Ribulose substituted by one or more phosphoric acid moieties.
An oxidative decarboxylation process that converts GLUCOSE-6-PHOSPHATE to D-ribose-5-phosphate via 6-phosphogluconate. The pentose product is used in the biosynthesis of NUCLEIC ACIDS. The generated energy is stored in the form of NADPH. This pathway is prominent in tissues which are active in the synthesis of FATTY ACIDS and STEROIDS.
An enzyme of the transferase class that catalyzes the reaction sedoheptulose 7-phosphate and D-glyceraldehyde 3-phosphate to yield D-erythrose 4-phosphate and D-fructose phosphate in the PENTOSE PHOSPHATE PATHWAY. (Dorland, 27th ed) EC 2.2.1.2.
An enzyme of the transferase class that catalyzes the conversion of sedoheptulose 7-phosphate and D-glyceraldehyde 3-phosphate to D-ribose 5-phosphate and D-xylulose 5-phosphate in the PENTOSE PHOSPHATE PATHWAY. (Dorland, 27th ed) EC 2.2.1.1.
An enzyme of the oxidoreductase class that catalyzes the reaction 6-phospho-D-gluconate and NADP+ to yield D-ribulose 5-phosphate, carbon dioxide, and NADPH. The reaction is a step in the pentose phosphate pathway of glucose metabolism. (From Dorland, 27th ed) EC 1.1.1.43.

A kinetic study of ribulose bisphosphate carboxylase from the photosynthetic bacterium Rhodospirillum rubrum. (1/92)

The activation kinetics of purified Rhodospirillum rubrum ribulose bisphosphate carboxylase were analysed. The equilibrium constant for activation by CO(2) was 600 micron and that for activation by Mg2+ was 90 micron, and the second-order activation constant for the reaction of CO(2) with inactive enzyme (k+1) was 0.25 X 10(-3)min-1 . micron-1. The latter value was considerably lower than the k+1 for higher-plant enzyme (7 X 10(-3)-10 X 10(-3)min-1 . micron-1). 6-Phosphogluconate had little effect on the active enzyme, and increased the extent of activation of inactive enzyme. Ribulose bisphosphate also increased the extent of activation and did not inhibit the rate of activation. This effect might have been mediated through a reaction product, 2-phosphoglycolic acid, which also stimulated the extent of activation of the enzyme. The active enzyme had a Km (CO2) of 300 micron-CO2, a Km (ribulose bisphosphate) of 11--18 micron-ribulose bisphosphate and a Vmax. of up to 3 mumol/min per mg of protein. These data are discussed in relation to the proposed model for activation and catalysis of ribulose bisphosphate carboxylase.  (+info)

acs1 of Haemophilus influenzae type a capsulation locus region II encodes a bifunctional ribulose 5-phosphate reductase- CDP-ribitol pyrophosphorylase. (2/92)

The serotype-specific, 5.9-kb region II of the Haemophilus influenzae type a capsulation locus was sequenced and found to contain four open reading frames termed acs1 to acs4. Acs1 was 96% identical to H. influenzae type b Orf1, previously shown to have CDP-ribitol pyrophosphorylase activity (J. Van Eldere, L. Brophy, B. Loynds, P. Celis, I. Hancock, S. Carman, J. S. Kroll, and E. R. Moxon, Mol. Microbiol. 15:107-118, 1995). Low but significant homology to other pyrophosphorylases was only detected in the N-terminal part of Acs1, whereas the C-terminal part was homologous to several short-chain dehydrogenases/reductases, suggesting that Acs1 might be a bifunctional enzyme. To test this hypothesis, acs1 was cloned in an expression vector and overexpressed in Escherichia coli. Cells expressing this protein displayed both ribitol 5-phosphate dehydrogenase and CDP-ribitol pyrophosphorylase activities, whereas these activities were not detectable in control cells. Acs1 was purified to near homogeneity and found to copurify with ribitol 5-phosphate dehydrogenase and CDP-ribitol pyrophosphorylase activities. These had superimposable elution profiles from DEAE-Sepharose and Blue-Sepharose columns. The dehydrogenase activity was specific for ribulose 5-phosphate and NADPH in one direction and for ribitol 5-phosphate and NADP+ in the other direction and was markedly stimulated by CTP. The pyrophosphorylase showed activity with CTP and ribitol 5-phosphate or arabitol 5-phosphate. We conclude that acs1 encodes a bifunctional enzyme that converts ribulose 5-phosphate into ribitol 5-phosphate and further into CDP-ribitol, which is the activated precursor form for incorporation of ribitol 5-phosphate into the H. influenzae type a capsular polysaccharide.  (+info)

Crystal structure of carboxylase reaction-oriented ribulose 1, 5-bisphosphate carboxylase/oxygenase from a thermophilic red alga, Galdieria partita. (3/92)

