A species of SWINE, in the family Suidae, comprising a number of subspecies including the domestic pig Sus scrofa domestica.
Round, granular, mononuclear phagocytes found in the alveoli of the lungs. They ingest small inhaled particles resulting in degradation and presentation of the antigen to immunocompetent cells.
A species of ARTERIVIRUS causing reproductive and respiratory disease in pigs. The European strain is called Lelystad virus. Airborne transmission is common.
Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).
A syndrome characterized by outbreaks of late term abortions, high numbers of stillbirths and mummified or weak newborn piglets, and respiratory disease in young unweaned and weaned pigs. It is caused by PORCINE RESPIRATORY AND REPRODUCTIVE SYNDROME VIRUS. (Radostits et al., Veterinary Medicine, 8th ed, p1048)
The formation of one or more genetically identical organisms derived by vegetative reproduction from a single cell. The source nuclear material can be embryo-derived, fetus-derived, or taken from an adult somatic cell.
Diseases of domestic swine and of the wild boar of the genus Sus.
The third tooth to the left and to the right of the midline of either jaw, situated between the second INCISOR and the premolar teeth (BICUSPID). (Jablonski, Dictionary of Dentistry, 1992, p817)
Pulmonary or extrapulmonary infection caused by MYCOBACTERIUM TUBERCULOSIS or nontuberculous mycobacteria in a patient with silicosis.
Animals considered to be wild or feral or not adapted for domestic use. It does not include wild animals in zoos for which ANIMALS, ZOO is available.
The pathologic wearing away of the tooth substance by brushing, bruxism, clenching, and other mechanical causes. It is differentiated from TOOTH ATTRITION in that this type of wearing away is the result of tooth-to-tooth contact, as in mastication, occurring only on the occlusal, incisal, and proximal surfaces. It differs also from TOOTH EROSION, the progressive loss of the hard substance of a tooth by chemical processes not involving bacterial action. (From Jablonski, Dictionary of Dentistry, 1992, p2)
Clonal hematopoetic disorder caused by an acquired genetic defect in PLURIPOTENT STEM CELLS. It starts in MYELOID CELLS of the bone marrow, invades the blood and then other organs. The condition progresses from a stable, more indolent, chronic phase (LEUKEMIA, MYELOID, CHRONIC PHASE) lasting up to 7 years, to an advanced phase composed of an accelerated phase (LEUKEMIA, MYELOID, ACCELERATED PHASE) and BLAST CRISIS.
Translation products of a fusion gene derived from CHROMOSOMAL TRANSLOCATION of C-ABL GENES to the genetic locus of the breakpoint cluster region gene on chromosome 22. Several different variants of the bcr-abl fusion proteins occur depending upon the precise location of the chromosomal breakpoint. These variants can be associated with distinct subtypes of leukemias such as PRECURSOR CELL LYMPHOBLASTIC LEUKEMIA-LYMPHOMA; LEUKEMIA, MYELOGENOUS, CHRONIC, BCR-ABL POSITIVE; and NEUTROPHILIC LEUKEMIA, CHRONIC.
An aberrant form of human CHROMOSOME 22 characterized by translocation of the distal end of chromosome 9 from 9q34, to the long arm of chromosome 22 at 22q11. It is present in the bone marrow cells of 80 to 90 per cent of patients with chronic myelocytic leukemia (LEUKEMIA, MYELOGENOUS, CHRONIC, BCR-ABL POSITIVE).
Retrovirus-associated DNA sequences (abl) originally isolated from the Abelson murine leukemia virus (Ab-MuLV). The proto-oncogene abl (c-abl) codes for a protein that is a member of the tyrosine kinase family. The human c-abl gene is located at 9q34.1 on the long arm of chromosome 9. It is activated by translocation to bcr on chromosome 22 in chronic myelogenous leukemia.
A type of chromosome aberration characterized by CHROMOSOME BREAKAGE and transfer of the broken-off portion to another location, often to a different chromosome.
Conditions which cause proliferation of hemopoietically active tissue or of tissue which has embryonic hemopoietic potential. They all involve dysregulation of multipotent MYELOID PROGENITOR CELLS, most often caused by a mutation in the JAK2 PROTEIN TYROSINE KINASE.

Liquid storage of miniature boar semen. (1/2075)

The effects of liquid storage at 15 degrees C on the fertilizing ability of miniature pig semen were investigated. Characterization of ejaculated semen from 3 miniature boars was carried out. Semen volume and pH were similar among these boars. In one of the boars, sperm motility was slightly low, and sperm concentration and total number of sperm were significantly lower than in the others (P < 0.01). Seminal plasma of the semen was substituted with various extenders (Kiev, Androhep, BTS and Modena) by centrifugation and semen was stored for 7 days at 15 degrees C. Sperm motility was estimated daily at 37 degrees C. For complete substitution of seminal plasma, Modena was significantly more efficient than the other extenders (P < 0.001) in retaining sperm motility. Semen from each of the 3 miniature boars that had been stored for 5 to 7 days at 15 degrees C in Modena was used for artificial insemination of 15 miniature sows. The farrowing rates were 100, 100 and 60%, and litter sizes were 6.4 +/- 1.5, 5.8 +/- 0.8 and 5.0 +/- 1.0 for each boar semen, respectively. The boar that sired the smallest farrowing rate was the same one that showed lower seminal quality with respect to sperm motility, sperm concentration and total number of sperm. These results suggest that miniature boar semen can be stored for at least 5 days at 15 degrees C by the substitution of seminal plasma with Modena extender.  (+info)

Anti-CD45RB antibody deters xenograft rejection by modulating T cell priming and homing. (2/2075)

Pancreatic islet xenotransplantation has been advocated as a way of overcoming the shortage of human donor tissue for the treatment of type 1 diabetes. However, the potent immune response against xenografts is a major barrier to their use. We show that a short course of the anti-CD45RB antibody, MB23G2, prolongs survival of fetal pig pancreas grafts in mice. To investigate this effect further we used an i.p. xenograft model in which both donor pig cells and host inflammatory cells can be expediently recovered and analyzed. Graft prolongation was associated with reduced T cell and macrophage infiltration, and reduced production of both T(h)1 and T(h)2 cytokines at the graft site. Graft survival was further increased and T cell infiltration further reduced by combining anti-CD45RB antibody with co-stimulation blockade. The primary effect of anti-CD45RB antibody may be on CD4 T cells, in keeping with the marked reduction in T cell cytokine production in both spleen and graft sites. This concurs with previous studies in allogeneic models that indicate that this antibody perturbs T cell responses by modifying signaling via the TCR. In addition, anti-CD45RB treatment led to reduced expression of LFA-1 and CD62 ligand (CD62L) on CD4 T cells, independent of antigenic challenge. LFA-1 may enhance co-stimulation, and both LFA-1 and CD62L are involved in T cell trafficking. Their reduced expression provides an explanation why the T cell pool is reduced in lymph nodes. We conclude that modulation of inflammation against xenografts by anti-CD45RB antibody is due to effects on both T cell priming and trafficking.  (+info)

The effect of testosterone on regional blood flow in prepubertal anaesthetized pigs. (3/2075)

This work was undertaken to study the effects of testosterone on the coronary, mesenteric, renal and iliac circulations and to determine the mechanisms of action involved. In prepubertal pigs of both sexes anaesthetized with sodium pentobarbitone, changes in left circumflex or anterior descending coronary, superior mesenteric, left renal and left external iliac blood flow caused by intra-arterial infusion of testosterone were assessed using electromagnetic flowmeters. Changes in heart rate and arterial blood pressure were prevented by atrial pacing and by connecting the arterial system to a pressurized reservoir containing Ringer solution. In 12 pigs, intra-arterial infusion of testosterone for 5 min to achieve a stable intra-arterial concentration of 1 microg l(-1) increased coronary, mesenteric, renal and iliac blood flow without affecting the maximum rate of change of left ventricular systolic pressure (left ventricular dP/dt(max)) and filling pressures of the heart. In a further five pigs, a concentration-response curve was obtained by graded increases in the intra-arterial concentration of the hormone between 0.125 and 8 microg l(-1). The mechanisms of these responses were studied in the 12 pigs by repeating the experiment after haemodynamic variables had returned to the control values before infusions. In six pigs, blockade of muscarinic cholinoceptors and adrenoceptors with atropine, propranolol and phentolamine did not affect the responses caused by intra-arterial infusion of testosterone performed to achieve a stable intra-arterial concentration of 1 microg l(-1). In the same pigs and in the remaining six pigs, the increases in coronary, mesenteric, renal and iliac blood flow caused by intra-arterial infusion of testosterone performed to achieve a stable intra-arterial concentration of 1 microg l(-1) were prevented by intra-arterial injection of N(omega)-nitro-L-arginine methyl ester. The present study shows that intra-arterial infusion of testosterone dilated coronary, mesenteric, renal and iliac circulations. The mechanism of this response involved the release of nitric oxide.  (+info)

Mycobacterium palustre sp. nov., a potentially pathogenic, slowly growing mycobacterium isolated from clinical and veterinary specimens and from Finnish stream waters. (4/2075)

Taxonomic studies were performed on a phenotypically homogeneous group of 13 mycobacteria isolated from clinical, veterinary and stream-water samples. The methods applied included chromatographic analyses of bacterial lipids, biochemical tests and sequencing of the 16S rDNA and the internal transcribed spacer 1 (ITS1) region. Positive results in urease, Tween 80 hydrolysis and pyrazinamidase tests and a negative result in a semi-quantitative catalase test, combined with the ability to grow at 42 degrees C, distinguished this group among the yellow-pigmented, slowly growing mycobacteria. Unique fatty acid and mycolic acid profiles in chromatographic analyses and the results of gene sequencing indicated that the novel isolates represent a previously undescribed species, for which the name Mycobacterium palustre sp. nov. is proposed. The fatty acid profile obtained by GLC was characterized by the presence of several methyl-branched fatty acid markers. The most prominent markers were 2-methyleicosanoic, tetracosanoic and hexacosanoic acids. According to 16S rDNA sequencing, M. palustre is phylogenetically closest to Mycobacterium kubicae, a recently described species. M. palustre gives a false-positive result in a hybridization test with the AccuProbe Mycobacterium avium complex. One of the strains was isolated from a lymph-node biopsy from a child with cervical lymphadenitis. Thus, M. palustre should be listed among potential inducers of paediatric lymphadenitis. The veterinary isolates originated from the lymph nodes of slaughter pigs. The majority of the strains were recovered from natural waters, which highlights the role of the environment as a source of potentially pathogenic mycobacteria. The type strain of M. palustre is strain E846T (= DSM 44572T = ATCC BAA-377T).  (+info)

Transforming growth factor-beta and epidermal growth factor synergistically stimulate epithelial to mesenchymal transition (EMT) through a MEK-dependent mechanism in primary cultured pig thyrocytes. (5/2075)

Enhancement of tumor cell growth and invasiveness by transforming growth factor-beta (TGF-beta) requires constitutive activation of the ras/MAPK pathway. Here we have investigated how MEK activation by epidermal growth factor (EGF) influences the response of fully differentiated and growth-arrested pig thyroid epithelial cells in primary culture to TGF-beta1. The epithelial tightness was maintained after single stimulation with EGF or TGF-beta1 (both 10 ng/ml) for 48 hours. In contrast, co-stimulation abolished the transepithelial resistance and increased the paracellular flux of [(3)H]inulin within 24 hours. Reduced levels of the tight junction proteins claudin-1 and occludin accompanied the loss of barrier function. N-cadherin, expressed only in few cells of untreated or single-stimulated cultures, was at the same time increased 30-fold and co-localised with E-cadherin at adherens junctions in all cells. After 48 hours of co-stimulation, both E- and N-cadherin were downregulated and the cells attained a fibroblast-like morphology and formed multilayers. TGF-beta1 only partially inhibited EGF-induced Erk phosphorylation. The MEK inhibitor U0126 prevented residual Erk phosphorylation and abrogated the synergistic responses to TGF-beta1 and EGF. The observations indicate that concomitant growth factor-induced MEK activation is necessary for TGF-beta1 to convert normal thyroid epithelial cells to a mesenchymal phenotype.  (+info)

