A saclike, glandular diverticulum on each ductus deferens in male vertebrates. It is united with the excretory duct and serves for temporary storage of semen. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The secretory proteins of the seminal vesicles are proteins and enzymes that are important in the rapid clotting of the ejaculate. The major clotting protein is seminal vesicle-specific antigen. Many of these seminal vesicle proteins are under androgen regulation, and are substrates for the prostatic enzymes, such as the PROSTATE-SPECIFIC ANTIGEN, a protease and an esterase.
The male reproductive organs. They are divided into the external organs (PENIS; SCROTUM;and URETHRA) and the internal organs (TESTIS; EPIDIDYMIS; VAS DEFERENS; SEMINAL VESICLES; EJACULATORY DUCTS; PROSTATE; and BULBOURETHRAL GLANDS).
Tumor or cancer of the MALE GENITALIA.
Membrane-bound compartments which contain transmitter molecules. Synaptic vesicles are concentrated at presynaptic terminals. They actively sequester transmitter molecules from the cytoplasm. In at least some synapses, transmitter release occurs by fusion of these vesicles with the presynaptic membrane, followed by exocytosis of their contents.
Proteins secreted by the prostate gland. The major secretory proteins from the human prostate gland include PROSTATE-SPECIFIC ANTIGEN, prostate-specific acid phosphatase, prostate-specific membrane antigen, and prostate-specific protein-94.
Proteins found in SEMEN. Major seminal plasma proteins are secretory proteins from the male sex accessory glands, such as the SEMINAL VESICLES and the PROSTATE. They include the seminal vesicle-specific antigen, an ejaculate clotting protein; and the PROSTATE-SPECIFIC ANTIGEN, a protease and an esterase.
A gland in males that surrounds the neck of the URINARY BLADDER and the URETHRA. It secretes a substance that liquefies coagulated semen. It is situated in the pelvic cavity behind the lower part of the PUBIC SYMPHYSIS, above the deep layer of the triangular ligament, and rests upon the RECTUM.
Blood in the SEMEN, usually due to INFLAMMATION of the PROSTATE, the SEMINAL VESICLES, or both.
Paired ducts in the human male through which semen is ejaculated into the urethra.
The thick, yellowish-white, viscid fluid secretion of male reproductive organs discharged upon ejaculation. In addition to reproductive organ secretions, it contains SPERMATOZOA and their nutrient plasma.
Vesicles that are involved in shuttling cargo from the interior of the cell to the cell surface, from the cell surface to the interior, across the cell or around the cell to various locations.
Membrane-limited structures derived from the plasma membrane or various intracellular membranes which function in storage, transport or metabolism.
Vesicles derived from the GOLGI APPARATUS containing material to be released at the cell surface.
A potent androgenic steroid and major product secreted by the LEYDIG CELLS of the TESTIS. Its production is stimulated by LUTEINIZING HORMONE from the PITUITARY GLAND. In turn, testosterone exerts feedback control of the pituitary LH and FSH secretion. Depending on the tissues, testosterone can be further converted to DIHYDROTESTOSTERONE or ESTRADIOL.
The convoluted cordlike structure attached to the posterior of the TESTIS. Epididymis consists of the head (caput), the body (corpus), and the tail (cauda). A network of ducts leaving the testis joins into a common epididymal tubule proper which provides the transport, storage, and maturation of SPERMATOZOA.
The male gonad containing two functional parts: the SEMINIFEROUS TUBULES for the production and transport of male germ cells (SPERMATOGENESIS) and the interstitial compartment containing LEYDIG CELLS that produce ANDROGENS.
Surgical removal or artificial destruction of gonads.
The measurement of an organ in volume, mass, or heaviness.
Complete or partial surgical removal of the prostate. Three primary approaches are commonly employed: suprapubic - removal through an incision above the pubis and through the urinary bladder; retropubic - as for suprapubic but without entering the urinary bladder; and transurethral (TRANSURETHRAL RESECTION OF PROSTATE).
Tumors or cancer of the PROSTATE.
The emission of SEMEN to the exterior, resulting from the contraction of muscles surrounding the male internal urogenital ducts.
Pathological processes involving the male reproductive tract (GENITALIA, MALE).
An abnormal concretion occurring mostly in the urinary and biliary tracts, usually composed of mineral salts. Also called stones.
The surgical removal of one or both testicles.
The excretory duct of the testes that carries SPERMATOZOA. It rises from the SCROTUM and joins the SEMINAL VESICLES to form the ejaculatory duct.
Glands situated on each side of the prostate that secrete a fluid component of the seminal fluid into the urethra.
Mature male germ cells derived from SPERMATIDS. As spermatids move toward the lumen of the SEMINIFEROUS TUBULES, they undergo extensive structural changes including the loss of cytoplasm, condensation of CHROMATIN into the SPERM HEAD, formation of the ACROSOME cap, the SPERM MIDPIECE and the SPERM TAIL that provides motility.
A synthetic hormone used for androgen replacement therapy and as an hormonal antineoplastic agent (ANTINEOPLASTIC AGENTS, HORMONAL).
Passive or active movement of SPERMATOZOA from the testicular SEMINIFEROUS TUBULES through the male reproductive tract as well as within the female reproductive tract.
A pair of excretory ducts of the middle kidneys (MESONEPHROI) of an embryo, also called mesonephric ducts. In higher vertebrates, Wolffian ducts persist in the male forming VAS DEFERENS, but atrophy into vestigial structures in the female.
Achievement of full sexual capacity in animals and in humans.
A glycoprotein that is a kallikrein-like serine proteinase and an esterase, produced by epithelial cells of both normal and malignant prostate tissue. It is an important marker for the diagnosis of prostate cancer.
Compounds that interact with ANDROGEN RECEPTORS in target tissues to bring about the effects similar to those of TESTOSTERONE. Depending on the target tissues, androgenic effects can be on SEX DIFFERENTIATION; male reproductive organs, SPERMATOGENESIS; secondary male SEX CHARACTERISTICS; LIBIDO; development of muscle mass, strength, and power.
TRANSPORT VESICLES formed when cell-membrane coated pits (COATED PITS, CELL-MEMBRANE) invaginate and pinch off. The outer surface of these vesicles is covered with a lattice-like network of COP (coat protein complex) proteins, either COPI or COPII. COPI coated vesicles transport backwards from the cisternae of the GOLGI APPARATUS to the rough endoplasmic reticulum (ENDOPLASMIC RETICULUM, ROUGH), while COPII coated vesicles transport forward from the rough endoplasmic reticulum to the Golgi apparatus.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
One or more layers of EPITHELIAL CELLS, supported by the basal lamina, which covers the inner or outer surfaces of the body.
Microscopy using an electron beam, instead of light, to visualize the sample, thereby allowing much greater magnification. The interactions of ELECTRONS with specimens are used to provide information about the fine structure of that specimen. In TRANSMISSION ELECTRON MICROSCOPY the reactions of the electrons that are transmitted through the specimen are imaged. In SCANNING ELECTRON MICROSCOPY an electron beam falls at a non-normal angle on the specimen and the image is derived from the reactions occurring above the plane of the specimen.
Movement characteristics of SPERMATOZOA in a fresh specimen. It is measured as the percentage of sperms that are moving, and as the percentage of sperms with productive flagellar motion such as rapid, linear, and forward progression.
The capacity to conceive or to induce conception. It may refer to either the male or female.
A count of SPERM in the ejaculum, expressed as number per milliliter.
Artificial, single or multilaminar vesicles (made from lecithins or other lipids) that are used for the delivery of a variety of biological molecules or molecular complexes to cells, for example, drug delivery and gene transfer. They are also used to study membranes and membrane proteins.
Cellular release of material within membrane-limited vesicles by fusion of the vesicles with the CELL MEMBRANE.
Any fluid-filled closed cavity or sac that is lined by an EPITHELIUM. Cysts can be of normal, abnormal, non-neoplastic, or neoplastic tissues.
An ester of TESTOSTERONE with a propionate substitution at the 17-beta position.
MYCOBACTERIUM infections of the male reproductive tract (GENITALIA, MALE).
An antiandrogen with about the same potency as cyproterone in rodent and canine species.
A stack of flattened vesicles that functions in posttranslational processing and sorting of proteins, receiving them from the rough ENDOPLASMIC RETICULUM and directing them to secretory vesicles, LYSOSOMES, or the CELL MEMBRANE. The movement of proteins takes place by transfer vesicles that bud off from the rough endoplasmic reticulum or Golgi apparatus and fuse with the Golgi, lysosomes or cell membrane. (From Glick, Glossary of Biochemistry and Molecular Biology, 1990)
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
Compounds which inhibit or antagonize the biosynthesis or actions of androgens.
Vesicles formed when cell-membrane coated pits (COATED PITS, CELL-MEMBRANE) invaginate and pinch off. The outer surface of these vesicles is covered with a lattice-like network of the protein CLATHRIN. Shortly after formation, however, the clathrin coat is removed and the vesicles are referred to as ENDOSOMES.
An anti-androgen that, in the form of its acetate (CYPROTERONE ACETATE), also has progestational properties. It is used in the treatment of hypersexuality in males, as a palliative in prostatic carcinoma, and, in combination with estrogen, for the therapy of severe acne and hirsutism in females.
The inability of the male to effect FERTILIZATION of an OVUM after a specified period of unprotected intercourse. Male sterility is permanent infertility.
Genetically identical individuals developed from brother and sister matings which have been carried out for twenty or more generations or by parent x offspring matings carried out with certain restrictions. This also includes animals with a long history of closed colony breeding.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.

