release/tuberculosis-vaccine-passes-safety-test.html

... better drugs for tuberculosis, but we dont have an effective vaccine for tuberculosis. So, malaria vaccines, tuberculosis ... Theres already been criticism of the FDAs discussion of an annual COVID-19 vaccine. One criticism is that the COVID vaccines ... vaccine in addition to a systemic vaccine. Do you always wear a mask when you go out into the world? How do you evaluate the ... Yes, we certainly want next-generation vaccines - both vaccines that have a greater degree of breadth, namely covering multiple ...

http://www.medscape.com/viewarticle/987658

Vaccine strain. M_bovis_AF2122_97, M_bovis_BCG_str_Korea, M_bovis_BCG_str_Mexico, M_bovis_BCG_str_Pasteur_1173P2, M_bovis_BCG_ ... The is the epitope card with name of tuberculoid, vaccine and NTM strain sharing the epitope alongwith all its information ...

http://crdd.osdd.net/raghava/mtbveb/epitope.php?seq=CGAGKVLQT

You are here: Home > Tuberculosis Vaccines: Need and Challenges Tuberculosis Vaccines: Need and Challenges. Published by ... Posted in Featured, Infectious diseases Tagged Tuberculosis, Vaccines. 16 Responses. * Lisa Benson. March 24, 2015. at 2:46 am ... that the BCG vaccine has been useful in preventing the spread of tuberculosis. The BCG vaccine was also used to prevent any ... through the use of effective vaccines. The only tuberculosis vaccine currently available, Bacille Calmette-Guérin, or BCG for ...

https://immunitytales.com/tuberculosis-vaccines-need-and-challenges/

STRITUVAD project aims to develop in silico trials and computer simulations to test the efficacy of new tuberculosis therapies ... DEVELOPING IN SILICO TRIALS TO FIGHT TUBERCULOSIS. Tuberculosis is one of the worlds deadliest diseases: it infects one third ... There is a huge potential around the possibility to design therapeutic vaccines for Tuberculosis that work in conjunction with ... Last year over 1.6 million people worldwide died of Tuberculosis. We need better therapies, but the current process of ...

https://www.strituvad.eu/

Vaccination with the BCG vaccine is effective in reducing the incidence of TB meningitis and death in children under 5 years of ... Tuberculosis (TB) is caused by an infection with the bacteria Mycobacterium tuberculosis. In rarer cases, TB may be attributed ... Vaccine administration. BCG vaccine is administered via the intradermal route. Only healthcare providers trained in intradermal ... Materials in this section are updated as new information and vaccines become available. The Melbourne Vaccine Education Centre ...

https://mvec.mcri.edu.au/references/bcg-vaccine/

We used mathematical models to compare the potential public health impact of mass vaccination campaigns that used either pre- or postexposure vaccines. (cdc.gov)
Since 1979, when the last Immunization Practices Advisory Committee (ACIP) statement on vaccination with Bacillus of Calmette and Guerin (BCG*) was published, additional data have been published on the epidemiology of tuberculosis (TB) in the United States and on the efficacy of childhood BCG vaccines. (cdc.gov)
The findings of the study do not represent a view that the BCG vaccine will be more effective than a specific COVID-19 vaccination. (contagionlive.com)
And what these new Australian works show is the process: how the immunity of children evolves just after vaccination and provides protection against other germs (viruses, bacteria, fungi) other than tuberculosis. (rebelinkpress.com)
Vaccination of herds and/or wild animals that share their grazing land and serve as reservoirs of infection has been proposed as a strategy to combat bovine tuberculosis. (escholarship.org)
Mass BCG vaccination campaigns : 1948-1951 / reports prepared by the Tuberculosis Research Office, World Health Organization. (who.int)
This finding is important because local and regional reactions after vaccination are among the limitations of the BCG vaccine, Kaufmann points out. (max-planck-innovation.com)
Indeed, modeling studies published in 2009 show that tuberculosis cannot be eliminated without new vaccines and mass vaccination campaigns. (immunitytales.com)
Prevention through vaccination is expected to be the most cost-effective tool in the control and eradication of tuberculosis. (immunitytales.com)
Vaccination with the BCG vaccine is effective in reducing the incidence of TB meningitis and death in children less than 5 years of age in countries where TB is prevalent. (edu.au)
Immunogenicity was assessed in a subset of participants at day 7 and day 28 after the first and second vaccination, and M tuberculosis infection and disease were assessed at the end of the study. (ox.ac.uk)
Vaccines and high rates of vaccination have made these diseases much less common in the United States. (cdc.gov)
Previous work with small-animal laboratory models of tuberculosis has shown that vaccination strategies based on heterologous prime-boost protocols using Mycobacterium bovis bacillus Calmette-Guérin (BCG) to prime and modified vaccinia virus Ankara strain (MVA85A) or recombinant attenuated adenoviruses (Ad85A) expressing the mycobacterial antigen Ag85A to boost may increase the protective efficacy of BCG. (ox.ac.uk)
Analysis of vaccine-induced immunity identified memory responses measured by cultured enzyme-linked immunospot assay as well as in vitro interleukin-17 production as predictors of vaccination success, as both responses, measured before challenge, correlated positively with the degree of protection. (ox.ac.uk)
Therefore, this study provides evidence of improved protection against tuberculosis by viral booster vaccination in a natural target species and has prioritized potential correlates of vaccine efficacy for further evaluation. (ox.ac.uk)
MTBVAC is a highly promising vaccine candidate that has the potential to be used as an alternative to BCG vaccination in infants and for prevention of TB disease in adolescents and adults. (iavi.org)
12 October 2022, Damascus - With support from WHO, UNICEF and Gavi, the Vaccine Alliance, the Ministry of Health in Syria has launched a polio, measles and rubella vaccination campaign across the country. (who.int)
Since the licensing of the live attenuated rubella vaccine in the United States in 1969, a substantial increase has been noted in the vaccination coverage among school-aged children and the population immunity. (medscape.com)
Bacille Calmette-Guérin (BCG) vaccination at birth and antibody responses to childhood vaccines. (technet-21.org)
Tuberculosis remains one of the most important causes of human disease and death despite the introduction of vaccination in 1921 and chemotherapy in 1952. (edu.hk)
The vaccine scheduler table summarizes the current vaccination schedule for young children, adolescents, and adults for Tuberculosis. (who.int)
Live Attenuated Virus Vaccines This paper from Massachusetts found that vaccination with the tuberculosis BCG vaccine gave a 92% efficacy against COVID-19. (webfoot.com)
Lack of a timely receipt of vaccines can cause uncertain immune response and under-vaccination. (annalsofglobalhealth.org)
To identify the age of presentation for the birth dose vaccines, vaccine antigens received and factors associated with vaccination presentation by day one in Northern Nigeria. (annalsofglobalhealth.org)
Data was collected using a questionnaire including the socio-demographic, antenatal care (ANC), delivery details, birth dates, vaccination presentation and birth vaccine antigens received. (annalsofglobalhealth.org)
Furthermore, some babies do not get the required vaccines despite presenting for vaccination due to stockout. (annalsofglobalhealth.org)
Unfortunately, vaccination uptake remains low in developing countries with the highest burden of vaccine-preventable diseases. (annalsofglobalhealth.org)
Bacillus Calmette-Guérin (BCG) vaccines are given to more than 100 million children every year, but there is considerable debate regarding the effectiveness of BCG vaccination in preventing tuberculosis and death, particularly among older children and adults. (medscape.com)
BCG vaccination was protective against pulmonary tuberculosis (19% effectiveness), but this effect was only seen in children younger than 3 years (42% effectiveness) when stratified by age. (medscape.com)
Currently there is no vaccination for prevention of tuberculosis (TB). (wilkescounty.net)
Screening of priority populations for vaccination and most affected groups of people by hospitalizations related to vaccine-preventable diseases was highlighted. (bvsalud.org)
BCG vaccination is only recommended on the NHS for babies, children and adults under the age of 35 who are considered at risk of catching tuberculosis (TB). (havering.gov.uk)