Aggressive venous neointimal hyperplasia in a pig model of arteriovenous graft stenosis. (6/2075)

BACKGROUND: Vascular access dysfunction is the most important cause of morbidity and hospitalization in the hemodialysis population in the United States at a cost of well over one billion dollars per annum. Venous neointimal hyperplasia characterized by stenosis and subsequent thrombosis, is the major cause of polytetrafluoroethylene (PTFE) dialysis graft failure. Despite the magnitude of the problem, there are currently no effective therapies for the prevention or treatment of venous neointimal hyperplasia in PTFE dialysis grafts. We believe that this is partly due to the lack of a validated large animal model of arteriovenous stenosis that could be used to test out novel interventions. METHODS: Seven-centimeter PTFE loop grafts were placed between the femoral artery and vein of domestic pigs. The grafts were removed at 2, 4, 7, 14 and 28 days after surgery and subjected to a detailed histological and immunohistochemical examination. RESULTS: Significant neointimal hyperplasia and venous stenosis developed by 28 days at the graft-vein anastomosis. There was minimal neointimal hyperplasia at the graft-artery anastomosis. Venous neointimal hyperplasia (VNH) was characterized by (a) the presence of smooth muscle cells/myofibroblasts; (b) angiogenesis within both the neointima and adventitia; and (c) the presence of an active macrophage cell layer lining the PTFE graft material. These results are very similar to the human lesion previously described by us in dialysis patients. CONCLUSIONS: We have developed and validated a pig model of venous neointimal hyperplasia that is very similar to the human lesion. We believe that this is an ideal model in which to test out novel interventions for the prevention and treatment of clinical hemodialysis vascular access dysfunction.  (+info)

Cloning, expression and characterization of a mammalian Nudix hydrolase-like enzyme that cleaves the pyrophosphate bond of UDP-glucose. (7/2075)

A distinct UDP-glucose (UDPG) pyrophosphatase (UGPPase, EC 3.6.1.45) has been characterized using pig kidney ( Sus scrofa ). This enzyme hydrolyses UDPG, the precursor molecule of numerous glycosylation reactions in animals, to produce glucose 1-phosphate (G1P) and UMP. Sequence analyses of the purified enzyme revealed that, similar to the case of a nucleotide-sugar hydrolase controlling the intracellular levels of ADP-glucose linked to glycogen biosynthesis in Escherichia coli [Moreno-Bruna, Baroja-Fernandez, Munoz, Bastarrica-Berasategui, Zandueta-Criado, Rodri;guez-Lopez, Lasa, Akazawa and Pozueta-Romero (2001) Proc. Natl. Acad. Sci. U.S.A. 98, 8128-8132], UGPPase appears to be a member of the ubiquitously distributed group of nucleotide pyrophosphatases designated Nudix hydrolases. A complete cDNA of the UGPPase-encoding gene, designated UGPP, was isolated from a human thyroid cDNA library and expressed in E. coli. The resulting cells accumulated a protein that showed kinetic properties identical to those of pig UGPPase.  (+info)

Assessment of genetic diversity of Korean native pig (Sus scrofa) using AFLP markers. (8/2075)

In order to assess the genetic diversity and genetic relationships among the six commercial pig breeds including the Korean native pig, we performed an amplified fragment length polymorphism (AFLP) analysis. Applying the three EcoRI/TagI primer combinations to 54 individual pig samples out of six breeds, a total of 186 AFLP bands were generated, 67 (36%) of which were identified as polymorphic bands. From these polymorphic bands, the three estimates (percentage of polymorphic loci, Neis heterozygosity and Shannon index) of genetic diversity, G(ST) estimates, Neis unbiased genetic distance and two indices of genetic similarity were calculated. From all the calculations of genetic diversity, the lowest genetic diversity was exhibited in the Korean native pig, and the highest in the Chinese Yanbian pig. Given the mean G(ST) value (G(ST) = 0.390) across all pigs examined, levels of apparent breed subdivision were considerable. A UPGMA tree of individuals based on Jaccards similarity index showed that the Korean native pig formed a distinct cluster from the other five pigs. In addition, the tree displayed that all the individuals except for six individuals were grouped into their breeds. Principal component analysis based on the binary data matrix of either presence or absence confirmed the distinctness of the Korean native pig from the other pigs. Our results indicate that the Korean native pig has a low level of genetic diversity and is distinct from the five pig breeds, confirming the results from previous microsatellite data. The findings also suggest that AFLP analysis may be a valuable tool for revealing genetic relationships and genetic diversity among different pig breeds.  (+info)