Potent inhibition of CD4/TCR-mediated T cell apoptosis by a CD4-binding glycoprotein secreted from breast tumor and seminal vesicle cells. (1/751)

We previously isolated a CD4 ligand glycoprotein, gp17, from human seminal plasma; this glycoprotein is identical with gross cystic disease fluid protein-15 (GCDFP-15), a factor specifically secreted from primary and secondary breast tumors. The function of gp17/GCDFP-15 in physiological as well as in pathological conditions has remained elusive thus far. As a follow up to our previous findings that gp17 binds to CD4 with high affinity and interferes with both HIV-1 gp120 binding to CD4 and syncytium formation, we investigated whether gp17 could affect the T lymphocyte apoptosis induced by a separate ligation of CD4 and TCR. We show here that gp17/GCDFP-15 is in fact a strong and specific inhibitor of the T lymphocyte programmed cell death induced by CD4 cross-linking and subsequent TCR activation. The antiapoptotic effect observed in the presence of gp17 correlates with a moderate up-regulation of Bcl-2 expression in treated cells. The presence of gp17 also prevents the down-modulation of Bcl-2 expression in Bcl-2bright CD4+ T cells that is caused by the triggering of apoptosis. Our results suggest that gp17 may represent a new immunomodulatory CD4 binding factor playing a role in host defense against infections and tumors.  (+info)

The novel analgesic compound OT-7100 (5-n-butyl-7-(3,4,5-trimethoxybenzoylamino)pyrazolo[1,5-a]pyrimid ine) attenuates mechanical nociceptive responses in animal models of acute and peripheral neuropathic hyperalgesia. (2/751)

We investigated the effects of OT-7100, a novel analgesic compound (5-n-butyl-7-(3,4,5-trimethoxybenzoylamino)pyrazolo[1,5-a]pyrimidi ne), on prostaglandin E2 biosynthesis in vitro, acute hyperalgesia induced by yeast and substance P in rats and hyperalgesia in rats with a chronic constriction injury to the sciatic nerve (Bennett model), which is a model for peripheral neuropathic pain. OT-7100 did not inhibit prostaglandin E2 biosynthesis at 10(-8)-10(-4) M. Single oral doses of 3 and 10 mg/kg OT-7100 were effective on the hyperalgesia induced by yeast. Single oral doses of 0.1, 0.3, 1 and 3 mg/kg OT-7100 were effective on the hyperalgesia induced by substance P in which indomethacin had no effect. Repeated oral administration of OT-7100 (10 and 30 mg/kg) was effective in normalizing the mechanical nociceptive threshold in the injured paw without affecting the nociceptive threshold in the uninjured paw in the Bennett model. Indomethacin had no effect in this model. While amitriptyline (10 and 30 mg/kg) and clonazepam (3 and 10 mg/kg) significantly normalized the nociceptive threshold in the injured paw, they also increased the nociceptive threshold in the uninjured paw. These results suggest that OT-7100 is a new type of analgesic with the effect of normalizing the nociceptive threshold in peripheral neuropathic hyperalgesia.  (+info)

Testosterone control of nucleic acid content and proliferation of epithelium and stroma in rat seminal vesicles. (3/751)

Tissue wet weight, nucleic acid content and epithelial and stromal cell numbers were measured in the seminal vesicles of sexually mature male rats. After castration, tissue weight and RNA decreased rapidly and in aprallel to reach, after 14 days, values only 15-20% of those in control (not castrated) animals. During this period, DNA decreased to a much lesser extent (by about 40%), but this change in DNA correlates well with the observed loss of cells from the epithelium. Testosterone in vivo promoted an immediate resynthesis of RNA, the value characteristic of control animals being reached within 80h. Delays occurred in the hormone-induced regain of tissue weight (30h) and DNA (40h), each of which preceded proliferation of the epithelium (40--50h). The cells of the stroma were unaffected by these changes in the androgenic statls of the animal. It is suggested that these proliferative changes in the epithelium cannot account for the previously reported induction by testosterone of basic secretory proteins in this tissue.  (+info)

Seminal tract infections: impact on male fertility and treatment options. (4/751)

Bacterial and viral infections of the genital tract may be important aetiological factors for male infertility. Infectious processes may lead to deterioration of spermatogenesis, impairment of sperm function and/or obstruction of the seminal tract. Detection of bacteria in semen does not necessarily signify infection since bacteriospermia may represent contamination, colonization or infection. Reported prevalence of Ureaplasma urealyticum in human semen varies from 10 to 40%. Enterobacteria can even be found in up to 90% of semen samples depending on the sensitivity of detection methods used. Chlamydia trachomatis is the most frequent sexually transmitted bacterial organism in industrialized countries. It is suggested that its main influence is due to sexual transmission resulting in tubal disease and subsequent infertility in the female partner rather than a direct influence on male reproductive functions. The effect of leukocytospermia on male fertility is controversial. This is probably due to different detection methods, different populations studied and to the fact that leukocyte subtypes in semen may have different functions. In addition to potentially negative effects, leukocytes may even have protective effects on spermatozoa. Only recently have amplification methods been established to detect viruses in semen with high sensitivity and specificity. It is unclear if these infections significantly contribute to male infertility.  (+info)

Many LH peaks are needed to physiologically stimulate testosterone secretion: modulation by fasting and NPY. (5/751)

The pulsatile luteinizing hormone (LH) and testosterone secretions were studied during serial blood collections performed at 7-min time intervals in the male rat. In fed rats, a discontinuous pattern of LH secretion was observed. Periods without secretion alternated with active secretory episodes consisting in trains of three to four LH peaks that triggered testosterone secretion usually 1-2 h later. The magnitude of the testosterone response was not correlated with the amplitude of the LH peaks. Isolated, single peaks of LH did not evoke clear testosterone responses. Forty-eight hours after initiation of fasting, testosterone secretion was markedly decreased, but integrated LH secretion was only partly reduced. Chronic infusion of neuropeptide Y (NPY; 18 microgram/day, icv) reduced testosterone secretion to very low levels and abolished pulsatile LH secretion or testosterone response to isolated LH peaks. In conclusion, the stimulation of testosterone secretion by LH necessitates several LH peaks organized in a proper sequence, and the testosterone response is not immediate. Low testosterone secretion in fasting rats appears to result from disappearance of coordinated, multiple LH peaks of sufficient size. Inhibition of the gonadotropic axis achieved by central NPY administration is due to either absence of LH peak "clusters" or occurrence of nonfunctional single LH peaks.  (+info)

Comparison of the peroxidase reaction kinetics of prostaglandin H synthase-1 and -2. (6/751)

Prostaglandin H synthase isoforms 1 and 2 (PGHS-1 and -2) each have a peroxidase activity and also a cyclooxygenase activity that requires initiation by hydroperoxide. The hydroperoxide initiator requirement for PGHS-2 cyclooxygenase is about 10-fold lower than for PGHS-1 cyclooxygenase, and this difference may contribute to the distinct control of cellular prostanoid synthesis by the two isoforms. We compared the kinetics of the initial peroxidase steps in PGHS-1 and -2 to quantify mechanistic differences between the isoforms that might contribute to the difference in cyclooxygenase initiation efficiency. The kinetics of formation of Intermediate I (an Fe(IV) species with a porphyrin free radical) and Intermediate II (an Fe(IV) species with a tyrosyl free radical, thought to be the crucial oxidant in cyclooxygenase catalysis) were monitored at 4 degrees c by stopped flow spectrophotometry with several hydroperoxides as substrate. With 15-hydroperoxyeicosatetraenoic acid, the rate constant for Intermediate I formation (k1) was 2.3 x 10(7) M-1 s-1 for PGHS-1 and 2.5 x 10(7) M-1 s-1 for PGHS-2, indicating that the isoforms have similar initial reactivity with this lipid hydroperoxide. For PGHS-1, the rate of conversion of Intermediate I to Intermediate II (k2) became the limiting factor when the hydroperoxide level was increased, indicating a rate constant of 10(2)-10(3) s-1 for the generation of the active cyclooxygenase species. For PGHS-2, however, the transition between Intermediates I and II was not rate-limiting even at the highest hydroperoxide concentrations tested, indicating that the k2 value for PGHS-2 was much greater than that for PGHS-1. Computer modelling predicted that faster formation of the active cyclooxygenase species (Intermediate II) or increased stability of the active species increases the resistance of the cyclooxygenase to inhibition by the intracellular hydroperoxide scavenger, glutathione peroxidase. Kinetic differences between the PGHS isoforms in forming or stabilizing the active cyclooxygenase species can thus contribute to the difference in the regulation of their cellular activities.  (+info)