However, the most effective type of vaccine to control TB epidemics in high-incidence countries, where prevalence of latent TB infection is high, is not apparent. (cdc.gov)
In a study published in the September issue of the peer-reviewed journal Infection and Immunity, the researchers found that rBCG30, a recombinant variant of BCG that overexpresses a highly abundant 30 kDa protein of the tuberculosis bacterium known as Antigen 85B, is superior to BCG in protecting against tuberculosis in animal models, and also cross protects against leprosy. (infectioncontroltoday.com)
Since the 1990s, the infection biologist and his team have been working on an improved next-generation vaccine, called VPM1002. (max-planck-innovation.com)
DNA vaccines on the mouse model with latent tuberculosis infection. (bvsalud.org)
About a quarter of the world's population with latent tuberculosis infection (LTBI) are the main source of active tuberculosis . (bvsalud.org)
Tuberculosis (TB) is caused by an infection with the bacteria Mycobacterium tuberculosis . (edu.au)
It is important to note that TST results may be unreliable for 4-6 weeks following a measles infection or receiving a measles-containing vaccine. (edu.au)
BACKGROUND: HIV-1 infection is associated with increased risk of tuberculosis and a safe and effective vaccine would assist control measures. (ox.ac.uk)
participants with latent tuberculosis infection were eligible if they had completed at least 5 months of isoniazid preventive therapy, unless they had completed treatment for tuberculosis disease within 3 years before randomisation. (ox.ac.uk)
Secondary outcomes were immunogenicity and vaccine efficacy against Mycobacterium tuberculosis infection and disease, assessed in the per-protocol population. (ox.ac.uk)
However, we detected no efficacy against M tuberculosis infection or disease, although the study was underpowered to detect an effect against disease. (ox.ac.uk)
The Max Planck Insitute for Infection Biology has developed a vaccine against TB which is currently in phase III trial. (iuis.org)
The two different vaccines programmed the two arms of the immune system differently, and the vaccine that engaged adaptive and innate immunity together did the best job at controlling tuberculosis infection. (mmmbitesizescience.com)
In people with serious immune system problems, this vaccine may cause an infection that may be life-threatening. (cdc.gov)
Here we report the first efficacy data on using these vaccines in cattle, a natural target species of tuberculous infection. (ox.ac.uk)
After six weeks, in the group who received the vaccine at birth, infection rates from any disease were 25% lower compared to the group that had not yet received the jab. (wighthosting.info)
The innate immunity and enhancing defense pathways provided by widely-used and well-recognized vaccines could substantially mitigate, or even prevent, infection from other pathogens such as SARS-CoV-2. (healthcarehygienemagazine.com)
We are suggesting that in the absence or availability of pathogen-specific vaccines, particularly in the beginning phase of a pandemic, that LAVs be rigorously tested to determine whether they can control infection and disease progression. (healthcarehygienemagazine.com)
By offering immediate protection against infection with SARS CoV-2 mediated by enhanced innate immunity and boosting immune response to traditional vaccine against COVID19 working as an adjuvant. (healthcarehygienemagazine.com)
Besides protecting against infection, innate immunity stimulation also has the potential to be used therapeutically in the early stages of disease, as well as to boost the effectiveness of vaccines that promote a specific adaptive immune response. (healthcarehygienemagazine.com)
Bacillus Calmette-Guérin (BCG) revaccination of uninfected adolescents provided protection against Mycobacterium tuberculosis infection. (nature.com)
The most successful vaccines are highly effective at generating durable immunity against disease-causing pathogens for individuals and generate herd immunity that dramatically limits the spread of infection. (nature.com)
Immunosuppressives may diminish therapeutic effects of vaccines and increase risk of adverse effects (increased risk of infection). (medscape.com)
The only available TB vaccine, bacille Calmette-Guérin (BCG), does not prevent primary infection and has limited effectiveness at preventing pulmonary TB in adults, who, along with adolescents, are mainly responsible for spreading TB. (iavi.org)
What drew its attention was TB's increasingly apparent association with another terrible disease-HIV infection leads to active tuberculosis, and conversely, tuberculosis patients are more likely to develop AIDS. (indiatoday.in)
False-positive reactions may occur due to infection with mycobacteria other than M. tuberculosis or immunization with bacille Calmette-Guerin (BeG) vaccine. (cdc.gov)
BeG is the most widely used vaccine in the world, but it is generally not recommended in the United States because of the low risk of infection with M. tuberculosis, the variable effectiveness of the vaccine against pulmonary TB in adults, and interference by the vaccine with tuberculin reactivity. (cdc.gov)
Is Mycobacterium tuberculosis infection life long? (cdc.gov)
Medications that interact with the immune system may increase the risk of infection following administration of live vaccines. (skyrizihcp.com)
Infection is lifelong and symptomatic tuberculosis may develop following a period of clinical latency lasting for months, years, or decades. (edu.hk)
Accumulating evidence suggests that M. tuberculosis might utilize fatty acids as its principal carbon and energy source during infection. (edu.hk)
Rhesus macaques receiving a priming vaccine followed by multiple booster inoculations had a 79% lower per-exposure risk of infection by simian-human immunodeficiency virus (SHIV) compared to unvaccinated animals. (nih.gov)
These results add to the scientists' understanding of what happens in the early stages of tuberculosis infection. (usfreenews.com)
This is partly due to the difficulty in studying the early stages of infection, which occurs when only one or two M. tuberculosis bacteria are deposited deep in the lungs. (usfreenews.com)
The study authors state that they are now using the model to study how the lungs might respond to a low dose of infection and the novel coronavirus vaccine . (usfreenews.com)
Talk to your doctor if you have tuberculosis, chronic lung disorders, gastrointestinal perforations, or active infection. (healthkindpharma.com)
Those individuals are encouraged to take antibiotics to reduce the likelihood that they will develop active tuberculosis later, when circumstances may reduce their immune system's ability to contain the infection. (wilkescounty.net)