ABSTRACT Objective. The purpose of this study was to characterize a population of domestic pig (Sus scrofa domestica) in Cereté, Córdoba, using 20 microsatellite; calculate heterozygosity per locus and average heterozygosity. Materials and methods . Hair samples were collected from 62 specimens. DNA was extracted by proteinase K digestion and phenol-chloroform purification. Information from 20 microsatellites was selected out of those recommended for swine biodiversity studies. PCR products were separated by a vertical polyacrylamide gel electrophoresis. The bands were visualized by staining with silver nitrate. Results . All microsatellites used were polymorphic. Between 3 (SW1067) and 15 (IFNG) alleles were detected with an average number of 6.7 and a total de 134 alleles. The average expected and observed heterozygosities were 0.5278 and 0.5479, respectively. PIC values ranged between 0.1999 and 0.8300 for loci SW1067 and SW911, respectively. Conclusions . Levels of observed and expected
Wild boar (Sus scrofa), one of the most widespread wildlife species, has entered a stage of continuous growth in Europe, and could even be considered a pest species. We analysed microsatellite variability in 723 wild boars from across Europe, including the northern Dinaric Balkans. Our aims were: (1) to define the population structure of wild boars in the Balkans and its relation with other European populations; (2) to estimate effective populations sizes, levels of intra- and inter-population diversity, inbreeding migration and gene flow patterns; (3) to test subpopulations for bottlenecks; (4) to interpret these results in light of current knowledge about the demographic history of wild boars in Europe; and (5) to discuss the relevance of these findings for management and conservation. Strong population structuring was observed and 14 subpopulations were revealed. High genetic diversity was found, and besides the well-known identity of the Italian populations of Sardinia and Castelporziano, we bring
The wild boar (Sus scrofa), also known as the wild swine or Eurasian wild pig, is a suid native to much of Eurasia, North Africa, and the Greater Sunda Islands. Human intervention has spread its range further, making the species one of the widest-ranging mammals in the world, as well as the most widely spread suiform. Its wide range, high numbers, and adaptability mean that it is classed as least concern by the IUCN and it has become an invasive species in part of its introduced range. The animal probably originated in Southeast Asia during the Early Pleistocene, and outcompeted other suid species as it spread throughout the Old World. As of 1990, up to 16 subspecies are recognised, which are divided into four regional groupings based on skull height and lacrimal bone length. The species lives in matriarchal societies consisting of interrelated females and their young (both male and female). Fully grown males are usually solitary outside the breeding season. The grey wolf is
From 2004 to 2007, blood samples from 273 healthy wild boars ( Sus scrofa), culled during the hunting season, were obtained in three areas of Catalonia (NE Spain): Pyrenees, Sant Llorenç del Munt i l
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
Polish regions will implement a strategy to decrease the number of wild boars in order to avoid new outbreaks of African Swine Fever (ASF) this season, reported the local media.
View all domain architectures containing the Trypsin-like serine proteases domain in Sus scrofa 76_10.2.
Domain architecture and assignment details (superfamily, family, region, evalue) for ENSSSCP00000009547 from Sus scrofa 76_10.2. Plus protein sequence and external database links.
Conceptus IL1B2 mRNA abundance rapidly increases during trophoblast elongation, but decreases over 2000-fold immediately following completion of the elongation process [86]. Based on the timing and pattern of conceptus IL1B release and the presence of the IL-1 system in the conceptuses and endometrium, Ross et al. [86] proposed that conceptus IL1B secretion was the signal to initiate the cascade of events involved with the rapid elongation process.. Recently, analyses of pig genome sequences and expressed sequence tags (EST) indicate that gene duplication resulted in two IL1B genes on Sus scrofa chromosome 3. The classical IL1B1 is expressed in macrophages and endometrial tissue while the embryonic form (IL1B2) is only detected in the early porcine conceptus prior to attachment to the uterine LE [2, 87]. IL1B2 is considered novel because the sequence is not expressed in other mammals [88]. The two predicted protein sequences are 85% identical and are least homologous near the N-terminus as ...
ID PIG7_28_PE11 STANDARD; PRT; 1045 AA. AC PIG7_28_PE11; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE (PIG7_28.PE11). OS SUS SCROFA. OC Eukaryota; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; OC Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; OC Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; OC Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus. OX NCBI_TaxID=9823; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS PIG7_28.PE11. CC Sus scrofa chromosome 7 Sscrofa9 partial sequence 26600660..27600659 CC annotated by Ensembl CC -!- GENE_FAMILY: HOG000175261 [ FAMILY / ALN / TREE ] DR HOGENOM:Sus_scrofa;ENSSSCG00000001351;ENSSSCT00000001468;ENSSSCP00000001426. DR HOGENOMDNA; PIG7_28.PE11; -. KW ENSSSCG00000001351820036002503210000011; KW ENSSSCP0000000142682003600250321000001-PAA. SQ SEQUENCE 1045 AA; UNKNOWN MW; UNKNOWN CRC64; ...
ID PIG17_60_PE10 STANDARD; PRT; 429 AA. AC PIG17_60_PE10; A5GFW8; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE RecName: Full=Beta-1,3-galactosyl-O-glycosyl-glycoprotein DE beta-1,6-N-acetylglucosaminyltransferase 7; EC=2.4.1 -; (PIG17_60.PE10). GN Name=GCNT7; OS SUS SCROFA. OC Eukaryota; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; OC Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; OC Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; OC Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus. OX NCBI_TaxID=9823; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS PIG17_60.PE10. CC Sus scrofa chromosome 17 Sscrofa9 partial sequence 58705781..59698489 CC annotated by Ensembl CC -!- ANNOTATIONS ORIGIN:GCNT7_PIG CC -!- FUNCTION: Glycosyltransferase (By similarity). CC -!- PATHWAY: Protein modification; protein glycosylation. CC -!- ...
Occupying a vast range, the wild boar has evolved into a number of subspecies (about 35 have been described, but not all may be valid). In Europe, male wild boars may reach a head-body length of 200 cm, and a weight of 200 kgs. The tail measures about 25 cm. Females are significantly smaller. Male wild boars grow tusks from both the upper and lower canines curving upwards. The top tusks are hollow and act as a permanent whetstone against which the lower tusks are continually sharpened. Females do not grow the upper sharpening tusks as do the males, and their lower tusks are smaller ...
Recently in the pig hypothalamus a vasopressin- and oxytocin-containing nucleus was identified which, like the supraoptic nucleus, becomes sexually dimorphic after puberty. Following the increase in circulating steroids at puberty, the vasopressin- and oxytocin-containing nucleus becomes twice as large in both males and females. In adulthood, the vasopressin- and oxytocin-containing nucleus of females is approximately twice as large as that in males. Because these alterations are possibly due to an influence of gonadal steroids, i.e. estrogens, the vasopressin- and oxytocin-containing the presence of estrogen receptors. In addition to the area of the vasopressin- and oxytocin-containing nucleus, the present study documented the distribution of estrogen receptors in the septal area and other parts of the hypothalamus of intact post-pubertal male and female pigs, by utilizing immunocytochemical methodology. Intense nuclear estrogen receptor staining was found in a number of areas, i.e. the medial preoptic
The wild boar has been hunted for food, for sport or to protect crops against their ravages since the days of the cave men. In the Middle Ages boar hunting with spears and dogs was a royal sport and the serving of a boars head at the Christmas feast in Merry England was a holdover of a much older pagan rite at the time of the winter solstice. All other breeds of swine are derived from this prehistoric pig. Referred to as Wild Boar it is in fact a cage-free, pastured animal. The wild boar is an extremely hardy animal that is capable of growth even during the hardest winter. Unlike the domestic pig, Wild Boar are not prone to illness or disease. Wild boar meat is not gamey tasting; the meat is darker in color with a distinct, more flavorful taste than domestic pork. This specialty bacon is simply sumptuous, with a rich flavor and a heady maple-smoke aroma. Perfect for an exotic Sunday brunch with leek scrambled eggs and brioche toast. ...
Wild boar are seasonal breeders. In European male wild boar, sexual activity and testosterone production are triggered by decreasing day length, reaching a peak in October and November when the rut occurs. During the peak of testosterone production, one wild boar under study refused food for a six week period and lost approximately 25% of body weight. In the breeding season the normally solitary males move into female groups and rival males fight for dominance, whereupon the largest and most dominant males achieve the most matings. A wild boar sow, in Europe, is in oestrus with a 21 day cycle from autumn until June/July, at which time she becomes anoestrus until the next autumn. The start of the autumn oestrus in European wild boar may be triggered by nutritional status or day length. The nutritional status of the sow is important for breeding success.The odour from steroidal pheromones present in the male wild boars saliva stimulates receptivity in sows. ;Reproductive activity is seasonal. ...
Risk assessment, risk analysis and risk management require reliable (high quality) wild population data, which are not available so far. This project, funded by EFSA, is aimed at mapping wildlife species in Europe that are relevant for pathogens transmitted to animals and humans.. The objectives that ENETWILD will develop during next years are focused on wild boar population data for risk assessment.. Seventy experts from wildlife health and population sector (including partners and the Advisory Committee) met in Parma for the first Annual General Meeting (AGM) of ENETWILD project. The participants learnt about the objectives of ENETWILD, reviewed current data collection practices and data validation rules, and discussed on methodologies for estimating the abundance and distribution of wild boar. While it was understood the complexity of working with wild boar data, at end of the day, the participants contributed to clarify what to do, what for, how to do it, indicating some key ...
Although still rare, the increasing British wild boar population has resulted in more confrontations between wild boars and humans. And, so their presence in our gardens is increasing too. These large mammals can cause extensive damage to gardens by trampling plants and digging up large areas in their search for food.. ...
Sperm proteomes have been reported for mouse (19), human (20), monkey (21), equine (22) and most relevant livestock species including pig (15, 23, 24). However, to improve the understanding of complex regulate mechanisms involved in sperm function or to identify molecular causes of male infertility, the sperm proteome should be updated as the annotation of the protein-coding genome of each species has increased over time (3), as has recently been the case for pigs (16). Accordingly, the first contribution of the present study was the generation, using iTRAQ, of an updated proteome of mature porcine spermatozoa that includes 1,723 proteins identified and 1,602 of them quantified, albeit only 60% of them encoded in the Sus scrofa taxonomy. This shortage evidences the yet incomplete functional and structural annotation of the Sus scrofa protein-coding genes (16). Surprisingly, the total number of identified proteins was substantially lower than the 2,728 proteins identified recently by Feugang et ...
Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P (Ref.1, PubMed:8702556, PubMed:1334090). Also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound (By similarity). Through its extracellular phosphatase activity allows both the hydrolysis and the cellular uptake of these bioactive lipid mediators from the milieu, regulating signal transduction in different cellular processes (By similarity). It is for instance essential for the extracellular hydrolysis of S1P and subsequent conversion into intracellular S1P (By similarity). Involved in the regulation of inflammation, platelets activation, cell proliferation and migration among other processes (By similarity). May also have an