Significant changes in volume of seminal vesicles as determined by transrectal sonography in relation to age and benign prostatic hyperplasia. (7/751)

We evaluated the changes in volume of the seminal vesicles as determined by transrectal sonography in terms of the possible relationship with aging, lower urinary tract symptoms and benign prostatic hyperplasia (BPH) in community based populations in Japan. In 641 men (55-86 year, mean 67) on a mass screening program for prostatic diseases, the maximum horizontal area of the seminal vesicles (MHA) was compared with age, American Urological Association (AUA) symptom index scores and transrectal ultrasonic parameters of the prostate including prostatic volume, transition zone (TZ) volume, TZ index and presumed circle area ratio (PCAR). Simple regression analyses demonstrated that MHA correlated significantly with age, prostatic volume, TZ volume, TZ index and PCAR, but not with AUA symptom index scores. Multiple regression analysis revealed age, prostatic volume and PCAR to be independent determinants of MHA. There was a difference in MHA between subjects with BPH (7.1+/-2.5 cm2) and those with a normal prostate (5.6+/-2.1 cm2) with a statistical significance. In the morphological evaluation of the seminal vesicles, the significant influence of age and BPH has to be taken into account.  (+info)

Hyperplasia in multiple smooth muscle tissues in transgenic mice expressing a temperature-sensitive SV40 T-antigen under the control of smooth muscle alpha-actin regulatory sequences. (8/751)

Control of smooth muscle cell (SMC) proliferation is of fundamental importance in the development and pathology of the vasculature. To derive vascular SMC with conditional inactivation of negative cell cycle regulatory proteins in the context of smooth muscle protein expression, a 3.4 kb fragment of the mouse SMC alpha-actin promoter was used to target a temperature-sensitive mutant SV40 T antigen (tsA58) to smooth muscle in transgenic mice. Mice with this genotype display a heritable phenotype of abnormal SMC proliferation in the central tail artery, vasa deferentia, seminal vesicles, prostate, and uterus, with the latter resembling uterine leiomyomatosis and prostatic hypertrophy. Neither the aorta nor other viscera manifested abnormal proliferation. Cultures from aorta, vas deferens, seminal vesicle, and kidney tissue were characterized with regard to protein expression, stability, and matrix remodelling capacity. The alpha-actin content/cell was up to 3-4-fold higher, as well as more stable than in primary SMC cultures, suggesting successful selection for propagation of cells expressing this differentiation marker. All cells displayed enhanced growth at the permissive temperature. As an initial functional assessment, the cells were compared to non-transformed mouse aortic SMC with respect to the ability to remodel collagen gel matrices, and demonstrated conservation of this physiologic function. This in vivo analysis of the SMC alpha-actin promoter supports a broader range of smooth muscle-directed expression activity than previously recognized, and establishes the feasibility of its use to direct transgene expression to vascular as well as genito-urinary smooth muscle. The targeted expression of the tsA58 T antigen has yielded transgenic animals with several manifestations of smooth muscle hyperplasia; these animals have in turn permitted the derivation of several murine SMC lines with phenotypic stability and conditionally-modulated proliferation. These cells will allow expansion of derivative transfected smooth muscle cell lines under permissive conditions, as well as oncogene inactivation at the restrictive temperature when desired for functional studies.  (+info)