Even widely deployed and highly effective (50%-90% efficacy) pre- or postexposure vaccines would only be able to reduce the number of TB cases by one third. (cdc.gov)
Although BCG is the most widely used vaccine in the world, its efficacy in preventing adult forms of TB is relatively poor, with an average efficacy ≈50% ( 3 ). (cdc.gov)
The next step in the research will be to test the rBCG30 vaccine for efficacy in humans against TB. (infectioncontroltoday.com)
The only available vaccine, bacillus Calmette-Guérin (BCG), has variable efficacy throughout the world. (ox.ac.uk)
The only tuberculosis vaccine currently available, Bacille Calmette-Guérin, or BCG for short, has only limited efficacy. (immunitytales.com)
BCG can protect children from the most severe forms of tuberculosis, but it has little to no efficacy in preventing pulmonary tuberculosis in adults, the most common and most infectious form of the disease. (immunitytales.com)
Over the next decade, the results of these trials will allow to assess the efficacy of the vaccine candidates. (immunitytales.com)
The STriTuVaD project aims to develop and clinically validate an in silico trials technology capable of predicting the efficacy of therapies for active tuberculosis based on innovative therapeutic vaccines. (strituvad.eu)
Safety, immunogenicity, and efficacy of the candidate tuberculosis vaccine MVA85A in healthy adults infected with HIV-1: a randomised, placebo-controlled, phase 2 trial. (ox.ac.uk)
We assessed the safety, immunogenicity, and efficacy of a candidate tuberculosis vaccine, modified vaccinia virus Ankara expressing antigen 85A (MVA85A), in adults infected with HIV-1. (ox.ac.uk)
The number of participants with negative QuantiFERON-TB Gold In-Tube findings at baseline who converted to positive by the end of the study was 38 (20%) of 186 in the MVA85A group and 40 (23%) of 173 in the placebo group, for a vaccine efficacy of 11·7% (95% CI -41·3 to 44·9). (ox.ac.uk)
In the per-protocol population, six (2%) cases of tuberculosis disease occurred in the MVA85A group and nine (3%) occurred in the placebo group, for a vaccine efficacy of 32·8% (95% CI -111·5 to 80·3). (ox.ac.uk)
However it seems that this adenovirus vaccine has not been through Phase 3 trials, and we are therefore discounting it as a 'winner' until more evidence of its safety and efficacy comes to light. (allianceforscience.org)
Archivel plan to start to evaluate the efficacy of the vaccine for the treatment of MDR-TB in early 2020. (archivelfarma.com)
PORRIÑO, SPAIN, and NEW YORK, U.S. - JULY 14, 2021 - Spanish biopharmaceutical company Biofabri and IAVI today announced their intention to partner on efficacy trials of the tuberculosis (TB) vaccine candidate MTBVAC. (iavi.org)
We will select a definitive dose from these studies to progress into efficacy studies, and, if results of those trials bear fruit, we will also be equally as proud to be manufacturing a lifesaving vaccine locally. (iavi.org)
The CDC compiled data from 43 jurisdictions between July 31 and October 1 of this year to estimate overall vaccine efficacy. (medscape.com)
The analysis also suggested there was no difference in efficacy between subcutaneous and intradermal administration of the vaccine. (medscape.com)
Wilkin noted that while this data is reassuring, more research is necessary to understand vaccine efficacy between both intradermal and subcutaneous administration routes. (medscape.com)
He also emphasized that further studies are necessary to understand vaccine efficacy in immunocompromised populations, like those with uncontrolled HIV. (medscape.com)
Contact with different species of environmental Mycobacterium can cause acquired immunity to M. tuberculosis or increase the efficacy of BCG vaccine protection (M. vaccae, M. microti), although some species of these bacteria reduce the efficacy of BCG vaccine (M. scrofulaceum) [8,10-13]. (who.int)
The most extensive study ever conducted on the efficacy of the BCG vaccine for protection against tuberculosis, stratified by age and history of previous tuberculosis, was published in September in The Lancet Global Health . (medscape.com)

This is a new technology: no adenovirus vector vaccines for other diseases are yet widely available, though vaccines for HIV, influenza, Ebola and malaria using this platform are in clinical trials and an Ebola vaccine has been briefly deployed. (allianceforscience.org)
Yet, certain pathogens, including HIV, malaria and respiratory syncytial virus (RSV), have been recalcitrant to our best attempts at vaccine development. (nature.com)
The aim of this event is to provide an interactive forum, foccusing on immunology of malaria, tuberculosis, HIV and additional tropical diseases. (iuis.org)
The Committee endorsed a strategic framework to coordinate and integrate support from Gavi, the Vaccine Alliance and the Global Fund to Fight AIDS, Tuberculosis and Malaria and urged Member States to take all necessary steps to accelerate the prevention, control and elimination of communicable diseases and increase domestic public funding allocations for HIV, tuberculosis, malaria and immunization programmes. (who.int)
There are now vaccines to protect against malaria, dengue and Ebola virus disease, and promising vaccines against respiratory syncytial virus, tuberculosis and all influenza virus strains are in the pipeline. (who.int)
Six infectious diseases -- pneumonia, tuberculosis, diarrheal diseases, malaria, measles and HIV/AIDS -- account for half of all premature deaths worldwide. (malaria.com)
Malawi will begin broad use of RTS,S, Africa's first malaria vaccine for children under age five. (path.org)
In 2016, UN member states ratified the Sustainable Development Goals, including a commitment to "End the diseases of HIV, tuberculosis, malaria, and neglected tropical diseases" by 2030 (UN General Assembly 2015). (polarjournal.org)

The Plan, endorsed by the 194 Member States of the World Health Assembly in May 2012, is the framework to prevent millions of deaths by 2020 through universal access to vaccines for people in all communities. (cdc.gov)

Here we show that a live recombinant vaccine, rBCG30, which expresses large amounts of the Mycobacterium tuberculosis 30kDa major secretory protein, is more efficacious against bovine tuberculosis than BCG in the highly demanding guinea pig model of pulmonary tuberculosis. (escholarship.org)
But this is not the case for the most common form of the disease, pulmonary tuberculosis, in all age groups. (max-planck-innovation.com)
This tenacious microbe is transmitted via infectious aerosols produced by individuals with pulmonary tuberculosis. (edu.hk)
Secondary outcomes were pulmonary tuberculosis, extrapulmonary tuberculosis, and mortality. (medscape.com)
Participants were characterized as having been exposed to tuberculosis if they were reported to have been a close contact (either living in the same household or having substantial interaction outside the household) of a person with microbiologically or radiologically diagnosed pulmonary tuberculosis. (medscape.com)
Protection against all tuberculosis and pulmonary tuberculosis was greater among female participants than male participants. (medscape.com)
Protection, including against pulmonary tuberculosis, can be observed up to 3 years of age," stated study author Croda, chair of the Brazilian Society of Tropical Medicine and advisor to Medscape Portuguese Edition . (medscape.com)
Croda emphasized that the findings from their study indicate that BCG vaccine protects against pulmonary tuberculosis and that those results differ from results of some previous studies. (medscape.com)
However, the fact that it protects against pulmonary tuberculosis, especially in children younger than 3, was surprising. (medscape.com)

The sequences of selected peptides were confirmed by spectral match validation and immunogenicity evaluated by IFN-gamma ELISpot against peripheral blood mononuclear cell from volunteers vaccinated with BCG, M.tb latently infected subjects or patients with tuberculosis disease. (ox.ac.uk)
Newborns with or without HIV exposure showed similar immunogenicity with both vaccines. (max-planck-innovation.com)
For this reason, Archivel Farma have focused their efforts on the development of RUTI ® in this context and has initiated phase IIa clinical trials to evaluate the safety and immunogenicity of the vaccine. (archivelfarma.com)
Safety and immunogenicity of a candidate tuberculosis vaccine MVA85A delivered by aerosol in BCG-vaccinated healthy adults: a phase 1, double-blind, randomised controlled trial. (ox.ac.uk)
The atomic level structure of the viral surface fusion protein of respiratory syncytial virus provided key insights that enabled the production of a stabilized subunit vaccine candidate that elicited robust immunogenicity in a phase I study. (nature.com)
Safety and immunogenicity of a polyvalent peptide C4-V3 HIV vaccine in conjunction with IL-12. (rush.edu)

That's being studied in latency patients, that is, patients who have already been infected with TB to try to keep them from going on to either reactivating or going on to active tuberculosis. (hstalks.com)
The radiograph shows a classic posterior segment right upper lobe density consistent with active tuberculosis. (medscape.com)
People who have been exposed to someone with active tuberculosis may become infected, and not be actively sick, nor are they contagious. (wilkescounty.net)