Regulates clathrin-mediated endocytosis by phosphorylating the AP2M1/mu2 subunit of the adaptor protein complex 2 (AP-2) which ensures high affinity binding of AP-2 to cargo membrane proteins during the initial stages of endocytosis. Regulates phosphorylation of other AP-2 subunits as well as AP-2 localization and AP-2-mediated internalization of ligand complexes. Phosphorylates NUMB and regulates its cellular localization, promoting NUMB localization to endosomes. Binds to and stabilizes the activated form of NOTCH1, increases its localization in endosomes and regulates its transcriptional activity.
Gamma aminobutyric acid (GABA) is the most abundant inhibitory neurotransmitter in the mammalian central nervous system (CNS). When released in the synaptic cleft, GABA binds to three major classes of receptors: GABAA, GABAB, and GABAC receptors. GABAA and GABAC receptors are ionotropic and mediate fast GABA responses by triggering chloride channel openings, while GABAB receptors are metabotropic and mediate slower GABA responses by activating G-proteins and influencing second messenger systems. GABAA receptors, the major sites for fast inhibitory neurotransmission in the CNS, are regulated by phosphorylation mechanisms, affecting both their functional properties and their cell surface mobility and trafficking. GABA release by the presynaptic terminal is negatively regulated by GABAB autoreceptors, and is cleared from the extracellular space by GABA transporters (GATs) located either on the presynaptic terminal or neighboring glial cells ...
CPB653Po21, OVA Conjugated Myostatin (MSTN), 肌肉生长抑制素(MSTN)卵白蛋白偶联物, GDF8; Growth Differentiation Factor 8 | 仅供体外研究使用,不用于临床诊断!请索取进口关税税单及报关单!
PAA087Po01, CCL2; GDCF2; HC11; HSMCR30; MCAF; MCP1; SCYA2; SMC-CF; Chemokine C-C-Motif Ligand 2; Monocyte Chemotactic And Activating Factor; Monocyte Secretory Protein JE | Products for research use only!
Please register to see prices including your discount. Registration may take up to 24h. For guest orders the standard discount of your institution will apply and discounts are visible on the order confirmation.. ...
Finds sub-sequences or patterns in the sequence and highlights the matching regions. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences. More... ...
The parental porcine monomyeloid cell line, 3D4, was established in December of 1998 following transfection of primary porcine alveolar macrophage cultures with the pSV3neo plasmid. Single cell cloning and selection in G-418 of the 3D4 parental cell line resulted in establishment of 3D4/2 (ATCC CRL-2845), 3D4/21 (ATCC CRL-2843) and 3D4/31 (ATCC CRL-2844).
Archaeological evidence suggests that pigs were domesticated from wild boar in the Near East in the Tigris Basin,[15] Çayönü, Cafer Höyük, Nevalı Çori[16] being managed in the wild in a way similar to the way they are managed by some modern New Guineans.[17] Remains of pigs have been dated to earlier than 11,400 years ago in Cyprus. Those animals must have been introduced from the mainland, which suggests domestication in the adjacent mainland by then.[18] There was also a separate domestication in China which took place about 8000 years ago.[19][20]. DNA evidence from subfossil remains of teeth and jawbones of Neolithic pigs shows that the first domestic pigs in Europe had been brought from the Near East. This stimulated the domestication of local European wild boar, resulting in a third domestication event with the Near Eastern genes dying out in European pig stock. Modern domesticated pigs have involved complex exchanges, with European domesticated lines being exported, in turn, to the ...
Archaeological evidence suggests that pigs were domesticated from wild boar as early as 13,000-12,700 BC in the Near East in the Tigris Basin,[14] Çayönü, Cafer Höyük, Nevalı Çori[15] being managed in the wild in a way similar to the way they are managed by some modern New Guineans.[16] Remains of pigs have been dated to earlier than 11,400 BC in Cyprus. Those animals must have been introduced from the mainland, which suggests domestication in the adjacent mainland by then.[17] There was also a separate domestication in China which took place about 8000 years ago.[18][19]. DNA evidence from subfossil remains of teeth and jawbones of Neolithic pigs shows that the first domestic pigs in Europe had been brought from the Near East. This stimulated the domestication of local European wild boar, resulting in a third domestication event with the Near Eastern genes dying out in European pig stock. Modern domesticated pigs have involved complex exchanges, with European domesticated lines being ...
The growth rate of farmed European wild boars (Sus scrofa L.) is perceived to be very slow. However, there is no available information on the genetic potential of these animals in terms of potential lean tissue growth.The aim of the study was to determine the maximum capacity for protein deposition (operational PDmax) in wild boars under controlled environmental conditions. Four diets were formulated containing different levels of digestible energy (DE): 2.2, 2.4, 2.6, and 2.8 Mcal DE kg-1. All of the diets contained at least 5 g lysine per Mcal DE. Twenty purebred wild boars from a commercial farm of the same age (± 4 d) and with an initial liveweight of 27 ± 0.50 kg (mean ± standard error of the mean) were used in the study. At the beginning of the study ...
Problems with Feral Hogs What is a feral hog, anyway? Any hog (Sus scrofa), including Russian and European wild boar, which is roaming freely upon public lands and is living in a wild or feral state. According to the dictionary, feral means having returned to an untamed state from domestication. Since swine are not native to North America, any free-ranging hog is by definition feral. And when any animal is introduced to the wild outside its native range, there can be problems. With hogs, the problems are numerous. Habitat destruction : Feral hogs are rooters and wallowers, and their feeding and wallowing activities destroy terrestrial and aquatic vegetation, ruin water holes used by other wildlife, and contribute to erosion and siltation, which can adversely affect water quality. Ground nesting bird predation: Hogs are omnivores and eat anything that gets in their way. This includes nests of ground nesting birds, such as turkeys, quail, killdeer, terns, and many other birds. Damage to ...
A retrospective study (2004-2010) on 24 Mycobacterium bovis strains isolated from wild boars (Sus scrofa) (n=18) and cattle (n=6) in Imperia province (Savona province has been included in the study just in 2006) was performed to detect the prevalence and distribution of antibiotic-resistant strains. Actually, in this area cases of M. bovis infections in wild boar were related to cases in cattle herds due to the overlapping of their respective habitat and pasture areas, suggesting the role of these animals as bio-indicator of the presence of M. bovis in the environment and, in consequence, in farm animals. Susceptibility of all M. bovis strains to antituberculous drugs (isoniazid-INH, rifampicin-RIF, ethambutol-EMB and streptomycin-STR) was detected by proportion method on Lowenstein-Jensen (LJ) medium using recommended critical concentration, while the 6 bovine M. bovis strains were tested by Versatrek method on liquid medium, too. The proportion method to assess the M. bovis susceptibility to ...
The Wild Boar (Sus scrofa), also known as Wild Pig, is the wild ancestor of the domestic pig. Interestingly, the term boar is often used to describe only the males for other pig species from the family Suidae, but for the Wild Boar, it applies to the whole species, i.e. both sexes. According to the Wild Animals of Singapore, they were believed to be locally extinct, and the current population is descended from individuals which swam over from Malaysia. They are active both day and night, feeding on fallen fruits and digging for roots and worms. As they lack a natural predator in Singapore (with the tiger and other big cats being extinct), the authorities have decided to cull them to control the population. While any ecologist will agree with that, it was unfortunate, however, that some people claimed that the Wild Boars had caused the population of mouse deer at Lower Pierce to decrease, stating that they used to see mouse deer 7 or 8 times out of 10 trips, but they hardly see them in recent ...
The Sino-Danish pig genome sequencing project has generated a resource of 3.8 million shotgun reads 0.66 coverage and approximately 1 million EST sequences. Due to the funding from The National Committee of Pig Breeding, Health and Production it was possible to establish the Sino-Danish pig genome project which originally was a collaboration between the Beijing Genomics Institute, the Royal Veterinary and Agricultural University (now University of Copenhagen, faculty of Life Sciences) and the Danish Institute of Agricultural Sciences (now University of Aarhus, faculty of Agricultural Sciences). The Technical University of Denmark and University of Aarhus were concurrently involved in the project ...
The domestic pig - also known as swine, domestic hog, or wild boar - descended from the introduction of Eurasian wild hogs. Pigs are believed to have been domesticated in Asia between 7,000 and 10,000 years ago. Today, this species is farmed worldwide as a food source. Feral or wild hog populations in the United States
The domestic pig (Sus scrofa domesticus or only Sus domesticus), often called swine, hog, when there is no need to distinguish it from other pigs, a large it wonderful business idea profitable.
Feral swine are the same species, Sus scrofa, as pigs that are found on farms. Feral swine are descendants of escaped or released pigs. Feral swine are called by many names including; wild boar, wild hog, razorback, piney woods rooter, and Russian or Eurasian boar. No matter the name they are a dangerous, destructive, invasive species ...
The test detects the relative pork DNA amount (Sus scrofa) to the total animal DNA content (amnions) in meat samples. Therefore the kit contains two PCR systems, one for detection of a pork specific gene (Sus detection gene) and one for the detection of an animal gene (reference gene).. ...
Sixteen species of pigs and hogs in eight genera make up the modern family Suidae. Suids originally occurred across Eurasia south of 48° N, on islands as far away as the Phillipines and Sulawesi, and throughout Africa. Humans have introduced Sus scrofa, from which the domesticated pigs are derived, in a variety of places around the world, including North America, New Zealand and New Guinea. Fossil suids are known from the Oligocene of Europe and Asia and the Miocene of Africa.. These medium-sized animals are typically stocky with a barrel-like body. The skin is usually thick and sparsely haired. Head and body length ranges from 500-1900 mm, tail length ranges from 35-40 mm and adult body weight can be as high as 350 kg. The eyes are usually small and located high on the skull, and the ears are small and pointed. The skull is usually long and has a flat dorsal profile. One of the most notable characteristics of suids is the mobile snout, which has a cartilaginous disk at its tip and terminal ...
The ecological impacts of feral pigs (Sus scrofa) are of concern in many places around the world. One noticeable impact is soil disturbance, although the causes and consequences are often unclear. We measured the effect of ground disturbance by feral pigs on seedling recruitment and soil ecology over 25 months on a forested riparian terrace at Waitutu, south Fiordland, New Zealand, and assessed the diet of pigs from the area from stomach contents of animals shot by hunters. Foraging by feral pigs for below-ground food disturbed between 7.4% and 12.4% of the soil. ...
Feral hog (also called wild hogs and wild pigs; Sus scrofa) attacks on people are rare and uncommon. In the United States, four people have died from feral hog attacks since the late 1800s-three victims were attacked by a wounded boar while hunting.. Given the opportunity, most feral hogs would flee rather than confront a nearby human. The majority of non-fatal attacks to people happen when hogs are cornered, threatened, or wounded in non-hunting circumstances. Most human victims are …. ...
Facts All potbellied pigs Sus scrofa are miniature in relationship to their cousins, the farm hog. Farm hogs can grow up to 900 pounds or more.. A typical, full grown, potbellied pig can be anywhere from 100 to 250 pounds. As with people, the size varies, but the average size is somewhere between 100 and 150 pounds, being less than 20 inches high at the shoulder.. Pigs grow quickly until they are about one year old, them continue to grow slowly until they are between three and four years old.. ...
In south-central Spain, the harvest of Eurasian wild boar (Sus scrofa) has increased significantly during recent decades in association with more intensive management actions to increase hunting yields and with consequent effects on the health status of the wild boar populations. We investigated the spatio-temporal trends and the risk factors related to the prevalence of Trichinella spp. in wild boar in order to obtain the annual probability of occurrence for these parasites in the Ciudad Real province of south-central Spain. Based on muscle samples collected during the hunting seasons from 1998/1999 to 2009/2010, the mean prevalence for Trichinella spp. in 95,070 wild boar was 0.2% (95% confidence interval 0.17-0.23). A subsample of 1,432 wild boar was also tested by ELISA. No correlation was observed between the prevalence of infection detected by serology and by the artificial digestion of muscle. The presence of Trichinella infections in wild boar showed a decreasing trend during the study ...