All the major androgen-regulated secretory proteins of rat seminal vesicles have been purified in high yield from polyacrylamide gels using electroelution. In the process a sixth previously undocumented protein has been identified. Amino acid compositions of all the proteins are very similar and highly unusual, being high in lysine and arginine, and with 40-50% of the residues accounted for by serine, glycine and glutamate/glutamine. N-Terminal amino acid sequences for 3 of the proteins show that they are clearly the products of related genes. At least one of the other proteins is N-terminally blocked in vivo. Antibodies specific for each protein have been raised and provide evidence of structural similarity between the proteins. The antibodies were also used in immunofluorescence histochemistry with the rat copulatory plug, showing for the first time that all the major proteins of seminal vesicle secretion are components of this reproductive structure.. ...
TY - JOUR. T1 - Embryological and diagnostic aspects of seminal vesicle cysts associated with upper urinary tract malformation. AU - Roehrborn, Claus. AU - Schneider, H. J.. AU - Rugendorff, E. W.. AU - Hamann, W.. PY - 1986/1/1. Y1 - 1986/1/1. N2 - Congenital seminal vesicle cysts represent a rare but illustrative type of embryological malformation. They often are combined with ipsilateral upper urinary tract abnormalities. In most of the cases described in the literature the diagnosis has been made with rather invasive procedures. On the basis of our experience with 3 cases we recommend pelvic ultrasonography as the initial study in patients in whom such a malformation is suspected. Although other radiological procedures may be required to confirm the diagnosis, this approach appears to be cost-effective and accurate in most instances. The treatment of such malformations should be restricted to symptomatic cases and usually consists of vesiculectomy with or without removal of the ipsilateral ...
TY - JOUR. T1 - An experimental model to evaluate the in vivo response of rat seminal vesicle to electrical stimulation. AU - Hsieh, Ju Ton. AU - Chien, Chiang Ting. AU - Liu, Shih Ping. AU - Chen, Chau Fong. AU - Lai, Ming Kuen. PY - 1996/2/9. Y1 - 1996/2/9. N2 - This investigation demonstrated a good model to record the pressure change of rat seminal vesicle (SV) in response to electrical stimulation (ES) of lesser splanchnic nerve (LSN) in vivo. LSN was easily identified and isolated grossly. Antegrade catheterization via the SV tail to the main lumen was performed similar to the technique of i.v. catheterization, and the pressure recording was quite satisfactory. The vesicle response to ES was frequency-dependent and reproducible. Under the conditions of 10 V and 1 ms, the maximal vesicle pressure was 81.7 ± 2.8 mmHg with 80 Hz of ES. The inhibitory response of SV to ES by clomipramine was concentration-dependent. Clomipramine (3 mg/kg) could inhibit 53% of control responses (n = 7). This ...
Accepted name: prostaglandin-endoperoxide synthase. Reaction: arachidonate + reduced acceptor + 2 O2 = prostaglandin H2 + acceptor + H2O. Other name(s): prostaglandin synthase; prostaglandin G/H synthase; (PG)H synthase; PG synthetase; prostaglandin synthetase; fatty acid cyclooxygenase; prostaglandin endoperoxide synthetase. Systematic name: (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoate,hydrogen-donor:oxygen oxidoreductase. Comments: This enzyme acts both as a dioxygenase and as a peroxidase.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, PDB, CAS registry number: 39391-18-9. References:. 1. DeWitt, D.L. and Smith, W.L. Primary structure of prostaglandin G/H synthase from sheep vesicular gland determined from the complementary DNA sequence. Proc. Natl. Acad. Sci. USA 85 (1988) 1412-1416. [PMID: 3125548]. 2. Ohki, S., Ogino, N., Yamamoto, S. and Hayaishi, O. Prostaglandin hydroperoxidase, an integral part of prostaglandin endoperoxide synthetase from bovine vesicular gland microsomes. ...
Question - Have grade -II prostatomegaly and small seminal vesicle cyst. Do I need urgent medical cure?. Ask a Doctor about Prostate, Ask a Urologist
After castration, treatment with 17 beta-estradiol (20 micrograms/kg.day) for 3 days induced the LF mRNA in the seminal vesicle of both control and prenatally DES-exposed mice; however, the levels in DES-treated tissues were approximately 6-fold higher than those in control tissue.. This report describes the presence of LF in seminal vesicle tissues and secretions of prenatally DES-exposed mice, as determined by immunohistochemistry and Western blot analysis.. Further, these data are correlated with immunolocalization of the estrogen receptor in the seminal vesicle tissue.. We conclude that the seminal vesicle of prenatally DES-exposed male mice has acquired two key characteristics of female tissues, namely LF production/regulation and estrogen receptor localization/distribution similar to that in uterine tissues.. ...
In this report we determined that the level of LTF mRNA is minimal in the seminal vesicles of normal mice.. In contrast, expression of LTF mRNA in the seminal vesicles of developmentally estrogenized males was both constitutive and estrogen inducible.. The mRNA for the major estrogen-inducible uterine secretory protein, lactoferrin (LF), was constitutively expressed in the seminal vesicle of male mice exposed prenatally to DES, but not in the seminal vesicle of control mice. The results suggested that this alteration may be an example of atypical gene expression after hormonal manipulation early in development.. ...
Ectopic prostatic tissue and seminal vesicle at pericolic fat is extremely rare. The nodules in the pericolic fat could raise a dilemma of metastatic deposits in cases of rectal adenocarcinoma. A 61 years old male underwent abdomino-perineal resection for rectal carcinoma. Nodules along with lymph nodes from pericolic fat were sampled to assess the spread. Histopathological and immunohistochemical staining of one nodule confirmed it to be the prostatic tissue while another nodule to be seminal vesicle. Seminal vesicle and prostatic heterotopia is significant in several respects, either symptomatic or asymptomatic, as the ectopic tissue can be endoscopically and histologically confused with malignancy of urinary or lower gastrointestinal system and may reflect divergent differentiation or a malformative process. ...
CT and MRI of Congenital Anomalies of the Seminal Vesicles Current Issue · All Issues · Collections; Information For ... CT and MRI can both accurately show renal and seminal vesicle anomalies. Seminal vesicle anomalies often occur concurrently with renal and vasal defects. MRI is a better tool for ... ...
Gallic acid esters possessing a varying chain length of their alcohol moiety were tested for their inhibitory potencies on 15-lipoxygenase from rabbit reticulocytes and prostaglandin H synthase from sheep vesicular glands. Octyl gallate and decyl gal
TY - JOUR. T1 - Clear cell primary seminal vesicle carcinoma in a young male-a rare case report. AU - Gaur, Saurabh. AU - Pillai, Sunil B.. AU - Hegde, Padmaraj. AU - Chawla, Arun Kumar. AU - Kapadia, Aseem. PY - 2018/2/1. Y1 - 2018/2/1. N2 - Primary malignancies of Seminal Vesicle (SV) are rare. When involved, it is most commonly due to secondaries or by contiguous spread from adjacent organs. Primary tumours that can arise in SV can be epithelial and mesenchymal. Adenocarcinoma is most common epithelial tumour, and the Clear Cell variant of Adenocarcinoma (CCA) so far has not been reported in literature. Primary SV malignancies like adenocarcinoma pose a diagnostic dilemma as it becomes difficult to differentiate it from secondaries or as involvement from other adjacent organs even with imaging, histopathology and Immunohistochemistry (IHC). Here we present a case of 34-year-old male who presented with occasional total painless haematuria for four years and was evaluated by Contrast Enhanced ...
The seminal vesicle is a gland located behind the bladder in males. Humans have two seminal vesicles, which make seminal fluid and...
Summary: A 37-year-old man presented to the emergency room with a 1-day history of right lower-quadrant pain. There was no associated fever, vomiting, diarr...
It is very significant that these two apertures should be so extremely small, much smaller than the two seminal ducts. Because the two seminal vesicles are only laterally attached to their ducts it may happen (in contradistinction to the urinary apparatus, in which both the ureters discharge into the bladder itself), that sperm cells simply pass by the seminal vesicle without entering it. In this manner it might only too easily happen that semen would escape with urine unnoticed, without exercising its fertilising function, as is sometimes the case in serious paralytic conditions (spermator-rhea seminal emission without erection). But the extreme fineness of the two apertures in itself causes a resistance as elastic as the best occlusory muscle. So the antagonism in connection with the secretion of semen is unmistakable, even for those sperm-cells which have not penetrated into the seminal vesicles.. The problem of the ejaculation of the semen is rendered very much more difficult, because on ...
mention the role of the following organs of human male reproductive system testes seminal vesicles - Biology - TopperLearning.com | efi8m2qq
Rats can be used as a model organism to teach physiological concepts in a laboratory setting. This article describes a two-part laboratory that introduces students to hypothesis testing, experimental design, the appropriate use of controls and surgical techniques. Students perform both a castration and sham-control surgery on male rats and test the effects of reduced testosterone due to castration on the weight and histology of seminal vesicles. After performing the surgeries and collecting the data, students learn histological techniques, as well as empirical data collection, analysis and interpretation. Demonstrating the effects of testosterone through castration surgery bridges concepts learned in a traditional physiology class setting with data gleaned from research in a laboratory. Overall, the male castration surgery provides students with hands-on skills and an understanding of the work done by scientific researchers and health care professionals.