The currently available century-old vaccine Bacille Calmette-Guerin, or BCG, provides only partial protection against both tuberculosis and leprosy, so a more potent vaccine is needed to combat both diseases. (infectioncontroltoday.com)
That means that this vaccine has promise for better protecting against both major diseases at the same time. (infectioncontroltoday.com)
While many childhood diseases are now effectively controlled by immunisation programs (as long as parents vaccinate their kids), there is still no effective vaccine for other serious infections like adult tuberculosis (TB). (mmmbitesizescience.com)
Such efforts could open up new avenues for the development of vaccines for other bacterial diseases as well," IISc said. (careers360.com)
Findings published in Lancet Infectious Diseases , show that vaccinating all babies on the day of birth with the Bacillus Calmette-Guerin (BCG) vaccine could potentially save thousands of lives a year in places with high infectious disease rates. (wighthosting.info)
The researchers say their results also increase the possibility that the vaccine might be used to protect children and adults against Covid-19 and other new infectious diseases. (wighthosting.info)
These technologies are producing encouraging results in the development of vaccines for globally important diseases such as tuberculosis, influenza and respiratory syncytial virus. (nature.com)
Furthermore, current vaccines for globally important diseases such as tuberculosis (TB) and influenza are suboptimal, leading to vulnerabilities among billions of at-risk individuals. (nature.com)
is a network of mostly European, research oriented clinicians, microbiologists, mycobacteriologists and epidemiologists interested in the field of tuberculosis and mycobacterial diseases. (bvsalud.org)
The WHO website provides a list of certain diseases for which vaccines are available, and a list of some pathogens for which vaccines and/or monoclonal antibodies (mAbs) are in development. (technet-21.org)
A new microneedle patch being developed by the Georgia Institute of Technology and the Centers for Disease Control and Prevention (CDC) could make it easier to vaccinate people against measles and other vaccine-preventable diseases. (cdc.gov)
Microneedle technology could move the GVAP forward by leading to improved protection against other diseases, including polio, influenza, rotavirus, rubella, tuberculosis and others. (cdc.gov)
Vaccines are critical to the prevention and control of many communicable diseases and therefore underpin global health security. (who.int)
1 The global health community has long been concerned about the movement across borders of vaccine-preventable diseases, tuberculosis and other diseases of public health concern. (who.int)
An experimental HIV vaccine based on mRNA-the same platform technology used in two highly effective COVID-19 vaccines-shows promise in mice and non-human primates, according to scientists at the National Institute of Allergy and Infectious Diseases (NIAID), part of the National Institutes of Health. (nih.gov)
We're here to talk about an article in the November 2008 issue of Emerging Infectious Diseases reporting upon multidrug-resistant tuberculosis, which is also known as MDR TB. (cdc.gov)
Objective: The distribution of hospitalizations for vaccine-preventable diseases in Pará is provided. (bvsalud.org)
Method: An observational, ecological study on hospitalizations for vaccine- preventable diseases between 2009 and 2018 in residents of the state of Pará. (bvsalud.org)
Since one is dealing fever and hospitalization rates due to with vaccine-preventable diseases, the Haemophilus influenzae Type B and tetanus situation impacts the quality of and access require fast responses and immediate action to First Health Care (APS)1-7. (bvsalud.org)
Abstract Background Understanding health delivery service from a patient´s perspective, including factors influencing healthcare seeking behaviour, is crucial when treating diseases, particularly infectious ones, like tuberculosis. (unl.pt)

Immunization with BCG vaccine lowers the risk of serious complications of primary TB in children (1-4). (cdc.gov)
World Immunization Week, celebrated in the last week of April each year, aims to promote the use of vaccines to protect people of all ages against disease. (cdc.gov)
This year's campaign focuses on closing the immunization gap and reaching equity in immunization levels as outlined in the Global Vaccine Action Plan (GVAP). (cdc.gov)
Innovative ways are being found to distribute and administer vaccines and to improve immunization services. (who.int)
Digital tools, new, needle-free techniques for vaccine administration and more robust vaccine storage and supply chains promise to transform immunization programmes1 over the next decade. (who.int)

15/09/2022 15:26 PM - A group of researchers from IISc, Bengaluru have designed a way to deliver a TB vaccine candidate using spherical vesicles secreted by bacteria coated on gold nanoparticles which. (outlookindia.com)
Damascus, 29 November 2022 - Trucks carrying two million doses of Oral Cholera Vaccines (OCV) arrived in Damascus, Syria, today. (who.int)

In addition, the VPM1002 vaccine is currently evaluated in adults in two other phase III clinical trials in India for protection against tuberculosis. (max-planck-innovation.com)

A group of researchers at Cedars-Sinai Medical Center in Los Angeles have found evidence that a tuberculosis vaccine has been associated with a reduced likelihood of contracting coronavirus disease 2019 (COVID-19). (contagionlive.com)

Study finds that a century-old tuberculosis vaccine could be used in the treatment and prevention of COVID-19. (contagionlive.com)
Tuberculosis Prevention and Control Key Laboratory, Beijing Key Laboratory of New Techniques of Tuberculosis Diagnosis and Treatment, Senior Department of Tuberculosis, the Eighth Medical Center of PLA General Hospital, Beijing, China. (bvsalud.org)
RUTI ® was designed as a therapeutic vaccine for the treatment (not prevention) of different forms of tuberculosis (TB), meant mainly as a solution to treat Multidrug-Resistant Tuberculosis (MDR-TB) and as coadjuvant for the standard antibiotic treatment to avoid the frequent relapses associated with TB. (archivelfarma.com)
Intradermal administration of the JYNNEOS mpox vaccine is as effective and safe as subcutaneous administration, according to new data released this week by the Centers for Disease Control and Prevention (CDC). (medscape.com)
The second part of this lecture will discuss the challenges facing development of more effective vaccines and drugs for prevention and treatment of tuberculosis. (edu.hk)

Vaccines currently under development include subunit vaccines ( 9 ), naked DNA vaccines ( 10 , 11 ), and attenuated mycobacteria, including recombinant BCGs expressing immunodominant antigens and cytokines ( 12 ). (cdc.gov)
There are protein adjuvants which tend to dominate this in dark blue, and those are subunit vaccines containing somewhere between two to four antigens, which are always adjuvanted and given usually by intramuscular injection. (hstalks.com)

Three antigens were expressed in viral vectors, and evaluated as vaccine candidates alone or in combination in a murine aerosol M.tb challenge model. (ox.ac.uk)
When delivered in combination, the three candidate vaccines conferred significant protection in the lungs and spleen compared with BCG alone, demonstrating proof-of-concept for this unbiased approach to identifying new candidate antigens. (ox.ac.uk)
Latency-related antigens can induce T lymphocytes of LTBI individuals to produce higher IFN-Î³ levels than tuberculosis patients and normal subjects. (bvsalud.org)
Sub-unit vaccines typically only contain a limited number of antigens -- bacterial proteins that can elicit an immune response in the host. (careers360.com)
Novel approaches to vaccine development include structure-based immunogen design, gene-based vaccine platforms and formulation of recombinant antigens with potent adjuvants. (nature.com)
Small synthetic peptides that mimic surface antigens of pathogens and are immunogenic, or vaccines manufactured with the aid of recombinant DNA techniques. (rush.edu)

The group of mice immunized with rBCG30 and boosted with r30 had no detectable leprosy bacteria in their footpads, in contrast to groups of mice immunized with all other vaccines tested, including BCG and rBCG30 alone and BCG boosted with r30. (infectioncontroltoday.com)
While the search continues for a viable vaccine, the bacteria are becoming more antibiotic-resistant which is extremely detrimental to those infected. (immunitytales.com)
Most adult TB vaccines under development focus on boosting the "adaptive" immune response to generate highly activated immune cells to fight off M. tuberculosis bacteria. (mmmbitesizescience.com)
Then, since tuberculosis-causing bacteria enter the human body via the lungs, the team delivered a second inhaled vaccine designed to boost immune cells at the site of pathogen invasion. (mmmbitesizescience.com)
Scientists have earlier developed sub-unit vaccines based on just a handful of proteins from the disease-causing bacteria, but none of them have been effective so far, IISc said. (careers360.com)
The tuberculosis bacteria, My co bacterium tuberculosis, reside within every third person worldwide. (indiatoday.in)
Four types of opportunistic mycobacterial disease of humans have been described: skin lesions (following traumatic inoculation of bacteria), localized lymphadenitis, tuberculosis (TB)-like pulmonary lesions and disseminated disease [5]. (who.int)

However, the only currently available vaccine, M. bovis Bacille Calmette-Guerin (BCG), is not highly efficacious. (escholarship.org)
In 1921, the first-and so far the only-vaccine against the disease, Bacille Calmette-Guerin or BCG, was developed.With a spurt in discovery of antibiotics, from Streptomycin in 1944 to Rifampicin in 1963, M. tuberculosis was deemed doomed. (indiatoday.in)