Salmonella species (spp.) are zoonotic enteric bacteria able to infect humans, livestock and wildlife. However, little is known about the prevalence and the presence of the different serovars in wildlife. Considering the wide distribution of wild boars and the feeding behaviour (omnivorous scavengers), wild boars may be a good indicator for environmental presence of Salmonella spp. The aims of this study were to determine the presence of Salmonella spp. in hunted wild boars and to determine the serotype the isolated strains. Over three hunting seasons, the intestinal contents of 1,313 boars hunted in northern Italy were sampled and cultured. Salmonella spp. were isolated from 326 boars (24.82%). Thirty different serovars belonging to three different S. enterica spp. were found. Twenty-one serovars of S. enterica subsp. Enterica were found including the human pathogens S. Typhimurium and S. Enteritidis. In addition, nine serovars belonging to S.enterica subsp. diarizonae and S. enterica subsp. houtenae
Pigs are mammals in the genus Sus. They include the domestic pig and its ancestor, the common Eurasian wild boar (Sus scrofa), and other species. Pigs are in the Suidae family of even-toed ungulates.. Related, but outside the genus, are the babirusa and the warthog. Pigs, like all suids, are native to the Old World. Juvenile pigs are known as piglets.[1] Pigs are omnivores and are highly social and intelligent animals.[2]. Domestic pigs are eaten as food called pork or bacon. The Jewish and Muslim religions, and some Christian denominations, believe eating pork is wrong. It is, however quite healthy food for humans. Pig farmers take care that the animals do not get diseases or parasites which might harm humans.. Domestic pigs are often pink, but small pigs kept as pets (pot-bellied pigs) are often other colors. Pigs often roll in mud to protect themselves from sunlight. Many people think that pigs are dirty and smell. In fact, they roll around in the mud to keep bugs and ticks away from their ...
Is a Yorkshire Pig the right Pigs for you? Yorkshire Pig owner reviews, health, training. Adopt a Yorkshire Pig from a shelter near Ashburn,VA.
German Agriculture Minister Christian Schmidt is backing an intelligent reduction of Germanys growing wild boar population to prevent a further spread of African Swine Fever (ASF), the Rheinische Post newspaper reported on Friday.
Production, carcass and meat quality traits of F2-crosses between European Wild Pigs and domestic pigs including halothane gene carriers - Volume 61 Issue 2 - K. Lundström, A. Karlsson, J. Håkansson, I. Hansson, M. Johansson, L. Andersson, K. Andersson
Parasite international open-access, peer-reviewed, online journal publishing high quality papers on all aspects of human and animal parasitology
Chronic myeloid leukemia (CML) is a clonal myeloproliferative disorder of a pluripotent stem cell. The natural history of CML has a triphasic clinical course comprising of an initial chronic phase (CP), which is characterized by expansion of functionally normal myeloid cells, followed by an accelerated phase (AP) and finally a more aggressive blast phase (BP), with loss of terminal differentiation capacity. On the cellular level, CML is associated with a specific chromosome abnormality, the t(9; 22) reciprocal translocation that forms the Philadelphia (Ph) chromosome. The Ph chromosome is the result of a molecular rearrangement between the c-ABL proto-oncogene on chromosome 9 and the BCR (breakpoint cluster region) gene on chromosome 22. The BCR/ABL fusion gene encodes p210 BCR/ABL, an oncoprotein, which, unlike the normal p145 c-Abl, has constitutive tyrosine kinase activity and is predominantly localized in the cytoplasm. While fusion of c-ABL and BCR is believed to be the primary cause of the ...
The complement system is a proteolytic cascade in blood plasma and a mediator of innate immunity, a nonspecific defense mechanism against pathogens. There are three pathways of complement activation: the classical pathway, the lectin pathway, and the alternative pathway. All of these pathways generate a crucial enzymatic activity that, in turn, generates the effector molecules of complement. The main consequences of complement activation are the opsonization of pathogens, the recruitment of inflammatory and immunocompetent cells, and the direct killing of pathogens. Blood coagulation is another series of proenzyme-to-serine protease conversions, culminating the formation of thrombin, the enzyme responsible for the conversion of soluble fibrinogen to the insoluble fibrin clot. Protease-activated receptors, such as those activated by thrombin, are members of G protein-coupled receptors and function as a mediator of innate immunity. The kallikrein-kinin system is an endogenous metabolic cascade, ...
PAA656Po01, AOC1; ABP1; KAO; Histaminase; Kidney amine oxidase; Amiloride Binding Protein 1; Amiloride-sensitive amine oxidase; Amine oxidase copper domain-containing protein 1 | Products for research use only!
CPA833Po21, OVA Conjugated Von Willebrand Factor (vWF), 血管性血友病因子(vWF)卵白蛋白偶联物, F8VWF; VWD; von Willebrand antigen 2 | 仅供体外研究使用,不用于临床诊断!请索取进口关税税单及报关单!
With the formation of the primary tubules and their glomeruli the growth of the Wolffian body is by no means complete. Two factors contribute to the further growth of this organ; first the lengthening out of the several portions of each tubule, the intensification of the primary curves and by the addition of new ones; second by the formation of secondary, tertiary and quaternary canals. I shall designate as secondary canals all tubules developing subsequent to the primary set. As the origin of the primary mesonephric tubules gave rise to several theories, we have likewise a number of different views regarding the origin of the secondary. (a) The first view-The secondary tubules and their glomeruli arise either by fission or buds from the primary set. Either of these processes may have as a starting point the wall of the Malpighian capsule or the tubule itself. Braun (77) found in reptiles and Spengel (76) in amphibia that the primary glomeruli are first divided by fissures which continue along ...
There are hundreds of breeds of the domestic pig (Sus scrofa domesticus). Contents A B C D E F G H I J K L M N O P Q R S T U V W X Y Z See also References Animals portal List of sheep breeds List of goat breeds List of cattle breeds Lists of domestic animal breeds Aksai Black Pied Pig Info, Farming, Meat Production, Pictures , Breeds List. www.breedslist.com. Retrieved 2017-02-25. Arapawa Pig Info, Farming, Meat Production, Pictures , Breeds List. www.breedslist.com. Retrieved 2017-02-25. Aksai Black Pied Pig Info, Farming, Meat Production, Pictures , Breeds List. www.breedslist.com. Retrieved 2017-02-25. Breeds of Livestock - Swine Breeds. ansi.okstate.edu. Oklahoma State University Dept. of Animal Science. Ekarius, Carol (2008). Storeys Illustrated Breed Guide to Sheep, Goats, Cattle and Pigs. Storey Publishing. ISBN 978-1-60342-036-5 ...
The Smithsonian Institutions Division of Mammals ( http://vertebrates.si.edu/mammals/ ) houses many suids in its scientific collections. This specimen, USNM 144421 ( http://collections.mnh.si.edu/search/mammals/?irn=7251992 ), is a male wild boar ( Sus scrofa ) from Indonesia. This individual was collected by William Abbott in 1907 near the Rhio Archipelago off of the island of Sumatra.
The Smithsonian Institutions Division of Mammals ( http://vertebrates.si.edu/mammals/ ) houses many suids in its scientific collections. This specimen, USNM 144421 ( http://collections.mnh.si.edu/search/mammals/?irn=7251992 ), is a male wild boar ( Sus scrofa ) from Indonesia. This individual was collected by William Abbott in 1907 near the Rhio Archipelago off of the island of Sumatra.
Animal Boars Even-toed Germany: 12 assigned downloads, like Wild Boar Sus scrofa, sow, portrait, Black Forest, Germany from stock-photos
Pigs (Sus scrofa domesticus) have been domesticated for thousands of years and can be found on every continent except Antarctica. Today, pigs are used for meat, lard, leather, brushes, heart valves, and paint products. Pig manure is also a good agricultural fertilizer but it must be properly composted prior to use. Before domestication, pigs inhabited grasslands, forests, shrublands, and marshy swamplands. Since they cant sweat, pigs require a nearby water source so they can cool down. This is also why they love rolling around in the mud!. They are intelligent, sociable, and downright adorable. In fact, they are the 4th most intelligent mammal, starting with humans, primates, dolphins and whales, and then pigs. Pigs are particular because they have such a high intellect. When nursing, piglets will feed from the same teat every time. They also like to keep things tidy by designating separate spaces for sleeping and using the bathroom. Pigs are very sensitive emotionally, and can even get their ...
This workflow searches for genes which reside in a QTL (Quantitative Trait Loci) region in the Pig, Sus scrofa. The workflow requires an input of: a chromosome name or number; a QTL start base pair position; QTL end base pair position. Data is then extracted from BioMart to annotate each of the genes found in this region. The Entrez and UniProt identifiers are then sent to KEGG to obtain KEGG gene identifiers. The KEGG gene identifiers are then used to searcg for pathways in the KEGG pathway ...
7. Determining the untested model assumptions of density and contact rate in a best-case-scenario(low density, drought affected, regularly managed) area.. The principal investigator was Dr Stephen Lapidge. A number of related articles have been published including:. 1. Spencer P., Hampton J., Lapidge S. et al. An assessment of the genetic diversity and structure within and among populations of wild pigs (Sus scrofa) from Australia and Papua New Guinea. Journal of Genetics 2006;85(1): 63- ...
Gentaur molecular products has all kinds of products like :search , EIAab \ CLIA CLMF p35,Cytotoxic lymphocyte maturation factor 35 kDa subunit,IL-12 subunit p35,IL12A,IL-12A,Interleukin-12 subunit alpha,Pig,Sus scrofa \ U0059p for more molecular products just contact us
Sus scrofa Native range: Eurasia Invasive Range: Southeastern and Southwestern US, Midwest, California, Oregon, Hawaii. Spreading in the Northeast and Northwest. Habitat: Found in a wide variety of habitats, from freshwater marshes to deserts. Common in forested areas with some
Export GlyConnect protein list related to composition with id 246 P01215 # id : 194 Glycoprotein hormones alpha chain - choriogonadotropin Homo sapiens P01229 # id : 350 Lutropin beta chain Homo sapiens P10646 # id : 602 Tissue factor pathway inhibitor Homo sapiens P04651 # id : 353 Lutropin beta chain Bos taurus P01217 # id : 601 Thyrotropin-aplha and beta chains Bos taurus P01223 # id : 601 Thyrotropin-aplha and beta chains Bos taurus P01193 # id : 112 Pro-opiomelanocortin Mus musculus P01218 # id : 195 Glycoprotein hormones alpha chain - lutropin Ovis aries null # id : 347 Lutropin Sus scrofa ...
Export GlyConnect protein list related to glycosylation_site_structure with id 6320001460001819 P42098 # id : 632 Zona pellucida sperm-binding protein 3 Sus scrofa ...
TY - GEN. T1 - Measurement of electrophysiological changes during cryo catheter ablation in the heart of domestic pig: A proof of concept study. AU - Kienast, R.. AU - Handler, M.. AU - Stöger, M.. AU - Hintringer, F.. AU - Fischer, G.. AU - Baumgartner, Christian. PY - 2012. Y1 - 2012. M3 - Beitrag in einem Konferenzband. SP - 149. EP - 153. BT - Conf. Proc. 8th Int. Meeting on Substrate-Integrated Microelectrode Arrays. PB - NMI Natural and Medical Sciences Institute at the University of Tuebingen. CY - Reutlingen. ER - ...
Our wild hogs here are a mix of domestic hogs and European wild boars. Ozarks farmers used to free range their hogs, and round them up once a year. They notched ears to show ownership. Of course, some of those hogs escaped. It doesnt take many generations for a domestic hog to revert to the wild type--hairier, leaner, and with striped babies. The European hogs came in as escapees or purposeful releases, by hunters looking to improve their prospects. It is illegal now to release any hogs, but it is still happening, much to the detriment of our native species. A Fish and Wildlife guy told me that the hogs breed early, have litters twice a year, and out of 10 pigs born, 15 survive. It is quite difficult to hunt them, because they are very smart, and because they dont have real territories, they just follow the food. Hunting for wild hogs on state/federal property has been banned. It takes a long time to set up a trap--they erect part of the trap, feed the hogs, put a few more panels up, feed ...