Brauer, C.; Scheit, K. H.: Characterization of the gene for the bovine seminal vesicle secretory protein SVSP109. Biochimica et Biophysica Acta 1090 (2), pp. 259 - 260 (1991 ...
BioAssay record AID 54289 submitted by ChEMBL: Compound was tested at 1 nM for the inhibition of ADP-induced (20 uM) platelet aggregation in bovine seminal vesicle microsomes; NI=No inhibition.
Unilateral agenesis of seminal vesicle as seen in this case, is a documented cause of male infertility and abnormal semen analysis. It may be associated with unilateral renal agenesis, however correlative USG (not shown) showed normal kidneys in ...
Irreversible androgen induced growth in seminal vesicle smooth muscle.: The dihydrotestosterone (DHT)-sustained normal pubertal development of the guinea pig se
Bartke, A, Influence of pituitary homografts on the weight of seminal vesicles in castrated mice. (1967). Subject Strain Bibliography 1967. 562 ...
LetterKenny (2016) - S01E02 Daryls Super Soft Birthday clip with quote Id be most worried about seeing my seminal vesicles. Yarn is the best search for video clips by quote. Find the exact moment in a TV show, movie, or music video you want to share. Easily move forward or backward to get to the perfect clip.
Results: The mean age was 64 years (range: 50-76 years) with mean and median PSA of 17.98 ng/ml (range: 0.3-68.3 ng/ml) and 12.1 ng/ml, respectively. With increase in preoperative Gleason score, chance of organ confinement decreases (P=0.002) and capsular penetration increases (P=0.004) linearly. With increasing serum PSA, there is linear decrease in trend of organ-confined disease (P=0.03) and increased chances of seminal vesicle involvement (P=0.02). Patients with higher clinical stage have less probability of localized disease (P=0.007) and more chances of capsular penetration (P=0.04) and seminal vesicle involvement (P=0.004). Conclusion: Our data suggest that patients with higher preoperative serum PSA, Gleason score, and clinical stage have more chances of advanced pathological stage following RARP ...
Fred,. It is common to read from newly diagnosed folks about those psychological feelings occurring allover the body. We try connecting any little feel with the cancer because the day before diagnosis we were healthy and now we think we are rotten. In fact we are now listening to our body more attentive to the extent that even the work of hearts valves is noticed or thought to be felt. Our brain is tricking us and at such a status we become vulnerable to medical vultures. Pain may exist in very advanced cases of prostate cancer (PCa) when metastases have deteriorate bone or have interfere with the functioning of an organ but these are rare cases in young newely diagnosed patients with low PSA (,50).. Some doctors may be tempted to urge patients to decide quickly for avoiding spread, which is an erroneous way of thinking. PCa does not spread that fast and your status of today would not be much different if it were 4 to 6 months later. Apart from that the treatment process would be the same with ...
Fred,. It is common to read from newly diagnosed folks about those psychological feelings occurring allover the body. We try connecting any little feel with the cancer because the day before diagnosis we were healthy and now we think we are rotten. In fact we are now listening to our body more attentive to the extent that even the work of hearts valves is noticed or thought to be felt. Our brain is tricking us and at such a status we become vulnerable to medical vultures. Pain may exist in very advanced cases of prostate cancer (PCa) when metastases have deteriorate bone or have interfere with the functioning of an organ but these are rare cases in young newely diagnosed patients with low PSA (,50).. Some doctors may be tempted to urge patients to decide quickly for avoiding spread, which is an erroneous way of thinking. PCa does not spread that fast and your status of today would not be much different if it were 4 to 6 months later. Apart from that the treatment process would be the same with ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
A: The seminal vesicles are not only warehouse store tags Ahoinat sperm after the arrival of the testis, but it is a very important source for the production of fruit sugar (fructose), which is an indispensable element to feed Ahoinat sperm. The percentage of the sugar concentration of 120-200 mg per cent of the semen, is this amount of sugar to give enough power for about one hundred million sperm Hoin for twenty hours. Therefore, if I said the proportion of fructose in the semen than normal (as sometimes occurs in inflammatory seminal vesicles) that lead to abnormal phenomena on the one hand Ahoinat sperm count, or the movement or shapes. This may be a cause of infertility. ...
ICD-10-PCS › › Release › V › Release Release 0VN0 Prostate 0VN1 Seminal Vesicle, Right 0VN2 Seminal Vesicle, Left 0VN3 Seminal Vesicles, 0VN5
To understand how reproductive hazards affect a mans ability to have healthy children, it is important to understand how the male reproductive system works.. The testicles have two important functions: (1) they produce the hormone testosterone, which produces the deep male voice, beard, and sex drive; and (2) they produce sperm.. After the sperm are made (in about 72 days), they are stored in the epididymis, the outer structure of the testicles. The sperm remain in the epididymis for about 15 to 25 days. While there, they mature and develop the ability to swim. If the sperm are not ejaculated, they eventually die and are absorbed by the body.. When a man ejaculates, the mature sperm cells move through the vas deferens (the tube cut in a vasectomy) and past the seminal vesicles and prostate gland. The seminal vesicles and the prostate provide most of the liquid in semen.. The semen is deposited in the vagina and the sperm must then swim through the cervix into the uterus and up into the ...
The motivation behind the organs of the male conceptive framework is to play out the accompanying capacities: To deliver, keep up, and transport sperm (the male regenerative cells) and defensive liquid (semen) To release sperm inside the fe...
important for semen coagulation, sperm motility, and stability of sperm chromatin and suppression of the immune activity in the female reproductive tract[MP]. ...
This 43-year-old man noticed slight protuberance of the lower abdomen that increased over several months. Otherwise , he was asymptomatic. Ultrasound, CT and MRI scans of the pelvis revelaed a complex mass suspicious for sarcoma arising from the prostate. Surgical exploration showed an origin from the seminal vesicles but the tumor was separate from the prostate. The tumor as removed togeter with a cystoprostatectomy. Gross findings: A 16 cm tumor weighing 587 grams with a homogenous grey cut surface was received. Areas of hemorrhage and necrosis were evident. The surface was smooth and mainly covered by a layer of intact peritoneum. An area of irregularity was present corresponding to the site of removal from the area of the seminal vesicles ...
Hints: Click on a [map] link to show a map of that region. Click on a [studies] link to search within your current results for studies in that region. Use the back button to return to this list and try another region. Studies with no locations are not included in the counts or on the map. Studies with multiple locations are included in each region containing locations ...
The Orthopedics PERL Channel contains hundreds of items, including full-color medical illustrations, medical animations and patient education articles. The Orthopedics Channel covers topics relevant to skeletal and muscular anatomy, orthopedic injury and repair, and general sports medicine. Health Animation channels are produced by Nucleus Medical Media, Inc.
All the information, content and live chat provided on the site is intended to be for informational purposes only, and not a substitute for professional or medical advice. You should always speak with your doctor before you follow anything that you read on this website. Any health question asked on this site will be visible to the people who browse this site. Hence, the user assumes the responsibility not to divulge any personally identifiable information in the question. Use of this site is subject to our Terms & Conditions ...
No adverse effects on reproductive organs were identified in the 90 day study in rats on C12-14-diamine. This study was performed according to OECD 408 and does not include detailed reproductive parameters as indicated in OECD 416. Nevertheless, the 90 day study did not indicate any effects on weight of testes, prostate, seminal vesicles, ovaries, and uterus. Histological examination of these tissues also confirmed no treatment-related effects. There was a very slight increase in relative weight of the epididymis in the high dose animals but there were no corresponding histological changes. There was also no indication of a dose-response relationship. Accordingly, the effect on epididymis is not believed to be treatment related ...
Dr. Proffitt responded: Interesting question. The majority of ejaculate is made up of prostatic fluid, seminal vesicle fluid and just 1/2-1 cc from |a href=/topics/sperm track_data={
Health Care of children is a major problem in almost all the parents around the world. The accessory glands, including the seminal vesicles and the prostate
1/08: Biopsy 1 of 12 cores with 10% involvement, T1c, Gleason 3+3=6. 4/08/08: Da Vinci Rad. prostectomy @ Banner Thunderbird, 5 hrs.. Advised both nerve bundles spared. Post Op Pathology Report: Tumor confined w/in prostate, pT2c, NX, DX Gleason is 3+3=6, bilateral with 15% total involvement near apex. Margins and Seminal Vesicles negative!!!. 4/18/08: Staples and Catheter removed. Drip, drip, drip, drip.... 5/23/08: Dry!!!!. ...