Johnson & Johnson, while it has the corporate muscle to produce vaccine doses in large quantities, doesn't expect to start Phase 1 trials until September, which it says could possibly "allow vaccine availability for emergency use in early 2021. (allianceforscience.org)

The vaccine could be a potential bridge offering some benefit until a more effective and safer COVID-19 vaccine is made widely available. (contagionlive.com)
Numerous randomized clinical trials are already in the works studying the potential of the BCG vaccine for COVID-19. (contagionlive.com)
In the event of a new pandemic, will "covid type" one could imagine that BCG protects populations, the time to find a vaccine? (rebelinkpress.com)
In the United States, a study was underway when the Covid started: the idea was to look for the possible effect "positive" of this BCG vaccine on diabetes. (rebelinkpress.com)
The tuberculosis (TB) vaccine may protect newborns against a variety of upper respiratory tract and chest infections, a study suggests, raising hopes that the jab may also help with Covid-19. (wighthosting.info)
We very actively support the marvelous COVID-19-specific vaccines, and nothing in this publication conflicts with the development and use of these effective vaccines," said Dr. Michael Avidan of the Department of Anesthesiology, Washington University, St Louis. (healthcarehygienemagazine.com)
What are the Top 5 most promising COVID-19 vaccine candidates? (allianceforscience.org)
More than 160 vaccine efforts are currently underway in the global push to stop the COVID-19 pandemic, according to the World Health Organization. (allianceforscience.org)
On 11 August the story broke that Russia is claiming to have a fully developed COVID vaccine. (allianceforscience.org)
These engineered adenoviruses, when put into a vaccine, trigger an immune response in the human body, protecting against COVID-19. (allianceforscience.org)
Adenoviruses are not the only viral vectors that can be used: pharmaceutical giant Merck says it is working on a potential COVID vaccine using an engineered vesicular stomatis virus , previously used successfully in its Ebola vaccine. (allianceforscience.org)
This announcement comes amidst the extraordinary pace of the development of numerous vaccines to protect people from COVID-19 over the past year. (iavi.org)
The urgency of global COVID-19 vaccine rollout is deservedly receiving unprecedented attention. (iavi.org)
We saw with COVID-19 that adequate investment and public-private partnerships were essential to the successful, rapid development of vaccines. (iavi.org)
The country received its first shipment of COVID-19 vaccine doses in July. (wypr.org)
One week after Haiti's president was assassinated, the country's first shipment of COVID-19 vaccines finally arrived. (wypr.org)
In the context of the COVID-19 pandemic, quality of medicines, vaccines and medical devices should be maintained at their highest standards to ensure equitable access to optimal treatment. (iddo.org)
The experimental vaccine works like mRNA COVID-19 vaccines. (nih.gov)
Abstract: COVID-19 vaccine hesitancy (VH) has caused concerns due to the possible fluctuations that may occur directly impacting the control of the pandemic. (unl.pt)
CBC News: The National shows that heading into a third pandemic winter, COVID hospitalizations in Canada are up, vaccine uptake is down and new variants are circulating. (canadaforums.ca)
Help share COVID-19 vaccine facts and encourage your community to get vaccinated. (texas.gov)
Download and use these COVID-19 vaccine posters, videos, social media posts and more. (texas.gov)
Please check out these other COVID-19 vaccine-related campaigns. (texas.gov)
This easy-to-understand video for children can also educate adults about the COVID-19 vaccine. (texas.gov)

The Bacillus Calmette-Guérin (BCG) vaccine was first developed around 1921 to treat bladder cancer and for people who are at a higher risk of contracting tuberculosis. (contagionlive.com)

While both inhaled vaccines generated similar levels of adaptive immunity, the VSV vaccine was not as good as adenovirus at producing robustly activated, multi-functional innate immunity. (mmmbitesizescience.com)
This could be even more tragic in the case of a future pandemic for which the development of a vaccine is more challenging, transmission is more rapid, or herd immunity more difficult to achieve. (healthcarehygienemagazine.com)
LAVs that stimulate innate immunity could serve as a stop-gap until an effective vaccine is widely available. (healthcarehygienemagazine.com)

No other infectious disease has killed more people than tuberculosis. (max-planck-innovation.com)
The infectious biologist expects initial results showing whether VPM1002 can provide comparable or better protection than existing BCG vaccines in about three years. (max-planck-innovation.com)
However, the most effective way to stop the global tuberculosis epidemic is to prevent the spread of Mycobacterium tuberculosis - the infectious microorganism that causes the disease - through the use of effective vaccines. (immunitytales.com)
This prompted Rachit Agarwal, Assistant Professor at the Centre for BioSystems Science and Engineering (BSSE), IISc , and his group to develop a potential sub-unit vaccine candidate that contains only parts of the infectious bacterium to stimulate an immune response. (careers360.com)
Ensuring that the vaccine is given on day one, in areas with high rates of infectious disease, could have a major impact on infections and deaths in the newborn period. (wighthosting.info)
Tuberculosis (TB) (see the image below), a multisystemic disease with myriad presentations and manifestations, is the most common cause of infectious disease-related mortality worldwide. (medscape.com)
200 new cases of tuberculosis were reported in Mexico in 2016 and more than 2900 people died from this infectious disease (770 of them, affected by HIV/AIDS). (archivelfarma.com)
Even as tuberculosis attacks with great ferocity than ever before, there is hope as a range of new drugs, diagnostic tools and vaccines infuses zeal into the war against this highly infectious disease. (indiatoday.in)
Airborne and highly infectious, TB cannot be reined in without an effective vaccine. (indiatoday.in)
Tuberculosis (TB) is an infectious disease associated with poverty. (unl.pt)

One third of the world's population is estimated to be infected with Mycobacterium tuberculosis , the causative agent of TB ( 1 ). (cdc.gov)
TB is a bacterial disease caused by organisms of the Mycobacterium tuberculosis complex (i.e. (cdc.gov)
Such Th2-like activity can stop Mycobacterium tuberculosis from being pushed into a latent state by the Th1 response, impair bactericidal functions and cause toxicity of TNF-alpha and pulmonary fibrosis. (nih.gov)
Caused by the bacterium Mycobacterium tuberculosis, tuberculosis (TB) kills over a million people worldwide every year. (careers360.com)
In future studies, the team plans to develop gold-coated OMVs derived directly from Mycobacterium tuberculosis and test them on animal models to take the results forward for clinical applications. (careers360.com)
Immunoinformatics offers a variety of tools that can predict immunogenic T-cell peptides of Mycobacterium tuberculosis (Mtb) that can be used to create a new vaccine. (unison.mx)
The RUTI ® vaccine, originally designed by Dr. Pere-Joan Cardona , Head of the Experimental Tuberculosis Unit at Institut Germans Trias i Pujol (IGTP) in Badalona (Spain) and the founder and scientific advisor at Archivel Farma, is based on cell wall nanofragments of Mycobacterium tuberculosis, the bacillus causing the disease. (archivelfarma.com)
RUTI ® triggers a polyantigenic response that enhances the immune response of the patient, which contributes to combating Mycobacterium tuberculosis and promotes its elimination. (archivelfarma.com)
The microbe Mycobacterium tuberculosis (MTB) is an ancient cohabiter with humans, infecting almost 3 billion people worldwide, 10% of them developing clinical disease. (intechopen.com)
Tuberculosis (TB) is a bacterial disease caused by Mycobacterium tuberculosis. (cdc.gov)
Tuberculosis (TB) is caused by a bacterium called Mycobacterium tuberculosis . (cdc.gov)
These conditions have led to the emergence of virulent new pathogens and the increased prevalence of "classic" scourges, such as Mycobacterium tuberculosis. (edu.hk)
Tuberculosis is a disease caused by the bacterium Mycobacterium tuberculosis (M. tuberculosis) and most often affects the lungs. (usfreenews.com)