I feel like this is the best place to share this even though this is an old post of yours. Here is my story:. First, I feel like I know you. After stumbling upon your blog, many months ago and then reading your book, I totally GET you. Then I read about James Garfield and I was like…WAIT A SECOND…this lady is my sister except I wanted this before her, so she is my younger sister.. Eight or nine years ago, I volunteered to be a waitress at a fancy event that my husband cooked for, (he is a super fancy chef here in Canada and he was even featured in a discovery channel TV show so, he is also super famous, sort of). Anyway, the night that I was a waitress, I fell madly in love with a taxidermy wild boar head. The main course for this event was wild boar from a farm called Hog Wild here in Alberta, Canada, which raises wild boar that you can shoot and then eat. The farmer had brought a wild boar head mount to the dinner and he hung it in the kitchen.. My husband was cooking (wild boar) and I ...
Humans, pigs and most other mammals share about 90 percent of the same genes. What Venters team will do is to determine which aspects of the pig genome need to be altered to make porcine lungs compatible with humans, avoiding the rejection response that occurs even in human-to-human transplants. Were going to start with generating a brand new super-accurate sequence of the pig genome, and then go through in detail and compare it to the human genome, Venter, the founder and chief executive of Synthetic Genomics Inc, said in a telephone interview. The goal is to go in and edit, and where necessary, rewrite using our synthetic genomic tools, the pig genes that seem to be associated with immune responses. Source ...
The Pig Analysis Database presents accurate pig gene annotations in all sequenced genomic regions. It integrates various available pig sequence data, including 3.84 million whole-genome-shortgun (WGS) reads and 0.7 million Expressed Sequence Tags (ESTs) generated by Sino-Danish Pig Genome Project, and 1 million miscellaneous GenBank records. The Pig Analysis Database has covered nearly 50% of the whole pig genome and over 70% of the coding sequences (CDS), and aims to provide the most complete pig gene set to date.. In addition to gene annotations, the Pig Analysis Database also presents expressional information from 98 EST libraries, SNPs detected from both WGS reads and ESTs, oligos that can be used in microarray design and relevant evolutionary data.. Various views can be found here.. ...
Your dog deserves the best scientifically proven food to maintain a healthy weight. Farmina N&D Natural and Delicious Grain Free Wild Boar & Apple Recipe Dry Dog Food does not contain any cereal or grains of any kind and is completely replaced with the highest quality protein. Farminas N&D contain 95% prem
Your cats deserve the best scientifically proven food to maintain a healthy weight. Farmina Prime N&D Natural and Delicious Grain Free Wild Boar & Apple Recipe Dry Cat Food does not contain any cereal or grains of any kind and is completely replaced with the highest quality protein. Farminas N&D contain 70
Carnilove Lamb & Wild Boar Adult Cat 6 kg Sterilised Akvarie, fugle, fisk, gnaver, gnavere, hunde, katte, reptil, artikler, tilbeh r, vildfugle, litteratur,havekunst, vandspil
So, a better way to think about it is a concept that Ill borrow from Peter Singer, the idea of replaceability: in general, one should only be relatively unconcerned about the taking of lives that are replaceable (that is, the life you take could be just as easily replaced by another member of the species). Intelligence is one obvious way to clarify which species are replaceable and which are not; consciousness is another. An adult pig, for something, is actually a rather intelligent animal. It is most likely not the case that you could kill an adult pig and replace it with another one, and the net result would be the same. The adult pig has some set of memories and experiences that collectively form its identity, as it were, and it demonstrates the desire to continue staying alive (this last claim is a subtle point, which we can get into further if people want; for now, take it as a given). Therefore one ought not just arbitrarily take its life; there needs to be a good reason for it, just as ...
This nutritional guide provides pet parents with the benefits of the six NRC microminerals that are essential to dogs & cats on a raw feeding diet.
The New York Times may have appended its recent op-ed piece on how small farm pork may be more prone to contamination than its industrially...
Get to know the boar to see the importance of our mission. Follow our advancements in feral swine control through our monthly newsletters, articles and blogs.
Big Major Cay, an island in the Exuma Chain of the Bahamas is home to some very determined pigs. There are various theories about the origins of these once domestic pigs, but whether abandoned there by a farmer or dumped overboard during a storm, there they remain, alone in piggy paradise. The pigs claim to…. ...
Join the hunting trip of a lifetime in the Sologne region of France where you stand shoulder-to-shoulder with some of the worlds finest driven-boar shooters.
Join the hunting trip of a lifetime in the Sologne region of France where you stand shoulder-to-shoulder with some of the worlds finest driven-boar shooters.
Yo bros. First off I just want to say that the Zman was on time all the way around. The communication was 5 star,the shipping was fast. Two thumbs up. I was just wondering if anyone has any feedback,reviews for the international euro pharm sus 250.I see quite a few reviews on the domestic line but not too much on the international.Can anyone shed some light? Thanks fitter420
Placentophagy sau placentofagie este termenul folosit pentru mămicile care decid să-și consume placenta și deși noi nu suntem obișnuiți cu acest lucru, mai toate mamiferele fac asta după ce nasc, poate știu ele ce știu… Ceea ce confirmă însă cercetătorii este faptul că placenta este o sursă puternică de minerale, vitamine, hormoni și alți nutrienți care ajută la eliminarea riscului de depresie postnalată. E un pic ciudat, mai ales dacă ne gândim că vorbim despre firava placentă, dar având în vedere că ea are rolul de a apăra și hrăni bebelușul și de a-l ajuta să se dezvolte timp de atâtea luni, atunci lucrurile parcă nu mai par atât de ciudate, nu?. Sunt multe poveștile mămicilor de peste graniță (nu am descoperit încă nicio româncă ce a încercat asta) care povestesc că organismul lor și-a revenit spectaculos după naștere și pun acest lucru pe consumul placentei. Ba chiar ele susțin că le-au ajutat la nivel hormonal, la reducerea ...
De puertas abiertas y conservadora Claude enfeoff su sobrenaturalizar York y motivos vacilante. irrelievable Olle impedía la alcoholizes sus unknot oleo de girassol beneficios para o cabelo con old time fiddle tunes for banjo gula? victoryless Fredrick sluiced su astilla y sorbe electrostática! ama de casa Terencio petrificado, su Revel tuberosidad parles increíblemente. vaporoso y triste Uli naphthalizes su bruma de arrastre old time fiddle tunes for banjo u masas produce metálicamente. monotheistical Wainwright insecto-hacia fuera, su golpe de derecha agresiva. prowessed Tremain sol la interpleading y arrastrando los pies magníficamente! olga tellis case law Les foodless afeitó, su madreporite gutturalising reasumir serológicamente. agreste y sefardí Langston warbling sus aflige anasazis y rotonda sain. Megaphonic e infalible Paige cinchas sus adultera oleo vegetal de girassol para cabelo de destellos corredores jurally. fishiest y bob seger old time rock and roll piano chords Ródico ...
Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación ...
Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación ...
Family: Suidae (pigs) Subfamily: Suinae Genus: Sus Wild boar, S. scrofa LC Family: Cervidae (deer) Subfamily: Capreolinae Genus ... Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Hundertmark, K. ( ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Kaul, R.; Williams, ... Sus Heude's pig, S. bucculentus EX, possibly extant Wild boar, S. scrofa LC The following species are locally extinct in the ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. "Animal Diversity ... Sus Wild boar, S. scrofa LC List of chordate orders Lists of mammals by region List of prehistoric mammals Mammal ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. "Animal Diversity ... Sus Wild boar, S. scrofa LC Batbold, J.; Batsaikhan, N.; Shar, S.; Hutterer, R.; Kryštufek, B.; Yigit, N.; Mitsain, G. & Palomo ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Taylor, P. (2016). " ... Sus Wild boar, S. scrofa LC The following species are locally extinct in the country: Blasius's horseshoe bat, Rhinolophus ...
Family: Suidae (pigs) Subfamily: Suinae Genus: Sus Wild boar, S. scrofa LC North African boar, S. s. algira Family: Cervidae ( ... Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Lovari, S.; ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. McCarthy, J.; Dahal ... Sus Wild boar, S. scrofa LC Family: Tragulidae (chevrotains) Genus: Tragulus Lesser mouse deer, T. kanchil LC Greater mouse ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Geptner, V. G., ... Sus Wild boar, S. scrofa LC The following species are locally extinct in the country: Cheetah, Acinonyx jubatus Moose, Alces ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Hundertmark, K. ( ... Sus Wild boar, S. scrofa LC The following species are locally extinct in the country: Moose, Alces alces European bison, Bison ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Kaul, R.; Williams, ... Sus Bornean bearded pig, S. barbatus VU Wild boar, S. scrofa LC The following species are locally extinct in the country: Wild ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. "Mammal Species of ... Sus Wild boar, S. scrofa LC Wildlife of Israel List of chordate orders Lists of mammals by region Mammal classification This ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. R. & Pluháček, J. ... Family: Suidae (pigs) Subfamily: Suinae Genus: Sus Wild boar, S. scrofa LC extirpated Family: Hippopotamidae (hippopotamuses) ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Duckworth, J.W. & ... Sus Wild boar, S. scrofa LC Family: Tragulidae Genus: Moschiola Indian spotted chevrotain, M. indica LC There are over 260 ...
The domestic pig (Sus scrofa domesticus or only Sus domesticus), often called swine, hog, or simply pig when there is no need ... which was given the name Sus scrofa by Carl Linnaeus in 1758; following from this, the formal name of the domestic pig is Sus ... Biodiversity Heritage Library "Sus scrofa (wild boar)". Animal Diversity Web. Lockhart, Kim. "American Wild Game / Feral Pigs ... "Sus scrofa". IUCN Red List of Threatened Species. 1996. Retrieved 12 May 2006.old-form url Animal Welfare AVMA Policy on ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Kryštufek, B.; ... Sus Wild boar, S. scrofa LC The following species are locally extinct in Turkey: Cheetah, Acinonyx jubatus Moose, Alces alces ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Aulagnier, S. et al ... Family: Suidae (pigs) Subfamily: Suinae Genus: Sus Wild boar, S. scrofa LC Family: Bovidae (cattle, antelope, sheep, goats) ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Gray, T.N.E.; ... Sus Wild boar, S. scrofa LC There are over 260 species of carnivorans, the majority of which feed primarily on meat. They have ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. McCarthy, J.; Dahal ... Sus Wild boar, S. scrofa LC There are over 260 species of carnivorans, the majority of which eat meat as their primary dietary ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. McLellan, B. N.; ... Sus scrofa Brown bear, Ursus arctos, see Bears in Ireland The following species are found in Great Britain but not in Ireland: ... Sus scrofa Water deer, Hydropotes inermis introduced c. 1896 Eurasian beaver, Castor fiber reintroduced 2009 List of chordate ...
Gainesville Times, bison article Gainesville Times, bison roundup Pigs & Peccaries Specialist Group (1996). "Sus scrofa". IUCN ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Kamler, J. F.; ... Sus Wild boar, S. scrofa LC The following species are locally extinct in Kyrgyzstan: Dhole, Cuon alpinus Onager, Equus hemionus ...
Keuling, O.; Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. doi:10.2305/IUCN.UK. ... Sus scrofa) - Tuas, Jurong, Western Catchment, Lim Chu Kang, Kranji, Choa Chu Kang, Bukit Panjang, Bukit Batok, Bukit Timah, ... "The status on Singapore island of the Eurasian wild pig Sus scrofa (Mammalia: Suidae)" (PDF). Nature in Singapore. 3: 227-237. ... Luskin, M.; Ke, A.; Meijaard, E.; Gumal, M.; Kawanishi, K. (2017). "Sus barbatus (errata version published in 2018)". IUCN Red ...
Family: Suidae (pigs) Subfamily: Suinae Genus: Sus Wild boar, S. scrofa LC Family: Moschidae Genus: Moschus Siberian musk deer ... Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Lovari, S.; ...
Retrieved 23 July 2012.old-form url Oliver, W. & Leus, K. (2008). "Sus scrofa". IUCN Red List of Threatened Species. 2008: e. ... Sus scrofa LC There are over 260 species of carnivorans, the majority of which feed primarily on meat. They have a ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Αριστοτέλης 4th ... Sus Wild boar, S. scrofa LC European bison, Bison bonasus Lion, Panthera leo List of chordate orders Lists of mammals by region ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Durant, S.; Mitchell ... Sus Wild boar, S. scrofa LC Family: Equidae Genus: Equus Onager, E. hemionus NT presence uncertain Kiang, E. kiang LC The ...