In spawning Clarias gariepinus from the Hula Nature Reserve in Northern Israel, the mean value for the seminal vesicle somatic index (SVSI) had decreased as compared with that in prespawning fish, due to loss of seminal vesicle fluid. Mean gonadosomatic index (GSI), however, had increased, probably as a result of ... read more hydration, 3α-Hydroxysteroid dehydrogenase (3αHSD), 3βHSD and uridine diphosphoglucose dehydrogenase (UDPGD) reactions were demonstrated in interstitial cells of both testis and seminal vesicle. UDPGD reactions were also found in the epithelium of the seminal vesicle tubules. Quantitative determination of the enzyme reactions with a computerized image analysis system revealed that total activity of all three enzymes in interstitial cells of the seminal vesicle was distinctly stronger in spawning fish. Prespawning and spawning fish did not differ in total UDPGD activity in the epithelium lining the seminal vesicle tubules. In the testes of spawning fish, total 3βHSD ...
Looking for online definition of Ducts of the seminal vesicles in the Medical Dictionary? Ducts of the seminal vesicles explanation free. What is Ducts of the seminal vesicles? Meaning of Ducts of the seminal vesicles medical term. What does Ducts of the seminal vesicles mean?
TY - JOUR. T1 - Interfractional seminal vesicle motion relative to the prostate gland for image-guided radiotherapy for prostate cancer with/without androgen deprivation therapy. T2 - A retrospective cohort study. AU - Waki, Takahiro. AU - Katsui, Kuniaki. AU - Mitsuhashi, Toshiharu. AU - Ogata, Takeshi. AU - Katayama, Norihisa. AU - Takemoto, Mitsuhiro. AU - Nasu, Yasutomo. AU - Kumon, Hiromi. AU - Kanazawa, Susumu. PY - 2017. Y1 - 2017. N2 - We investigated differences in seminal vesicle (SV) length and interfractional SV motion relative to the prostate gland in prostate cancer patients. We compared 32 patients who received androgen deprivation therapy (ADT) before radiotherapy with 12 patients receiving radiotherapy alone at Okayama University Hospital in August 2008-July 2011. We examined the right and left SVs length and motion by computed tomography (CT) to determine the ADTs effects and analyzed 347 CT scans in a multiple linear regression model. The ADT patients SV length was ...
Material & Methods: Using the database of the European study on radical prostatectomy (653(DQG PHQ ZKR XQGHUZHQW UDGLFDO UHWURSXELF SURVWDWHFWRP\ EHWZHHQ DQGDWRWDORISDWLHQWVZHUHLGHQWLᚏHGZKRKDGXQGHUJRQHELODWHUDOQHUYHVSDULQJ and preservation of the tip of the seminal vesicle (GROUP 1). Potency and continence results were compared to a matched group of 1424 men who also underwent a bilateral nerve sparing procedure without preservation of the seminal vesicle tip during the same period (GROUP 2). Results: 2YHUDOOFRQWLQHQFHUDWHSDGDW\HDUZDVZLWKD&,&RQWLQHQFH WLPHNLQHWLFVDWPRDWPRDWPRDQGDWPR$ GLᚎHUHQFHZDVVHHQZKHQFRPSDULQJSK\VLFLDQDQGSDWLHQWJXLGHGTXHVWLRQQDLUHVZLWK respect to continence (physicians judging rates more favourably).A constant relative increase in Nerve-sparing (uni- and bilateral) procedures was observed with highest rates 1998-2000, and reaching a steady state thereafter (at 71,4% of all cases). Potency results and time kinetics in both groups are: Potency GROUP 1* GROUP 2 PR 8-15% ...
View Notes - The male reproductive system from PHRM 3010 at UGA. Epididymis • Vas deferens • Seminal vesicles • Prostate gland • Bulbourethral (cowpers gland)
May 08,2021 - Seminal plasma, the fluid part of semen is contributed by:(i) Seminal vesicle(ii) Prostate(iii) Urethra(iv) Bulbourethral glanda)(ii), (iii) and (iv)b)(i) and (ii)c)(i), (ii) and (iv)d)(i) and (iv)Correct answer is C. Can you explain this answer? | EduRev NEET Question is disucussed on EduRev Study Group by 773 NEET Students.
This fourth series Fascicle in the American Registry of Pathology/Armed Forces Institute of Pathology Atlas of Tumor Pathology series discusses the practical pathologic diagnoses of tumors and tumor-like diseases of the prostate gland, seminal vesicles, penis, and scrotum. The authors follow the tradition of the preceding three Fascicles by emphasizing pathologic gross and light microscopic diagnostic features and differential diagnoses. They also discuss relevant clinical features, including concise sections on the clinical presentation and the clinical meaning of the pathologic diagnosis in terms of prognosis and treatment. The immunohistochemical and molecular pathologic studies that are of current value in diagnosis are clearly presented. The high quality images follow the rich tradition of the previous Fascicles to depict the spectrum of tumor morphology from cases mainly from the files of institutions such as The Johns Hopkins Hospital, Barnes-Jewish Hospital, and Instituto de Patología e ...
ICD 10 Procedure Code for Removal of Infusion Device from Prostate and Seminal Vesicles, Percutaneous Endoscopic Approach is 0VP443Z. 0VP443Z is a Billable 2021 ICD-10-PCS Procedure Code.
0VW433Z is a billable procedure code used to indicate the performance of revision of infusion device in prostate and seminal vesicles, percutaneous approach. Code valid for the year 2021
Expression of AR (AIS, DHTR, HUMARA, NR3C4, SBMA, SMAX1) in seminal vesicle tissue. Antibody staining with CAB000001 and CAB065764 in immunohistochemistry.
Expression of RNASET2 (bA514O12.3, FLJ10907, RNASE6PL) in seminal vesicle tissue. Antibody staining with HPA029013 and HPA066509 in immunohistochemistry.
ICD-10-PCS code List for Prostate and Seminal Vesicles is medical classification list by Centers for Medicare and Medicaid ... ICD-10-PCS code List for Prostate and Seminal Vesicles. ICD-10-PCS code List for Prostate and Seminal Vesicles is medical ... Revision of Autologous Tissue Substitute in Prostate and Seminal Vesicles, Via Natural or Artificial Opening Endoscopic ... Revision of Nonautologous Tissue Substitute in Prostate and Seminal Vesicles, Via Natural or Artificial Opening Endoscopic ...
Article: The longitudinal effect of ejaculation on seminal vesicle fluid volume and whole-prostate ADC as measured on prostate ... This articles focuses on the volume reduction of fluid within the seminal vesicles after ejaculation, as shown in MRI. ... Seminal vesicle fluid volume significantly increased from day 1 to day 3 post-ejaculation ... Seminal vesicle volume significantly reduced 24 h post-ejaculation remaining reduced at day ...
Seminal vesicle secretory protein IV was expressed in all (100%) epithelial cells of the control seminal vesicle, but this ... However, LF expression was undetectable by ISH or IHC in control seminal vesicle epithelium. Lactoferrin was inducible in 2% of ... Molecular Feminization of Mouse Seminal Vesicle by Prenatal Exposure to DiEthylStilbestrol. Feminization of the male mouse ... Molecular feminization of mouse seminal vesicle by prenatal exposure to diethylstilbestrol: altered expression of messenger RNA ...
Seminal vesicle harvest is a feasible technique for sperm retrieval in wounded warriors with extensive testicular injuries. ... Seminal vesicle sperm aspiration from wounded warriors. Seminal vesicle harvest is a feasible technique for sperm retrieval in ... To assess whether seminal vesicle sperm aspiration (SVSA) is an option for wounded warriors with severe genital and testicular ... Seminal vesicle fluid analysis after harvest, after thaw analysis, fertilization rates, pregnancy rates (PRs), live birth. ...
Investigators analyzed long-term urinary continence and erectile function recovery for men who had seminal vesicle-sparing ... Seminal Vesicle-Sparing in Radical Cystectomy Shown to Improve Outcomes Natasha Persaud ... Seminal vesicle sparing (SVS) at radical cystectomy (RC) provides good oncologic outcomes and helps to preserve urinary ... Less injury probably occurred to the nerves surrounding the tips of the seminal vesicles, according to the investigators. The ...
Background: Individual seminal prostasomes are intrinsically heterogeneous extracellular vesicles (EVs) whose composition is, ... Background: Individual seminal prostasomes are intrinsically heterogeneous extracellular vesicles (EVs) whose composition is, ... Separation of seminal prostasomes by lectin-affinity chromatography (LAC) Seminal prostasomes from normozoospermic males (sPro- ... Isolation of prostasomes from human being seminal plasma Prostasomes were isolated from two swimming pools of seminal plasma ( ...
HIV-associated late seminal vesicle BCGosis following intravesical bacille Calmette-Guérin therapy ... HIV-associated late seminal vesicle BCGosis following intravesical bacille Calmette-Guérin therapy ...
seminal vesicle invasion - uninvolved. 1st Post PSA ,.04. 2nd Post PSA ,.01 10/30/08 ...
Cancer had spread out to seminal vesicles. Is now undergoing hormone and radio therapies in native Toronto. Total incontinence ...
Radical prostatectomy involves removing the prostate, nearby tissues, and seminal vesicles. It is effective if your cancer has ...
4) The semen is produced in the seminal vesicles, which are a pair of simple tubular glands posteroinferior (behind and below) ... Whereas the seminal vesicles are in the pelvis.. Strange that the almighty Allah didnt know such things.. As always the ... Semen is stored in vesicles that lie in the abdomen. From there it is ejaculated during coitus. Lay people still think that the ...
To perform a radical prostatectomy, a surgeon will remove the prostate gland, some nearby tissue and the seminal vesicles. ...
Unlike external beam radiation therapy, brachytherapy does not treat the seminal vesicles or the pelvic lymph nodes. The ... can also be used to treat disease that has spread beyond the capsule of the prostate and into the adjacent seminal vesicles. ...
Fortunately, my pelvic lymph nodes and seminal vesicles were not involved. Despite the fact that the cancer had grown out of ...
This procedure also includes the removal of adjoining seminal vesicles (glands that produce semen) and often the surrounding ...
... may be appropriate and can indicate if the PCa is in the seminal vesicles and nodes. The Tesla 3 MRI is a newer version of the ... When prostate cancer leaves the prostate and goes to the seminal vesicules, lymph nodes, bone or liver or lung, for example, it ... seminal vesicules, and may have also moved to the liver. ...
Gleason 8-10 or seminal vesicle invasion) showed an increased risk of 5-year BCR as high as 10% per 0.1 ng/ml of PSA level ... and seminal vesicle invasion rates were 19-21%. He notes that in Belgium and perhaps other countries in the world, surgeons are ... defined as local radiation to the prostate and seminal vesicle bed, delivered at PSA ≤ 0.5 ng/ml) [1]. At 5 years after early ... as well as very few patients with seminal vesicle invasion (20% in the observation + salvage radiotherapy arm and 19% in the ...