On all the so-called vaccines "living" (those inoculated with the still active virus) - so polio in its version "drinkable" , or even measles-mumps-rubella. (rebelinkpress.com)
And Professor Locht to report the concern of his Danish research colleagues who expect a resumption of mortality among children when the drinkable polio vaccine will soon be withdrawn from the market. (rebelinkpress.com)
The most frequently received antigen was theBacille-Calmette-Guerinby 1 781 infants (91.2%), oral polio vaccine 1 703 (87.2%), and hepatitis B vaccine birth dose the lowest at 75.1% (1 565). (annalsofglobalhealth.org)

Older children , adolescents , and adults also need 1 or 2 doses of MMR vaccine if they are not already immune to measles, mumps, and rubella. (cdc.gov)
This is a proven platform, which was used to produce thousands of doses of company's Ebola vaccine deployed in the Congo in November 2019. (allianceforscience.org)
Since the beginning of the mpox outbreak in May, there have been 29,711 reported cases in the United States, and more than 1.1 million doses of the JYNNEOS mpox vaccine have been administered. (medscape.com)
Earlier this year, Haiti shrugged off two offers of doses AstraZeneca - first from India and then from COVAX, the global vaccine sharing program . (wypr.org)
And in mid-July, the U.S. sent half a million doses of the Moderna vaccine through COVAX to the Caribbean nation. (wypr.org)
Although the doses of mRNA delivered were high, the vaccine was well tolerated and produced only mild, temporary adverse effects in the macaques, such as loss of appetite. (nih.gov)
Make sure your child gets all doses of HPV vaccine. (seerinvest.com)

Postexposure vaccines would initially have a substantially greater impact, compared to preexposure vaccines, on reducing the number of new cases of disease. (cdc.gov)
We evaluate the effect of both pre- and postexposure TB vaccines on two outcome variables: the number of new infections and the number of new cases of disease. (cdc.gov)
The research also found that the vaccine could help in reducing the level of severity of the disease. (contagionlive.com)
Each model has its own merits for studying human tuberculosis, and none completely mimics the human disease. (who.int)
Disease and class : tuberculosis and the shaping of modern North American society / Georgina D. Feldberg. (who.int)
First used 100 years ago, the BCG vaccine against the disease contains attenuated pathogens of cattle tuberculosis. (max-planck-innovation.com)
While finding an effective vaccine for tuberculosis is the ideal route for eradication of the bacterial disease, one must not lose sight of the forest for the trees. (immunitytales.com)
Possibly, in conjunction with the ongoing research on vaccine therapy, other mechanisms for the control of the disease should be considered. (immunitytales.com)
Cape Town - Africa has made progress in the fight against tuberculosis (TB) in recent years, however several hurdles are curbing the efforts to end this preventable and curable disease and at the current pace, the global targets to eliminate the disease by 2030 look increasingly elusive. (who.int)
From the development of each vaccine to its use in reducing disease, Plotkin's Vaccines, 7th Edition, provides the expert information you need to provide optimal care to your patients. (elsevier.com)
This award-winning text offers a complete understanding of each disease, as well as the latest knowledge of both existing vaccines and those currently in research and development. (elsevier.com)
If we understand the mechanisms that underlie susceptibility and protection, this would be very useful for any trials of new vaccines, but also for the diagnosis, as we could look for specific markers associated with TB disease and protection. (ukri.org)
Around 10 million people fell ill with tuberculosis in 2019, and the disease is one of the 10 leading causes of death worldwide. (iavi.org)
This advancement would be a major boost in our efforts to eliminate this disease, with more vaccines administered and more lives saved at less cost. (cdc.gov)
Unfortunately, global coverage with the measles vaccine has been stagnant for the last few years at around 85 percent, which is well below the coverage of up to 95 percent needed to interrupt transmission of the disease. (cdc.gov)
A more effective vaccine than BCG which does not provide complete protection from TB disease. (lstmed.ac.uk)
Although the disease primarily affects adults, there are currently no effective vaccines for this group. (usfreenews.com)

JYNNEOS, a vaccine for protection against smallpox and monkeypox, was approved by the US Food and Drug Administration in 2019 and was traditionally given via subcutaneous administration. (medscape.com)

To achieve this, the researchers genetically modified the attenuated BCG vaccine strain so that immune cells can better recognize the pathogens. (max-planck-innovation.com)
This research should help to drive the intelligent design of future vaccines against pathogens like HIV and chlamydia, which enter at similar interfaces where the body meets the outside world. (mmmbitesizescience.com)
INTERPRETATION: Further clinical trials assessing the aerosol route of vaccine delivery are merited for tuberculosis and other respiratory pathogens. (ox.ac.uk)
Vaccines for more than 30 bacterial and viral pathogens have saved hundreds of millions of lives over the years 1 . (nature.com)
In this review of major advances over the past 18 months, we focus on vaccine development concerning three critical pathogens: respiratory syncytial virus (RSV), which has no licensed vaccine, and TB and influenza, both of which are in critical need of improved vaccines. (nature.com)

Every physician believes the BCG vaccine protects against serious forms of tuberculosis up to age 5. (medscape.com)

Most high-incidence countries also use the only available TB vaccine, Mycobacterium bovis bacillus Calmette-Guérin (BCG). (cdc.gov)
Mice immunized with rBCG30 and boosted with r30 had markedly enhanced immune responses to the leprosy bacterium's version of the Antigen 85B protein, which is very similar to the one expressed by the tuberculosis bacillus, compared with mice immunized with the other vaccines and vaccine combinations. (infectioncontroltoday.com)
Currently, only one vaccine is available to prevent severe courses: Bacillus Calmette Guérin (BCG). (max-planck-innovation.com)

Phase I clinical trials of several of these vaccines are under way or scheduled to begin very soon ( 13 , 14 ). (cdc.gov)
During the past ten years, more than 15 tuberculosis vaccine candidates have been evaluated in more than 50 human trials, requiring global investments of more than 600 million US dollars. (immunitytales.com)
But because trials of vaccines are hugely expensive, their development needs very clear guidance. (immunitytales.com)
Also, it is provided a summary of the TB vaccines undergoing clinical trials. (unison.mx)
The Chinese company CanSino Biologics - the medical science arm of the People's Liberation Army, no less - has completed Phase 1 trials with an adenovirus vector vaccine called Ad5-nCoV. (allianceforscience.org)
Such markers could also be used in vaccine or treatment trials, instead of purely relying on the bacteriologically confirmed cases, which is the current approach. (ukri.org)
Bacteriological confirmation of TB in children is rare and lack of suitable alternative diagnostics is a major bottleneck to progress in identifying patients in need of treatment and in clinical trials of new vaccines and therapies. (ukri.org)
Integration of measurable host responses into diagnostic algorithms is informing not only the diagnosis of the individual patient but also facilitate clinical trials of new vaccines and drugs. (ukri.org)
Our project proposal has been developed to address a critical bottleneck for patient management and clinical trials of new vaccines and drugs alike: a) the problem of accurate diagnostics for tuberculosis (TB) in children and b) the absence of markers of protection which can be used as endpoints for TB vaccine trials. (ukri.org)
Without a better diagnostic approach, which doesn't exclusively rely on bacteriological confirmation, children are not likely to be included in any studies of improved treatment for TB, and any ongoing vaccine trials will continue to require large and expensive cohorts of patients to be followed prospectively over a long period of time. (ukri.org)
A sound rationale needed for phase III HIV-1 vaccine trials. (rush.edu)