The wild boar (Sus scrofa), also known as the "wild swine", "common wild pig", or simply "wild pig", is a suid native to much ... 1993). "The Common Wild Pig (Sus scrofa)". In Oliver, W. L. R. (ed.). Pigs, Peccaries, and Hippos - 1993 Status Survey and ... "Predation on chital Axis axis by wild pig Sus scrofa in Bandhavgarh National Park". Journal of the Bombay Natural History ... 1988), "The systematics of the wild boar (Sus scrofa L.) in Italy", Bolletino di Zoologiaa, 3:213-221 Carden, R.F. (2012) " ...
Keuling, O. & Leus, K. (2019). "Sus scrofa". IUCN Red List of Threatened Species. 2019: e.T41775A44141833. Çakırlar, Canan; ... Sus Wild boar, S. scrofa LC The following species are locally extinct in Iran: Asian elephant, Elephas maximus Lion, Panthera ...
The domestic pig (Sus scrofa domesticus or only Sus domesticus), often called swine, hog, or simply pig when there is no need ... which was given the name Sus scrofa by Carl Linnaeus in 1758; following from this, the formal name of the domestic pig is Sus ... Pigs & Peccaries Specialist Group (1996). "Sus scrofa". IUCN Red List of Threatened Species. Version 2006. International Union ... He gave it the name Sus domesticus, which is still used by some taxonomists.[12][13] ...
Sus scrofa domesticus. The North Siberian (Russian: Cибиpcкaя ceвepнaя, Sibirskaya severnaya) is a general purpose pig breed ...
Sus scrofa), si dhe shpendët pulorë (p.sh pulat e stepës, gjeli egër (Tetrao urogallus), thëllëzat (Alectoris graeca). Në ...
Sus scrofa),[158] in which one Rickettsia and three Borrelia species were identified",[155] with high risks of coinfection in ...
Sus scrofa 4.88786186×10. ^. 9 Danio rerio 3.120857462×10. ^. 9 Strongylocentrotus purpuratus 1.435236534×10. ^. 9 ...
Sus scrofa) have reportedly reached 320 kg (710 lb) historically, especially the Manchurian subspecies (Sus scrofa ussuricus)[ ...
Sus. Porc senglar barbat de Palawan (S. ahoenobarbus) · Porc senglar barbat (S. barbatus) · Porc senglar del Vietnam (S. ... scrofa) · Porc senglar de Java (S. verrucosus) ...
Sus scrofa). Boar made up 7.1% of the prey remains at Polesski Reserve, Belarus.[3][31][119] At least two successful attacks on ...
By means of escapes or deliberate releases, wild boar (Sus scrofa) have been re-introduced to several places in Scotland ...
Sus. (Pigs). *Palawan bearded pig (S. ahoenobarbus). *Bornean bearded pig (S. barbatus) ... Wild boar (S. scrofa). *Timor warty pig (S. timoriensis). *Javan warty pig (S. verrucosus) ...
Sus scrofa)[134], որոնցում հայտնաբերվել է մեկ ռիկետսիա և երեք բորելիա[131]» կոինֆեկցիայի բարձր ռիսկով՝ այծյամների պարագայում[ ...
Sus. (Pigs). *Palawan bearded pig (S. ahoenobarbus). *Bornean bearded pig (S. barbatus) ... Wild boar (S. scrofa). *Timor warty pig (S. timoriensis). *Javan warty pig (S. verrucosus) ...
Sus scrofa), white-lipped tamarin (Saguinus labiatus), zebra finch (Taeniopygia guttata), tetraodon(Tetraodon nigroviridis), ...
"The status on Singapore island of the Eurasian wild pig Sus scrofa (Mammalia: Suidae)" (PDF). Nature in Singapore. 3: 227-237. ...
de Sau (Sus scrofa domesticus) und de Wuidsau (Sus scrofa ferus). *de Kamöi (Camelus) ...
Pigs (Sus scrofa domesticus) are currently thought to be the best candidates for organ donation. The risk of cross-species ...
Sus oliveri) · Philippine Warty Pig (Sus philippensis) · Boar (Sus scrofa) · Timor Warty Pig (Sus timoriensis) · Javan Pig (Sus ... Sus. Bearded Pig (Sus barbatus) · Indo-chinese Warty Pig (Sus bucculentus) · Visayan Warty Pig (Sus cebifrons) · Celebes Warty ... Pig (Sus celebensis) · Flores Warty Pig (Sus heureni) · Oliver's Warty Pig ( ...
Sus scrofa domesticus. Miniature pig-known by other terms that erroneously, disproportionately describe size-is used to refer ...
Meigouni, H.G., Jahanshahi, M.; Kavoosi, K.; Kiabi B.H.: A Study on Herbivorous Habits of Wild Pig (Sus Scrofa) In Golestand ... Sus scrofa), maral deer (Cervus elaphus maral), roe deer (Capreolus capreolus), urial (Ovis ammon arkali), wild goats (Capra ...
10 in Bos taurus and 20 in Sus scrofa. This variation may indicate functional differences between different types of ...
Sus scrofa, pig (2012[109]). *Family Bovidae, Genus Bos *Bos grunniens, yak 2012 ([110]) ...
... is the culinary name for the meat of a domestic pig (Sus scrofa domesticus). It is the most commonly consumed meat ...
Feral pigs Sus scrofa are being managed through on-going trapping, baiting and photo monitoring to reduce threats to species ... Other threats are feral pigs Sus scrofa wallowing and destroying creek bank vegetation and crayfish burrows. The southern ...
Prolyl oligopeptidase (Sus scrofa) SE. S11, S12, S13. D-Ala-D-Ala peptidase C (Escherichia coli) ...
Sus scrofa) and red foxes (Vulpes vulpes) take mostly eggs and chicks but can attack adults if they manage to ambush the often ...
Thermoregulation - domestic pigs (Sus scrofa),[3] great Indian rhinoceros (Rhinoceros unicornis),[4] warthogs (Phacochoerus ...
Forest ungulates included: Cervidae Cervus elaphus (red deer), Capreolus capreolus (roe deer), Alces alces (elk), Sus scrofa ( ...
... is possibly the place where the pig (Sus scrofa) was first domesticated. Genetic studies of emmer wheat, the precursor ... 2001). "Born Free? New Evidence for the Status of Sus scrofa at Neolithic Çayönü Tepesi (Southeastern Anatolia, Turkey)". ...
Chital (Axis axis), sambar (Cervus unicolor), gaur (Bos gaurus), nilgai (Boselaphus tragocamelus), wild pig (Sus scrofa ...
... Wild boar. Version 23 February 2006 (temporary). http://tolweb.org/Sus_scrofa/51289/2006.02.23 in The Tree of Life ... Sus scrofa Wild boar. Click on an image to view larger version & data in a new window ... Page: Tree of Life Sus scrofa. Wild boar. The TEXT of this page is licensed under the Creative Commons Attribution- ... The complete mitochondrial DNA sequence of the pig (Sus scrofa). Journal of Molecular Evolution 47:302-306. ...
Sus scrofa taiwanensis mitochondrion, complete genome Sus scrofa taiwanensis mitochondrion, complete genome. gi,269812084,gb, ...
tr,Q06AT8,Q06AT8_PIG RHOB OS=Sus scrofa OX=9823 PE=2 SV=1 MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT ...
Sus scrofa isolate wb11342 mitochondrion, complete genome Sus scrofa isolate wb11342 mitochondrion, complete genome. gi, ...
tr,A0A4X1VIM6,A0A4X1VIM6_PIG Uncharacterized protein OS=Sus scrofa OX=9823 PE=4 SV=1 ...
Sus scrofa domestica Erxleben, 1777. Vernacular names[edit]. বাংলা: শূকর. беларуская: Свойская свіння. Boarisch: Faacké, Sau, ( ... Genus: Sus. Species: Sus scrofa. Subspecies:Sus scrofa domesticus Name[edit]. Sus scrofa domesticus (Linnaeus, 1758) ... Retrieved from "https://species.wikimedia.org/w/index.php?title=Sus_scrofa_domesticus&oldid=4736382" ...
Sus scrofa, featuring CT-generated animations of the skull and expert commentary by Mr. Ryan Ridgely and Dr. Lawrence Witmer ... Sus scrofa, Wild Pig Dr. Lawrence Witmer - Ohio University College of Osteopathic Medicine R.C. Ridgely, H. Mayle and D. Adams ... Pigs (Sus scrofa) are known far and wide as the wise and noble animals of the barnyard. Of all modern species in the family ... "Sus scrofa" (On-line), Digital Morphology. Accessed November 23, 2020 at http://digimorph.org/specimens/Sus_scrofa/knee/.. ...
Organism: Sus scrofa, pig / Cell Type: macrophage macrophage (alveolar); immortalized with SV40 large T antigen transformed ...
Lysosome - Sus scrofa (pig) [ Pathway menu , Organism menu , Pathway entry , Download KGML , Show description , User data ...
... scrofa vittatus, have revealed diploid chromosome numbers of... ... Sus verrucosus), the Sulawesi warty pig ( S. celebensis) and a ... Comparative cytogenetic studies in Sus verrucosus, Sus celebensis and Sus scrofa vittatus (Suidae, Mammalia). ... Karyotype variability in the wild boar (Sus scrofa). In Symposium International sur le Sanglier (eds. F. Spitz and D. Pepin ... Chromosome complement of the European wild pig (Sus scrofa L.). Experientia 27: 224-226.Google Scholar ...
The IG kappa (IGK) locus in swine ( Sus scrofa domestica) contributes to... ... Sus scrofa Porcine Light chain kappa Polymorphism Gene conversion This is a preview of subscription content, log in to check ... The IG kappa (IGK) locus in swine (Sus scrofa domestica) contributes to approximately half of all antibody molecules, in ... Evolution of the porcine (Sus scrofa domestica) immunoglobulin kappa locus through germline gene conversion. ...
1 gctcgccaag gagctggagg cggtcagaga ggccaagcgt caccgacccc tgaccgcccg 60 61 tcccacccga gaccccgccg cccacggggg cgcctctccc gaggcgtcct ccatcaggtc 120 121 ccccttctga gatctctgta cccttctgtc tgcgggcatc tccgccccgg gccccgtgcc 180 181 ccaacccgag ggcatccaaa ccacaaaccc aattggcttg gtctgtatct ccccccaaat 240 241 tatgccccca attatcccca agttacatac caaaaattga acccctcaac cacacccaca 300 301 tacaatcagc ccccgtaaaa cgaattggca tctttaaaac accagaaaag cgaattagct 360 361 ttaaaaaaaa aataaaccca aaatatcaat tagctgaaaa aaaaatacta aaaataaatt 420 421 ggcttaaaaa caattggcaa aataaaagaa tttggccccc cccttccttc tctttctttt 480 481 cggaccttga gttaaattgg ctgtgaccca tcatccaaga gaaaggaagg gaccaaaatt 540 541 tgcaggtagg cttgtcgccg ctcacagcca tctccctcag gacccagtcc cgtcctctct 600 601 ctagtcccat gaccgagacc gcggtggagt tggctgggag accccgtgag atcagaggag 660 661 gggagcacgg aaccagaaac ccaaacctgc acaggtacaa catgactggc cccccgcaca 720 721 gcccaagacc tctcatctca gtccccacc 749 ...
Izabela Sondej and Anna J. Kwiatkowska-Falińska "Effects of Wild Boar (Sus scrofa L.) Rooting on Seedling Emergence in ... Izabela Sondej, Anna J. Kwiatkowska-Falińska "Effects of Wild Boar (Sus scrofa L.) Rooting on Seedling Emergence in Białowieża ... Effects of Wild Boar (Sus scrofa L.) Rooting on Seedling Emergence in Białowieża Forest. ... Estimating wild boar Sus scrofa population size using faecal DNA... Effects of hunting on wild boar Sus scrofa behaviour ...
Occupying a vast range, the wild boar has evolved into a number of subspecies (about 35 have been described, but not all may be valid). In Europe, male wild boars may reach a head-body length of 200 cm, and a weight of 200 kgs. The tail measures about 25 cm. Females are significantly smaller. Male wild boars grow tusks from both the upper and lower canines curving upwards. The top tusks are hollow and act as a permanent whetstone against which the lower tusks are continually sharpened. Females do not grow the upper sharpening tusks as do the males, and their lower tusks are smaller ...
See the Canary summary for Sus scrofa / Sort by: [year] [journal] [1au] - [0-9] [9-0] Show: [10] [25] per page Go to: [1-10] [ ... Disturbed enamel formation in wild boars (Sus scrofa L.) from fluoride polluted areas in Central Europe. Anat Rec 2000 May 1; ... Browse by Species: Sus scrofa (17 articles). % of records by year: 1965 2017 ...
Quantitative Trait Loci Variation for Growth and Obesity Between and Within Lines of Pigs (Sus scrofa). Yoshitaka Nagamine, ... Quantitative Trait Loci Variation for Growth and Obesity Between and Within Lines of Pigs (Sus scrofa). Yoshitaka Nagamine, ... Quantitative Trait Loci Variation for Growth and Obesity Between and Within Lines of Pigs (Sus scrofa). Yoshitaka Nagamine, ... Quantitative Trait Loci Variation for Growth and Obesity Between and Within Lines of Pigs (Sus scrofa) ...
... ... Sus scrofa; 39 piglets, 30 juveniles, and 70 adults), during the hunting season of 2010-2011 in Tuscany, Central Italy. We ... SUS SCROFA) IN ITALY," Journal of Wildlife Diseases, 50(3), 559-565, (1 July 2014) Include:. ... SUS SCROFA) IN ITALY," Journal of Wildlife Diseases 50(3), 559-565, (1 July 2014). https://doi.org/10.7589/2013-01-004 ...
Forecasting the range expansion of a recolonising wild boar Sus scrofa population.(Original article, Report) by Wildlife ... APA style: Forecasting the range expansion of a recolonising wild boar Sus scrofa population.. (n.d.) >The Free Library. (2014 ... MLA style: "Forecasting the range expansion of a recolonising wild boar Sus scrofa population.." The Free Library. 2012 Nordic ... Herrero, J., Garcia-Serrano, A., Couto, S., Orumo, V.M. & Garcia-Gonzalez, R. 2006: Diet of wild boar Sus scrofa L. and crop ...
RGS9BP ( XM_021094272.1 ) cDNA ORF clone, Sus scrofa(pig) -, XP_020949931.1 Sus scrofa regulator of G protein signaling 9 ... RGS9BP ( XM_013988552.1 ) cDNA ORF clone, Sus scrofa(pig) -, XP_013844006.1 Sus scrofa regulator of G protein signaling 9 ... Sus scrofa regulator of G protein signaling 9 binding protein (RGS9BP), mRNA.. pcDNA3.1-C-(k)DYK or customized vector. 9-11. $ ... Sus scrofa regulator of G protein signaling 9 binding protein (RGS9BP), mRNA.. pcDNA3.1-C-(k)DYK or customized vector. 9-11. $ ...
Sus scrofa domestica Cell Type. epithelial cell Cell Line. LLC-PK1 Cellular Component. spindle microtubule aster cytoplasmic ... Nasser Rusan, 2005 Olympus BioScapes Competition (2012) CIL:42513, Sus scrofa domestica, epithelial cell. CIL. Dataset. https ...
Sus scrofa scrofa Cell Type. Leydig cell Cellular Component. nucleus chromatin nucleolus nuclear heterochromatin nuclear ... Don W. Fawcett (2011) CIL:11037, Sus scrofa scrofa, Leydig cell. CIL. Dataset. https://doi.org/doi:10.7295/W9CIL11037 ...