What is the straight tube, about 40 cm long, that carries sperms to the seminal vesicles, called? ...
Disease in the bull may produce infections of the seminal vesicles and testicles, resulting in shedding of the organisms in ...
Disease in the bull may produce infections of the seminal vesicles and testicles, resulting in shedding of the organisms in ...
Following seminal vesicle fever antibiotics stay as determine wound in it fluids to genes process. Skin conditions Erectile ...
Dose was prescribed as 55 Gy(RBE) to the low-dose target (lymph nodes and seminal vesicles) with a boost to 74 Gy(RBE) to the ...
Sperm moves into a tube called the hermaphrodite duct, then into the seminal vesicle gland, which contributes fluid and ...
Can i take proscar instead of propecia online no prescription ? Additionally, the weight of prostate and seminal vesicles, as ...
Literature associating CCDC115 and seminal vesicle tumor. CCDC115 [ENSP00000259229]. Coiled-coil domain-containing protein 115 ...
... seminal vesicle disease, ejaculatory duct obstruction, etc. Even though, decrease in ejaculate volume & size of testis can be a ... seminal vesicle disease, ejaculatory duct obstruction, etc. Even though, decrease in ejaculate volume & size of testis can be a ...
Receptors on hair nCAA national development, including the growth and maturation of the prostate, seminal vesicle, penis, and ...
... including seminal vesicle invasion, positive surgical margins, or extraprostatic extension because of demonstrated reductions ...
Seminal vesicle secreted proteins and their reactions during gelation and liquefaction of human semen. J. Clin. Invest., 1987, ... Polak B, Daunter B. Seminal plasma biochemistry. IV: Enzymes involved in the liquefaction of human seminal plasma. Int. J. ... However, PSA has been shown to contribute to the hydrolysis of the seminal coagulum proteins. Probable roles for the other ... Lizana JA, Eneroth P. Proteins in seminal plasma and cervicovaginal secretions. In "Proteins in body fluids, amino acids and ...
  • Ejaculation (ejaculation) is a sequential contraction of VAS deferens and prostate, highlighting the seminal fluid through the urethra, ending in the release of sperm. (vsebolezni.com)
  • The center gives a command to the process in which successively less smooth muscle, VAS deferens, seminal vesicles, prostate and urethra. (vsebolezni.com)
  • Prostate, seminal vesicles and VAS deferens are reduced, and semen is released in the urethra. (vsebolezni.com)
  • Initially, seminal fluid compresses the rear part of the urethra. (vsebolezni.com)
  • In Stage III, the tumor has just begun to spread to nearby tissues like the seminal vesicles or urethra. (pasadenacyberknife.com)
  • In the emission phase, semen is secreted into the urethra due to the contraction of the vas deferens, seminal vesicles and the prostate. (mesplantes.net)
  • this surgical procedure involving a complete removal of the bladder and other tissues surrounding it: the fatty tissue around the bladder, prostate, seminal vesicles, and possibly the urethra. (cancereffects.com)
  • 2. The seminal vesicle lies posterior to the bladder and medial to the ampulla of the vas deferens. (humangrossanatomy.com)
  • The vasa deferentia (singular: vas deferens) bring sperm from the testes to the seminal vesicles. (kwangoods.com)
  • However, more scar tissue may create a blockage in the vas deferens, preventing sperm from reaching the seminal vesicles. (uturology.com)
  • In men , the prostate, the seminal vesicles, and part of the vas deferens are also removed. (avocure.com)
  • Known as radical prostatectomy, this is a surgical procedure to remove the prostate, vas deferens and seminal vesicles. (healthxchange.sg)
  • Open radical retropubic prostatectomy: The prostate gland with the attached seminal vesicles and vas deferens are removed via a 15 cm incision below the navel in the midline of the abdomen. (healthxchange.sg)
  • Receptors on hair nCAA national development, including the growth and maturation of the prostate, seminal vesicle, penis, and scrotum. (thenavajotimes.com)
  • This procedure also includes the removal of adjoining seminal vesicles (glands that produce semen) and often the surrounding lymph nodes. (uchicagomedicine.org)
  • Disease in the bull may produce infections of the seminal vesicles and testicles, resulting in shedding of the organisms in semen. (idexx.co.uk)
  • Seminal vesicle secreted proteins and their reactions during gelation and liquefaction of human semen. (biomedcentral.com)
  • After the sperms get mixed with fluid made by the seminal vesicles and the prostate gland, that mixture is called the ejaculate or semen. (babymed.com)
  • The seminal vesicles contribute fluid to semen during ejaculation. (kwangoods.com)
  • More than 95% of the semen is made in the the prostate and seminal vesicles above the vas. (albertavasectomy.ca)
  • The inflammatory vexation is caused by a build up of semen and semen within the vesicles that are seminal testicles. (mitrapro.com)
  • The retained semen can boost the dopamine that is central function, however the expansion for the seminal vesicles and also the testicular ducts induces an extra launch of prostaglandin E2 that will stimulate infection of this neighborhood sympathetic nerves for anxious and stressful reactions so that they can expel semen and semen through the human body. (mitrapro.com)
  • Your seminal vesicles typically hold enough semen for two to three ejaculations, even though you can't ejaculate that many times in a row. (growingupboys.info)
  • A man's reproductive fluid, called semen, is produced by the following glands: The testicles, also called testes, the seminal vesicles, and the prostate gland. (nucleushealth.com)
  • Whether your seminal vesicles (the glands that produce semen) will mature now or in stage 4 is something that would be hard to guess. (growingupboys.info)
  • Sperms make up only a small fraction of the total ejaculate and rest of the substance is semen made by the prostate gland and the seminal vesicles. (asgargroup.com)
  • That semen is produced in the seminal vesicles, which can only hold so much semen before some have to be released to make room for new batches of semen. (growingupboys.info)
  • Fortunately, my pelvic lymph nodes and seminal vesicles were not involved. (laprp.com)
  • Dose was prescribed as 55 Gy(RBE) to the low-dose target (lymph nodes and seminal vesicles) with a boost to 74 Gy(RBE) to the high-dose target (prostate). (eur.nl)
  • Lizana JA, Eneroth P. Proteins in seminal plasma and cervicovaginal secretions. (biomedcentral.com)
  • Secretions of seminal vesicle and prostate gland provide nutrition and motility to the sperms. (physicsgurukul.com)
  • The secretions from seminal vesicles and the prostate gland lubricate the sperms and provide a fluid medium for easy transport of sperms. (freeguruhelpline.com)
  • But it continues to consist of other sperm secretions, which usually make up the nourishing medium of spermatozoa (Cowper's gland secretions, prostate secretions, seminal vesicle fluid). (psycho-sexo.fr)
  • The study showed that when male rats were fed high doses of stevioside for 22 months, sperm production was severely reduced, the weight of the seminal vesicles declined, and there was an increase of cell proliferation in their testicles. (typepad.com)
  • These usually carry spermatozoa produced by the testicles to the prostate and seminal vesicles. (psycho-sexo.fr)
  • Stimulation leads to contraction of the vessels of the testicles, appendages, seminal duct of the vesicles and prostate. (vsebolezni.com)
  • This is along with 70% seminal fluid from the seminal vesicle and 3-5% of sperm produced in the testicles. (mysteryvibe.com)
  • The milky fluid produced by the prostate - prostatic fluid - makes up around 30 percent of the total fluid ejaculated (the rest is sperm and fluid from the seminal vesicles). (mdriveformen.com)
  • Radical prostatectomy involves removing the prostate, nearby tissues, and seminal vesicles. (mountsinai.org)
  • The surrounding tissues include lymph nodes nearby and seminal vesicles. (sahajhospital.com)
  • The cancer has spread beyond the prostate to the seminal vesicles or other nearby tissues. (rxwiki.com)
  • In the last stage called T4, the tumour has spread to tissues next to the prostate other than the seminal vesicles. (careclinic.io)
  • Unlike external beam radiation therapy, brachytherapy does not treat the seminal vesicles or the pelvic lymph nodes. (northshore.org)
  • Stage IIIB: The cancer has spread to the seminal vesicles or the rectum, bladder or pelvic wall. (stjoes.ca)
  • Stage IIIC: The cancer is in one or both sides of the prostate, and may have spread to the seminal vesicles, rectum, bladder or pelvic wall. (stjoes.ca)
  • Isolation of prostasomes from human being seminal plasma Prostasomes were isolated from two swimming pools of seminal plasma (SP) from normozoospermic males and two swimming pools from oligozoospermic males. (livingseas.org)
  • Physicians should offer adjuvant radiation therapy to patients with adverse pathologic findings at the time of prostatectomy, including seminal vesicle invasion, positive surgical margins, or extraprostatic extension because of demonstrated reductions in biochemical recurrence, local recurrence, and clinical progression (standard, evidence strength: grade A). (urologytimes.com)
  • This includes patients who have positive surgical margins, extraprostatic extension, seminal vesicle invasion, bladder neck invasion, or a PSA rise after RP. (pcmarkers.com)
  • Qurs Mumsik Jadid also provides strength to seminal vesicles, prostate gland, and the bulbourethral glands in male reproductive system. (ajmal.pk)
  • Fluid from the testicle that contains sperm is joined with fluids from the seminal vesicles, prostate, and bulbourethral glands earlier than exiting the physique throughout an ejaculation. (trouvaille.id)
  • Seminal vesiculitis: It's normally brought about as a secondary impact of prostatitis and is characterised by seminal vesicles inflammation. (drnikonian.com)