In a second experiment, the mice were first immunized with BCG or rBCG30, and then immunized with a booster vaccine (r30) consisting of the TB bacterium's 30-kDa Antigen 85B protein in adjuvant - that is, in a chemical formulation that enhances the immune response. (infectioncontroltoday.com)
The immune response against tuberculosis relies, at least in part, on CD4+ T cells. (ox.ac.uk)
New research has now revealed that it's also important to consider how such vaccines impact the "innate" immune response, which exists in a state of constant readiness to repel pathogenic invaders. (mmmbitesizescience.com)
Thanks to its strong ability to stimulate the immune response, demonstrated in preclinical and clinical studies, a dose of the RUTI® vaccine combined with antibiotics can reduce the treatment time of MDR-TB and contribute to reducing both the number of deaths and the rate of relapse. (archivelfarma.com)

Technical advances in mRNA vaccines have led to improved intracellular stability and antigen expression, leading to robust and durable immune responses. (nature.com)
mRNA candidate vaccines encoding full length haemagglutinin from two pandemic influenzas strains were safe and immunogenic in phase I studies. (nature.com)
This experimental mRNA vaccine combines several features that may overcome shortcomings of other experimental HIV vaccines and thus represents a promising approach. (nih.gov)
However, instead of carrying mRNA instructions for the coronavirus spike protein, the vaccine delivers coded instructions for making two key HIV proteins, Env and Gag. (nih.gov)
In studies with mice, two injections of the VLP-forming mRNA vaccine induced neutralizing antibodies in all animals, the investigators report. (nih.gov)
The Env proteins produced in the mice from the mRNA instructions closely resembled those in the whole virus, an improvement over previous experimental HIV vaccines. (nih.gov)
The team then tested the Env-Gag VLP mRNA vaccine in macaques. (nih.gov)
The boost vaccines contained Gag mRNA and Env mRNA from two HIV clades other than the one used in the prime vaccine. (nih.gov)
In addition to neutralizing antibodies, the VLP mRNA vaccine also induced a robust helper T-cell response. (nih.gov)

Services and treatments include, but are not limited to: annual flu vaccines, minor sprains/strains, respiratory illnesses, skin rashes, headaches, bladder infections, leave of absence (LOA) and Medical Leave Act (FMLA) return-to-work processing, tuberculosis testing and treatment of workplace injuries. (cookchildrens.org)
The WHO says that individuals who create respiratory sicknesses like tuberculosis and pneumonia are bound to be lacking in Vitamin D. (healthifypedia.com)

abstract = "Introduction: Tuberculosis (TB) is a major health problem worldwide. (unison.mx)
ABSTRACT This research compared the numbers and types of different Mycobacterium species in soil samples taken from 2 areas of Golestan province, Islamic Republic of Iran, 1 with a high prevalence of tuberculosis and 1 with a low prevalence. (who.int)

We've compiled a list of the top 5 most promising candidate vaccine platforms, with a brief summary of relevant details. (allianceforscience.org)
BACKGROUND: Intradermal MVA85A, a candidate vaccine against tuberculosis, induces high amounts of Ag85A-specific CD4 T cells in adults who have already received the BCG vaccine, but aerosol delivery of this vaccine might offer immunological and logistical advantages. (ox.ac.uk)

However, a study published in October 2014 indicates that elimination of tuberculosis by 2050 may require vaccines developed for adults and adolescents. (immunitytales.com)
If elimination by 2050 is the goal, our study provides evidence that new vaccines should focus on targeting adolescents and adults rather than children. (immunitytales.com)
While the BCG vaccine works well in children, it is not as effective at protecting adolescents and adults, according to the statement. (careers360.com)
A tuberculosis (TB) subunit recombinant fusion protein (M72) formulated with a potent adjuvant (ASO1E) was effective at preventing activation of pulmonary TB in latently infected adults. (nature.com)
Tuberculosis remains a global emergency and affects and continues to kill adults and children in large numbers worldwide. (ukri.org)

So this is actually a live attenuated tuberculosis, which is being given intradermally, developed by BIOFABRI and the University of Zaragoza in Spain. (hstalks.com)
Live-attenuated vaccines should be avoided for at least 3 mo after cessation of immunosuppressive therapy. (medscape.com)

This case series describes the clinical and laboratory profile of 15 patients with tuberculosis (TB) HIV coinfection admitted to a referral centre in the Islamic Republic of Iran. (who.int)

At least 20 million people worldwide suffer from tuberculosis, according to World Health Organization (WHO), with 10 million new cases every year and about 1.5 million deaths annually. (max-planck-innovation.com)
The study found that more than 90% prescriptions in the private sector and RNTCP (Revised National Tuberculosis Control Programme) were incorrect as per the WHO (World Health Organization) norms. (journalistsagainsttb.org)

This is the first study demonstrating that an improved vaccine against tuberculosis also offers cross-protection against Mycobacterium leprae, the causative agent of leprosy,' says Dr. Marcus A. Horwitz, professor of medicine and microbiology, immunology and molecular genetics, and the study's senior author. (infectioncontroltoday.com)

It is also the first study demonstrating that boosting a recombinant BCG vaccine further improves cross-protection against leprosy,' he adds. (infectioncontroltoday.com)

Tuberculosis causes significant morbidity and mortality in children worldwide. (ukri.org)

It would it be wonderful if one of the oldest vaccines that we have could help defeat the world's newest pandemic,' Arditi said. (contagionlive.com)
Starting in 2012, the company continued to develop the vaccine in collaboration with the Serum Institute of India, one of the world's largest vaccine manufacturers. (max-planck-innovation.com)
Because measles is vaccine-preventable and the measles virus survives only in human hosts, the world's health officials are aiming for measles elimination. (cdc.gov)

Epidemiology of Bacterial Meningitis in the Nine Years Since Meningococcal Serogroup A Conjugate Vaccine Introduction, Niger, 2010-2018. (cdc.gov)
Between 2010 and 2018, 23 million deaths were averted with measles vaccine alone (1) . (who.int)

MVA-specific cellular responses were detected in both groups, whereas serum antibodies to MVA were only detectable after intradermal administration of the vaccine. (ox.ac.uk)

Results from Chennai's Tuberculosis Research Centre (TRC) promise to improve treatment methods. (indiatoday.in)

The 20th century dream of eradicating the global scourge of tuberculosis (TB) evaporated with the failure of the old BCG vaccine to protect the populations at greatest risk, low compliance at following the complicated and lengthy treatment in countries with limited resources, which was followed by the spread of multiple-drug resistant (MDR) strains. (intechopen.com)
Drug resistant strains of tuberculosis are becoming more common worldwide and unless we find more effective ways to fight TB, there will be a return to the pre-antibiotic era, when there were no effective drugs for TB. (lstmed.ac.uk)

Learn tips to help you and your family at risk of pneumonia with vaccines and other family members. (seerinvest.com)

There is a huge potential around the possibility to design therapeutic vaccines for Tuberculosis that work in conjunction with conventional cures. (strituvad.eu)
New research on broadly neutralizing antibodies and therapeutic vaccines is opening fresh horizons. (who.int)

This fact sheet discusses the BCG vaccine and TB and explains that TB can develop even if persons have been given the BCG vaccine. (cdc.gov)

Developing effective tuberculosis (TB) vaccines is a high priority. (cdc.gov)
Especially infants and immunocompromised patients are therefore in urgent need for more effective tuberculosis vaccines. (max-planck-innovation.com)

The campaign is part of the expansion of the Union health ministry's focus on the eradication of tuberculosis by ramping up. (outlookindia.com)