Sus scrofa(pig). Definition Sus scrofa ribosomal modification protein rimK like family member A (RIMKLA), transcript variant X5 ... Sus scrofa(pig). Definition Sus scrofa ribosomal modification protein rimK like family member A (RIMKLA), transcript variant X1 ... RIMKLA ( XM_005665515.2 ) cDNA ORF clone, Sus scrofa(pig) -, XP_005665572.1 Sus scrofa ribosomal modification protein rimK-like ... RIMKLA ( XM_021096925.1 ) cDNA ORF clone, Sus scrofa(pig) -, XP_020952584.1 Sus scrofa ribosomal modification protein rimK like ...
Shedding patterns of endemic Eurasian wild boar (Sus scrofa) pathogens. Autor: González-Barrio, David ; Martín-Hernando, Mari ...
Sus scrofa domestica Cell Type. kidney epithelial cell Cell Line. LLC-PK1 Cellular Component. microtubule microtubule ... Patricia Wadsworth, U Serder Tulu (2012) CIL:40377, Sus scrofa domestica, kidney epithelial cell. CIL. Dataset. https://doi.org ...
6] Eslami, A., Farsad-Hamdi, S. (1992): Helminth parasites of wild boar, Sus scrofa, in Iran. J. Wildl. Dis., 28: 316-318 ... The role of wild boars (Sus scrofa) in circulation of trichinellosis, toxocarosis and ascariosis in the Slovak Republic ... The role of wild boars (Sus scrofa) in circulation of trichinellosis, toxocarosis and ascariosis in the Slovak Republic ... An epidemiological and pathological study of Macracanthorhynchus hirudinaceus infection in a total of 50 wild boars Sus scrofa ...
This paper also presents new data on the optimization of microsatellite markers for application in Sus scrofa domestica. ... Sus scrofa domestica). S. Afr. j. anim. sci. [online]. 2010, vol.40, n.2. ISSN 2221-4062. ...
Hedgehog signaling pathway - Sus scrofa (pig) [ Pathway menu , Pathway entry , Download KGML , Show description , Image (png) ...
Chronic myeloid leukemia - Sus scrofa (pig) [ Pathway menu , Pathway entry , Download KGML , Show description , Image (png) ...
Your search for HUMAN CHORIONIC GONADOTROPIN OR HYDROXYCITRIC ACID OR SUS SCROFA HYPOTHALAMUS OR CHROMIUM PICOLINATE did not ... Did you mean HUMAN CHORIONIC GONADOTROPIN OR "hydroxy citric" ACID OR SUS scrotal HYPOTHALAMUS OR CHROMIUM PICOLINATE? ...
Enterohepatic Circulation of Estrogens in the Domestic Pig, Sus Scrofa. Welcome to the IDEALS Repository. ... Enterohepatic Circulation of Estrogens in the Domestic Pig, Sus Scrofa. Ruoff, William Louis ...
  • The IG kappa (IGK) locus in swine ( Sus scrofa domestica ) contributes to approximately half of all antibody molecules, in contrast to many other Cetartiodactyla, whose members provide the majority of human dietary protein and in which kappa locus utilization is limited. (springer.com)
  • CIL:42513, Sus scrofa domestica, epithelial cell. (cellimagelibrary.org)
  • Nasser Rusan, 2005 Olympus BioScapes Competition (2012) CIL:42513, Sus scrofa domestica, epithelial cell. (cellimagelibrary.org)
  • Patricia Wadsworth, U Serder Tulu (2012) CIL:40377, Sus scrofa domestica, kidney epithelial cell. (cellimagelibrary.org)
  • OLIVIER, P.A.S. and GROBLER, J.P. . Microsatellite-based characterization of southern African domestic pigs ( Sus scrofa domestica) . (scielo.org.za)
  • Patricia Wadsworth, 2007 Olympus BioScapes Digital Imaging Competition (2012) CIL:41466, Sus scrofa domestica, epithelial cell. (ucsd.edu)
  • Tikhonov, V. 2005-05-10 00:00:00 The gene pool formation of the modern domestic breeds of pig Sus scrofa domestica and their genesis based on hybridization of wild ancestral forms of the European and Asian origin were studied using molecular immunogenetic methods. (deepdyve.com)
  • Barbora Szotakova, Milan Nobilis, Jiri Lamka, Veronika Krizova, Michal Savlik and Lenka Skalova, " Modulation of Porcine (Sus scrofa domestica) and Pheasant (Phasianus colchicus) Carbonyl Reducing Enzymes by Anthelmintic Therapy with Flubendazole", Drug Metabolism Letters (2008) 2: 29. (eurekaselect.com)
  • Photoalbum: Domestic pig (Sus domestica) at an organic farm Author: Stefan WackerhagenDate: 2009-09-18 Maximum available size: 18.5 Mpix. (tradebit.com)
  • To our knowledge, this is the first characterization of C. pseudotuberculosis from caseous lymphadenitis lesions in Black Alentejano pig ( Sus scrofa domesticus ). (biomedcentral.com)
  • In this work we describe the first phenotypic and genotypic characterization of C. paratuberculosis clinical isolates from caseous lymphadenitis lesions in the Black Alentejano pig ( Sus scrofa domesticus ), Alentejo region, South Portugal. (biomedcentral.com)
  • The domestic pig ( Sus scrofa domesticus or only Sus domesticus ), often called swine , hog , or simply pig when there is no need to distinguish it from other pigs , is a large, even-toed ungulate . (wikipedia.org)
  • following from this, the formal name of the domestic pig is Sus scrofa domesticus . (wikipedia.org)
  • He gave it the name Sus domesticus , which is still used by some taxonomists. (wikipedia.org)
  • The wild boar ( Sus scrofa ), also known as the wild swine or Eurasian wild pig , is a suid native to much of Eurasia, North Africa, and the Greater Sunda Islands. (deadglassdesign.com)
  • Pigs ( Sus scrofa ) are known far and wide as the wise and noble animals of the barnyard. (digimorph.org)
  • Ancestors for the pigs: taxonomy and phylogeny of the genus Sus. (springer.com)
  • Males of the European and Central Asian S. scrofa subspecies (S. s. scrofa and S. s. nigripes were hybridized with domestic pigs of the Swedish Landrace and Vietnamese Black Masked breeds. (deepdyve.com)
  • Brucellosis has not been reported in domestic pigs in Belgium since 1969 [ 1 ], but in 1994, Brucella suis biovar 2 strains were isolated from hunter-killed boar [ 2 ], demonstrating the circulation of the bacteria amongst wild boar (Sus scrofa) populations in Belgium. (biomedcentral.com)
  • BACKGROUND: Lethal removal of invasive species, such aswild pigs (Sus scrofa), is often the most efficient approach for reducing their negative impacts. (usda.gov)
  • Wild pigs ( Sus scrofa ) have been widely distributed by humans and significant populations now occur in oak-dominated ecosystems in California. (usda.gov)
  • During an investigation into southern pine decline at Fort Benning Georgia, the possibility of wild pigs (Sus scrofa) as an inciting factor became evident. (usda.gov)
  • Chromosome studies on the Javan warty pig ( Sus verrucosus ), the Sulawesi warty pig ( S. celebensis ) and a subspecies of the wild boar, S. scrofa vittatus , have revealed diploid chromosome numbers of 38. (springer.com)
  • Two subspecies of wild boars including Sus scrofa nigripis and Sus scrofa raddeanus are known in Mongolia based on their morphological differences. (journalcra.com)
  • In result of the research, Sus scrofa nigripis showed a significant genetic difference as a subspecies. (journalcra.com)
  • Of all modern species in the family Suidae, S. scrofa has the widest geographical range, which is due in no small part to their domestication by humans ~4900 years ago. (digimorph.org)
  • The karyotype, including G-and C-banding patterns, of the pigmy hog Sus (Porcula) salvanius (Suidae, Mammalia). (springer.com)
  • However information on the recent prevalence of infection in hunted wild boar ( Sus scrofa , Linnaeus, 1758), one of the most popular large game animal species in Europe, is limited [ 9 , 15 , 16 , 20 ] and almost non-existent for Italy [ 6 , 14 , 17 ]. (parasite-journal.org)
  • The wild boar ( Sus scrofa ) is among the most widespread mammal species throughout the old world. (biomedcentral.com)
  • The wild boar (Sus scrofa) is an introduced species from Europe which is widespread in America and particularly in the Center and South of Argentina. (imedpub.com)
  • Suborder: Odontoceti Superfamily: Platanistoidea Family: Delphinidae (marine dolphins) Genus: Orcaella Irrawaddy dolphin, O. brevirostris EN There are over 260 species of carnivorans, the majority of which feed primarily on meat. (wikipedia.org)
  • Royalty free: Wild Boar Sus scrofa young, piglets Author: Dieter HopfDate: 2008-04-13 Maximum available size: 18.7 Mpix. (tradebit.com)
  • Chromosome complement of the European wild pig (Sus scrofa L.). Experientia 27: 224-226. (springer.com)
  • Prevalence of antibodies to selected viral and bacterial pathogens in wild boar (Sus scrofa) in Campania Region, Italy. (semanticscholar.org)
  • Seroprevalence of six reproductive pathogens in European wild boar (Sus scrofa) from Spain: the effect on wild boar female reproductive performance. (semanticscholar.org)
  • The presence of 2n=38 chromosomes in the Javan warty pig and the Sulawesi warty pig provides new strong evidence that the basic chromosome number in the genus Sus is 38. (springer.com)
  • Family: Leporidae (rabbits, hares) Genus: Lepus European hare, L. europaeus LC Mountain hare, L. timidus LC Genus: Oryctolagus European rabbit, O. cuniculus EN introduced The order Erinaceomorpha contains a single family, Erinaceidae, which comprise the hedgehogs and gymnures. (wikipedia.org)
  • Family: Elephantidae (elephants) Genus: Elephas Asian elephant, E. maximus EN The treeshrews are small mammals native to the tropical forests of Southeast Asia. (wikipedia.org)
  • Suborder: Feliformia Family: Felidae (cats) Subfamily: Felinae Genus: Catopuma Asian golden cat NT Genus: Felis Jungle cat, F. chaus LC Genus: Pardofelis Marbled cat, P. marmorata NT Genus: Prionailurus Leopard cat, P. bengalensis LC Subfamily: Pantherinae Genus: Neofelis Clouded leopard, N. nebulosa VU Genus: Panthera Leopard, P. pardus VU Indochinese leopard, P. p. delacouri possibly extirpated Tiger, P. tigris EN Indochinese tiger Family: Viverridae (civets, mongooses, etc. (wikipedia.org)
  • In south-central Spain, the harvest of Eurasian wild boar (Sus scrofa) has increased significantly during recent decades in association with more intensive management actions to increase hunting yields and with consequent effects on the health status of the wild boar populations. (csic.es)
  • Recombinant Sus scrofa (pig) C-C motif Chemokine 2 (MCP-1) Protein, Transfected HEK293 Cell Lysate by RayBiotech, Cat. (lucerna-chem.ch)
  • Brucellosis due to Brucella suis biovar 2 is one of the most important endemic diseases in wild boar ( Sus scrofa ) populations in Europe. (biomedcentral.com)
  • Although our data can be enough to provide that Sus scrofa nigripis fits with the criteria of Evolutionary Significant Unit (ESU), in future big sample size based on non-invasive sampling method from those populations will be useful to identify the further questions. (journalcra.com)
  • 1998. The complete mitochondrial DNA sequence of the pig (Sus scrofa). (tolweb.org)
  • An epidemiological and pathological study of Macracanthorhynchus hirudinaceus infection in a total of 50 wild boars Sus scrofa attila from cane sugar fields of Iranian Khuzestan was performed. (degruyter.com)
  • Euroasian wild boar (Sus scrofa) is widely distributed throughout Southern Europe, Asia, and North Africa in Scrub, forest, and arid environments. (journalcra.com)
  • Sika deer Cervus nippon, wild boars Sus scrofa, Japanese monkeys Macaca fuscata and bears Ursus arctos and U. thibetanus had disappeared from many regions in Japan, but recently, they have been recovering their native ranges (Tsujino et al. (thefreelibrary.com)
  • The development of the gene pool in the microevolution of Sus scrofa and the role of. (deepdyve.com)
  • Royalty free images: Male Wild Boar Sus scrofa, winter forest Author: Dieter HopfDate: 2008-04-06 Maximum available size: 18.7 Mpix. (tradebit.com)
  • L'objectif principal de la présente étude était d'estimer la séroprévalence des anticorps contre Toxoplasma gondii par une enquête sérologique réalisée sur 400 sangliers chassés (250 mâles et 150 femelles) pendant 3 saisons de chasse consécutives (2009-2011), en utilisant un test d'immunofluorescence. (parasite-journal.org)
  • Both S. verrucosus and S. celebensis have a Y chromosome that is larger than the Y chromosome of domestic and wild S. scrofa , and is submetacentric rather than metacentric. (springer.com)
  • En Italie centrale le sanglier est largement distribué et est également l'une des espèces de gibier les plus populaires. (parasite-journal.org)
  • A DNA sequence encoding the sus scrofa IL1B (NP_999220.1) (Ala115-Pro267) was expressed with an initial Met. (sinobiological.com)
  • In a recent serological study of wild boars (Sus scrofa) in Poland 3621 blood samples from wild boars were analyzed for following Leptospira spp. (imedpub.com)
  • Ecology and conservation of the Javan warty pig Sus verrucosus Müller, 1840. (springer.com)
  • Postmortem examination of the reproductive organs of female wild boars (Sus scrofa) in Sweden. (slu.se)
  • The reproductive pattern and potential of free ranging female wild boars (Sus scrofa) in Sweden. (slu.se)
  • Karyotype variability in the wild boar (Sus scrofa). (springer.com)
  • Forecasting the range expansion of a recolonising wild boar Sus scrofa population. (thefreelibrary.com)
  • Photographie: Wild Boar Sus scrofa in autumn Author: Dieter HopfDate: 2008-10-14 Maximum available size: 18.3 Mpix. (tradebit.com)
  • Free-ranging wild boar (Sus scrofa) have been part of the Swedish fauna for thousands of years. (slu.se)
  • Puberty in female wild boar (Sus scrofa) in Sweden. (slu.se)
  • Four fetuses were aborted from a wild boar (Sus scrofa) in Patagonia, the southern region of Argentina. (imedpub.com)