  • the decrease in ejaculate volume can be caused from several different reasons including age, medication especially alpha blocker medications that are used for blood pressure & enlarged prostate, as well prior prostate procedures (NOT vasectomy), seminal vesicle disease, ejaculatory duct obstruction, etc. (vasectomy.com)
  • Men considered for bilateral seminal vesicle-sparing radical cystectomy only had tumors in the bladder dome and anterior bladder wall. (cancertherapyadvisor.com)
  • Seminal vesicle sparing (SVS) at radical cystectomy (RC) provides good oncologic outcomes and helps to preserve urinary continence and sexual function in well-selected patients with bladder cancer, a new study finds. (cancertherapyadvisor.com)
  • To perform a radical prostatectomy, a surgeon will remove the prostate gland, some nearby tissue and the seminal vesicles. (moffitt.org)
  • A radical prostatectomy is the removal of the whole prostate, such as its own capsule, in addition to the seminal vesicles. (timebusinessnews.com)
  • However, LF expression was undetectable by ISH or IHC in control seminal vesicle epithelium. (desdaughter.com)
  • It can regulate the activity of the epithelium of the seminal vesicles‚ the activity of the prostate‚ and the activity of spermatogenesis for people who have a ketosteroid deficiency. (thegreenpharmacy.com)
  • What happens to seminal vesicles after ejaculation? (european-radiology.org)
  • This articles focuses on the volume reduction of fluid within the seminal vesicles after ejaculation, as shown in MRI. (european-radiology.org)
  • But this means if your seminal vesicles are particularly full, an ejaculation will take down the pressure, but it might not take long for it to build back up again. (growingupboys.info)
  • Seminal vesicle harvest is a feasible technique for sperm retrieval in wounded warriors with extensive testicular injuries. (fertstertdialog.com)
  • To assess whether seminal vesicle sperm aspiration (SVSA) is an option for wounded warriors with severe genital and testicular injuries, with the goal of cryopreservation to use in future assisted reproductive technology (ART) cycles. (fertstertdialog.com)
  • Speman promotes spermatogenesis by improving the testicular, seminal vesicle and epididymal functions. (mednederland.com)
  • This MRI also includes: for men - study of the prostate and seminal vesicles, for women - ovaries, uterus, vagina and fallopian tubes. (zufi.net)
  • Seminal vesicle secretory protein IV was expressed in all (100%) epithelial cells of the control seminal vesicle, but this protein was decreased by castration. (desdaughter.com)
  • maternal body weight on days 9 through 16 of gestation) resulted in the male offspring exhibiting constitutive expression of LF in 5% of the seminal vesicle epithelial cells, while expression of the androgen-regulated protein SVS IV was slightly decreased. (desdaughter.com)
  • Since a large percentage of the epithelial cells in the intact prenatal DES exposed male was capable of expressing the normal gene product, SVS IV, it was concluded that DES treatment during prenatal development appears to imprint or induce estrogenic sensitivity in the adult seminal vesicle, causing increased production of LF. (desdaughter.com)
  • This gland is removed along with surrounding tissue and seminal vesicles. (sahajhospital.com)
  • The most common surgery option removes the entire prostate gland and some of the tissue around it, including the seminal vesicles. (massivebio.com)
  • You feel yourself returning to normal the seminal vesicles as a measure of tissue androgenic response reduced androgenicity of nandrolone is explained by the. (openmbta.org)
  • They must have reached the seminal vesicles (seminal vesicles) that were not the rectum or the bladder composition. (medicalobserverph.com)
  • Looking closer at the baseline characteristics for the patients included in RADICALS, Dr. De Meerleer noted that there were very few patients with Gleason 8-10 prostate cancer (17% in the observation + salvage radiotherapy arm and 16% in the adjuvant radiotherapy arm), as well as very few patients with seminal vesicle invasion (20% in the observation + salvage radiotherapy arm and 19% in the adjuvant radiotherapy arm). (urotoday.com)
  • Gleason 8-10 or seminal vesicle invasion) showed an increased risk of 5-year BCR as high as 10% per 0.1 ng/ml of PSA level compared with only 1.5% in patients with one or no pathologic risk factors. (urotoday.com)
  • What is the role of seminal vesicles and prostate gland? (physicsgurukul.com)
  • The prostate is a small walnut-shaped gland that produces the seminal fluid that nourishes and transports sperm. (rxwiki.com)
  • Prostate cancer is a form of cancer that develops in the prostate gland, which produces seminal fluid that nourishes and transports sperm. (careclinic.io)
  • Open Surgery approach provides surgeon a larger area to work in, greater use of the prostate gland, seminal vesicles as well as the lymph nodes and can be used more commonly net wide. (timebusinessnews.com)
  • Surgical treatment of the prostate cancer entails removal of the entire prostate gland with seminal vesicles with or without lymph nodes depending upon the indications. (apollohospitals.com)
  • What is the straight tube, about 40 cm long, that carries sperms to the seminal vesicles, called? (sawaal.com)
  • First, her team found a way to extract seminal fluid without contamination from potential bacteria in the urinary tract. (missouri.edu)
  • The biopsy showed prostate cancer ( cancer de la prostate , pour mes amis en Quebec) with a grade of Gleason score 7 cancer in three of six pieces, and I wasn't very happy. (laprp.com)
  • I soon learned that a Gleason score of 9 is a very aggressive cancer but at least a 3a staging means that the tumour is confined to the prostate and perhaps the seminal veslcle. (cancercouncil.com.au)
  • It was abundant in the seminal fluid, and even more so when estrogen receptor genes were present. (missouri.edu)
  • MRI for prostate cancer diagnosis can show if the cancer has spread outside the prostate into the seminal vesicles or other nearby structures. (careclinic.io)
  • Here we compared seminal fluid bacterial DNA samples to publicly available databases that come from other large experiments and found a few sequences that no one else has discovered or at least characterized, so we're in completely new territory. (missouri.edu)
  • Non-invasive and painless, these treatments can also be used to treat disease that has spread beyond the capsule of the prostate and into the adjacent seminal vesicles. (northshore.org)
  • In fact, recent studies using mice describe prenatal estrogen exposure resulting in the expression of the major estrogen-inducible uterine secretory protein, lactoferrin (LF), by the seminal vesicles of the male offspring. (desdaughter.com)
  • Thus, we have studied the role of estrogens in abnormal and normal gene expression in the developing male reproductive tract using LF and seminal vesicle secretory protein IV (SVS IV), an androgen-regulated murine seminal vesicle secretory protein, as markers. (desdaughter.com)
  • When the female mice were fed acetaminophen for seven days, the unborn male offspring showed an 18% drop in seminal vesicle weight and a 45% drop in testosterone levels. (medshadow.org)
  • They initially wanted to know what bacteria in seminal fluid might mean for offspring of the mice they studied. (missouri.edu)
  • For their analysis, the investigators performed propensity score matching and stratified patients into 6 groups according to nerve-sparing and seminal vesicle-sparing status: no sparing at all, unilateral nerve sparing, bilateral nerve sparing, unilateral SVS with unilateral nerve sparing, unilateral SVS with bilateral nerve sparing, and bilateral SVS (with bilateral nerve sparing). (cancertherapyadvisor.com)
  • In a highly selected group of patients, [seminal vesicle sparing at RC] is oncologically safe and results in excellent functional outcomes that are achieved at an earlier time point postoperatively and remain superior over a longer time period," Dr Furrer's team concluded. (cancertherapyadvisor.com)
  • With regards to timing of early salvage radiotherapy, Dr. De Meerleer highlighted a study of 716 node-negative patients with undetectable postoperative PSA who experienced a PSA rise after RP, of which all patients received early salvage radiotherapy (defined as local radiation to the prostate and seminal vesicle bed, delivered at PSA ≤ 0.5 ng/ml) [1]. (urotoday.com)
  • Less injury probably occurred to the nerves surrounding the tips of the seminal vesicles, according to the investigators. (cancertherapyadvisor.com)
  • Along with prostate seminal vesicles and vas and some amount of nerves around the prostate are removed inorder to give a complete clearance. (chennaispecialityklinic.com)
  • Testosterone injectable achat en ligne, steroide anabolisant avant apres. (vitra-lux.ru)
  • The the rest comes from upstream structures corresponding to your prostate and seminal vesicles. (hilfe-hilders.de)
  • It may also have spread to the prostate and/or seminal vesicles. (urologicconsultsepa.com)
  • In the T3 stage, the tumour has grown outside the prostate and the tumour may have spread to the seminal vesicles. (careclinic.io)
  • If all the positive cores are at the base then seminal vesicle extension might be an issue. (prostatediaries.com)
  • context of Con A- and WGA-reactive glycans mark seminal prostasomes populations Mouse monoclonal to Cyclin E2 from normozoospermic and oligozoospermic males. (livingseas.org)
  • The seminal microbiome continued to stand out when compared to mouse poop, revealing 593 unique bacteria. (missouri.edu)
  • This seminal vesicle contains a newly-discovered microbiome in mice. (missouri.edu)
  • They compared it to bacteria in fecal samples of the same mice to see if bacteria in seminal fluid were unique. (missouri.edu)
  • More specifically, I would call an article seminal if it was the start of a new field/trend/idea, the work that inspired everything that came after, a starting point. (stackexchange.com)
  • With prostate removal, the ejaculate which is made from fluid from the prostate and seminal vesicles is also missing. (theroboticsurgeon.com)

No images available that match "seminal vesicles"