The 1998 International Symposium on Tuberculosis Vaccine Development and Evaluation will be held August 26-28, 1998, in San Francisco, California. (cdc.gov)
Symposium topics will include public health implications of tuberculosis (TB), the status of TB vaccine development, preclinical obstacles for TB candidate vaccines, challenges in TB vaccine evaluation, strategies for overcoming barriers for field testing, and criteria for field site selection. (cdc.gov)
A new, more effective vaccine would be expected to improve TB control substantially, and therefore, vaccine development is one of the highest priorities in TB research ( 4 , 5 ). (cdc.gov)
TB vaccines under development can be divided into two categories: preexposure or postexposure vaccines. (cdc.gov)
IMSEAR at SEARO: Animal models of tuberculosis for vaccine development. (who.int)
These findings also have implications for human tuberculosis vaccine development. (ox.ac.uk)
Expert opinion: In the next few years, the field of peptide-based vaccines will keep growing along with the development of more efficient and sophisticated immunoinformatic tools to identify immunogenic peptides with a greater accuracy. (unison.mx)
Archivel Farma , owner of RUTI ® , the most promising therapeutic vaccine targeting tuberculosis, among the dozen RUTI ® related projects that are currently being developed around the world, and Laboratorios Silanes, one of the major Mexican pharmaceutical companies, have signed a collaboration agreement for the clinical development and commercialization of the vaccine in Mexico. (archivelfarma.com)
Silanes, in turn, will advise Archivel Farma with regard to the regulatory affairs and the recommended clinical development of the vaccine in Mexico and will also evaluate the commercial potential of RUTI ® in the Mexican market. (archivelfarma.com)
Similarly, a concerted global effort will be essential to the development of an effective TB vaccine. (iavi.org)
Development of a diagnostic compatible BCG vaccine against Bovine tuberculosis. (europeanvaccinesdiagnostics.com)
Tuberculosis Vaccine Development: Progress in Clinical Evaluation. (cdc.gov)
However, from 2015, coverage of tive mechanisms for market shaping, procurement and interventions plateaued, and the region is now behind supply chains, which made available large quantities of on the related Sustainable Development Goal (SDG) quality-assured vaccines, medicines, diagnostic tests, and targets (2) . (who.int)
spur research and development for the next generation of vaccines and technologies. (cdc.gov)
Furthermore, there has been much innovation in vaccine development. (who.int)

The pipeline includes, as you see in sort of purple, the mycobacterial whole cell extracts, the most advanced of which is a non-tuberculosis Mycobacterium, similar to TB, which is in a Phase III trial in rural China. (hstalks.com)
And then there are the actual mycobacterial vaccines themselves, such as MTBVAC, an actual attenuated vaccine. (hstalks.com)
Protective vaccines require the induction of antigen-specific CD4+ T cells via mycobacterial peptides presented by MHC class-II in infected macrophages. (ox.ac.uk)

Efforts should continue to develop a vaccine which can replace/outperform the presently available vaccine BCG. (who.int)

As rBCG30 is significantly more potent than BCG against M. bovis challenge, it has potential as a vaccine against bovine tuberculosis in domesticated animals and in wild animal reservoirs. (escholarship.org)
Viral booster vaccines improve Mycobacterium bovis BCG-induced protection against bovine tuberculosis. (ox.ac.uk)
Bovine tuberculosis (BTB) attributable to Mycobacterium bovis stays a serious downside in each the developed and growing international locations. (europeanvaccinesdiagnostics.com)

Tuberculosis vaccine candidates are entering clinical studies in areas where BCG fails. (nih.gov)
So let's go through the global clinical pipeline of TB vaccine candidates. (hstalks.com)
Animal models for testing different vaccine candidates have been developed since a long time for studying tuberculosis. (who.int)

As a result, ACIP and the Advisory Committee for Elimination of Tuberculosis have issued the following educational update on BCG vaccines. (cdc.gov)

So 15 years ago, there were essentially no TB vaccines in the clinic, and due to stimulation of the field, mostly through large grants by the EC, European Community, and the Bill and Melinda Gates Foundation, there has been huge work and appreciation for the need to develop tuberculosis vaccines. (hstalks.com)
It is estimated that each year 90 million people are infected and approximately 10% of them develop tuberculosis. (archivelfarma.com)

Definitive diagnosis requires isolation and identification of organisms of the M. tuberculosis complex from a clinical specimen. (cdc.gov)
Professor Bertie Squire Areas of interest: Tuberculosis: improving access by the poor to diagnosis and clinical care. (lstmed.ac.uk)
Dr Maxine Caws Areas of interest: Tuberculosis: diagnosis, epidemiology, drug resistance and host:pathogen interaction. (lstmed.ac.uk)

Anatomy4

Organisms7

Diseases24

Chemicals and Drugs53

Analytical, Diagnostic and Therapeutic Techniques and Equipment8

Phenomena and Processes2

Information Science1

Health Care4

Comparative affects of plasmid-encoded interleukin 12 and interleukin 18 on the protective efficacy of DNA vaccination against Mycobacterium tuberculosis. (1/350)

Immunogenicity of Mycobacterium tuberculosis RD1 region gene products in infected cattle. (2/350)

Production of avirulent mutants of Mycobacterium bovis with vaccine properties by the use of illegitimate recombination and screening of stationary-phase cultures. (3/350)

Identification of novel Mycobacterium tuberculosis antigens with potential as diagnostic reagents or subunit vaccine candidates by comparative genomics. (4/350)

Mapping of murine Th1 helper T-Cell epitopes of mycolyl transferases Ag85A, Ag85B, and Ag85C from Mycobacterium tuberculosis. (5/350)

Enhanced immunogenicity to Mycobacterium tuberculosis by vaccination with an alphavirus plasmid replicon expressing antigen 85A. (6/350)

Cutting edge: Mycobacterium tuberculosis blocks Ca2+ signaling and phagosome maturation in human macrophages via specific inhibition of sphingosine kinase. (7/350)

The Apa protein of Mycobacterium tuberculosis stimulates gamma interferon-secreting CD4+ and CD8+ T cells from purified protein derivative-positive individuals and affords protection in a guinea pig model. (8/350)

Tuberculosis Vaccines

Tuberculosis

BCG Vaccine

Tuberculosis, Pulmonary

Mycobacterium tuberculosis

Mycobacterium bovis

Vaccines

Vaccines, Synthetic

Vaccination

Bacterial Vaccines

Antigens, Bacterial

Vaccines, Inactivated

Tuberculosis, Bovine

Viral Vaccines

Immunization, Secondary

Vaccines, DNA

Tuberculin Test

Vaccines, Attenuated

Vaccines, Combined

Tuberculosis, Multidrug-Resistant

Mycobacterium

Adjuvants, Immunologic

AIDS Vaccines

Bacterial Proteins

Interferon-gamma

Vaccines, Subunit

Vaccines, Conjugate

Tuberculosis, Miliary

Acyltransferases

Immunity, Cellular

Isoniazid

CD4-Positive T-Lymphocytes

Lung

Latent Tuberculosis

Tuberculosis, Lymph Node

Malaria Vaccines

Mice, Inbred BALB C

Guinea Pigs

Tuberculosis, Osteoarticular

CD8-Positive T-Lymphocytes

Tuberculosis, Gastrointestinal

Tuberculosis, Spinal

Papillomavirus Vaccines

Tuberculosis, Cutaneous

Meningococcal Vaccines

Clinical Trials as Topic

Rifampin

Mice, Inbred C57BL

Sputum

Hepatitis B Vaccines

Measles Vaccine

Tuberculosis, Pleural

Extensively Drug-Resistant Tuberculosis

Tuberculosis, Urogenital

Pertussis Vaccine

Tuberculosis, Meningeal

Pyrazinamide

Antibiotics, Antitubercular

Haemophilus Vaccines

Poliovirus Vaccine, Inactivated

Rabies Vaccines

Rotavirus Vaccines

Cholera Vaccines

Tuberculosis, Splenic

Tuberculosis, Ocular

Typhoid-Paratyphoid Vaccines

Smallpox Vaccine

Antibodies, Bacterial

Antibodies, Viral

Tuberculosis, Hepatic

Tuberculosis, Female Genital

Chickenpox Vaccine

Mycobacterium smegmatis

Diphtheria-Tetanus-Pertussis Vaccine

Ethambutol

Mumps Vaccine

Immunization Schedule

Hepatitis A Vaccines

Measles-Mumps-Rubella Vaccine

Streptococcal Vaccines