Ribulose 1,5-bisphosphate carboxylase/oxygenase (Rubisco, EC 4.1.1. 39) obtained from a thermophilic red alga Galdieria partita has the highest specificity factor of 238 among the Rubiscos hitherto reported. Crystal structure of activated Rubisco from G. partita complexed with the reaction intermediate analogue, 2-carboxyarabinitol 1,5-bisphosphate (2-CABP) has been determined at 2.4-A resolution. Compared with other Rubiscos, different amino residues bring the structural differences in active site, which are marked around the binding sites of P-2 phosphate of 2-CABP. Especially, side chains of His-327 and Arg-295 show the significant differences from those of spinach Rubisco. Moreover, the side chains of Asn-123 and His-294 which are reported to bind the substrate, ribulose 1,5-bisphosphate, form hydrogen bonds characteristic of Galdieria Rubisco. Small subunits of Galdieria Rubisco have more than 30 extra amino acid residues on the C terminus, which make up a hairpin-loop structure to form many interactions with the neighboring small subunits. When the structures of Galdieria and spinach Rubiscos are superimposed, the hairpin region of the neighboring small subunit in Galdieria enzyme and apical portion of insertion residues 52-63 characteristic of small subunits in higher plant enzymes are almost overlapped to each other.  (+info)

Bacillus subtilis yckG and yckF encode two key enzymes of the ribulose monophosphate pathway used by methylotrophs, and yckH is required for their expression. (4/92)

The ribulose monophosphate (RuMP) pathway is one of the metabolic pathways for the synthesis of compounds containing carbon-carbon bonds from one-carbon units and is found in many methane- and methanol-utilizing bacteria, which are known as methylotrophs. The characteristic enzymes of this pathway are 3-hexulose-6-phosphate synthase (HPS) and 6-phospho-3-hexuloisomerase (PHI), neither of which was thought to exist outside methylotrophs. However, the presumed yckG gene product (YckG) of Bacillus subtilis shows a primary structure similar to that of methylotroph HPS (F. Kunst et al., Nature 390:249-256, 1997). We have also investigated the sequence similarity between the yckF gene product (YckF) and methylotroph PHI (Y. Sakai, R. Mitsui, Y. Katayama, H. Yanase, and N. Kato, FEMS Microbiol. Lett. 176:125-130, 1999) and found that the yckG and yckF genes of B. subtilis express enzymatic activities of HPS and PHI, respectively. Both of these activities were concomitantly induced in B. subtilis by formaldehyde, with induction showing dependence on the yckH gene, but were not induced by methanol, formate, or methylamine. Disruption of either gene caused moderate sensitivity to formaldehyde, suggesting that these enzymes may act as a detoxification system for formaldehyde in B. subtilis. In conclusion, we found an active yckG (for HPS)-yckF (for PHI) gene structure (now named hxlA-hxlB) in a nonmethylotroph, B. subtilis, which inherently preserves the RuMP pathway.  (+info)

A novel operon encoding formaldehyde fixation: the ribulose monophosphate pathway in the gram-positive facultative methylotrophic bacterium Mycobacterium gastri MB19. (5/92)

A 4.2-kb PstI fragment harboring the gene cluster of the ribulose monophosphate (RuMP) pathway for formaldehyde fixation was identified in the chromosome of a gram-positive, facultative methylotroph, Mycobacterium gastri MB19, by using the coding region of 3-hexulose-6-phosphate synthase (HPS) as the hybridization probe. The PstI fragment contained three complete open reading frames (ORFs) which encoded from the 5' end, a DNA-binding regulatory protein (rmpR), 6-phospho-3-hexuloisomerase (PHI; rmpB), and HPS (rmpA). Sequence analysis suggested that rmpA and rmpB constitute an operon, and Northern blot analysis of RNA extracted from bacteria grown under various conditions suggested that the expression of the two genes is similarly regulated at the transcriptional level. A similarity search revealed that the proteins encoded by rmpA and rmpB in M. gastri MB19 show high similarity to the unidentified proteins of nonmethylotrophic prokaryotes, including bacteria and anaerobic archaea. The clusters in the phylogenetic tree of the HPS protein of M. gastri MB19 and those in the phylogenetic tree of the PHI protein were nearly identical, which implies that these two formaldehyde-fixing genes evolved as a pair. These findings give new insight into the acquisition of the formaldehyde fixation pathway during the evolution of diverse microorganisms.  (+info)

Analysis of two formaldehyde oxidation pathways in Methylobacillus flagellatus KT, a ribulose monophosphate cycle methylotroph. (6/92)

The roles of cyclic formaldehyde oxidation via 6-phosphogluconate dehydrogenase and linear oxidation via the tetrahydromethanopterin (H4MPT)-linked pathway were assessed in an obligate methylotroph, Methylobacillus flagellatus KT, by cloning, sequencing and mutating two chromosomal regions containing genes encoding enzymes specifically involved in these pathways: 6-phosphogluconate dehydrogenase, glucose-6-phosphate dehydrogenase and methenyl H4MPT cyclohydrolase (gndA, zwf and mch). No null mutants were obtained in gndA or zwf, implying that the cyclic oxidation of formaldehyde is required for C1 metabolism in this obligate methylotroph, probably as the main energy-generating pathway. In contrast, null mutants were generated in mch, indicating that the H4MPT-linked pathway is dispensable. These mutants showed enhanced sensitivity to formaldehyde, suggesting that this pathway plays a secondary physiological role in this methylotroph. This function is in contrast to Methylobacterium extorquens AM1, in which the H4MPT-linked pathway is essential.  (+info)

Kinetic properties of the glucose-6-phosphate and 6-phosphogluconate dehydrogenases from Corynebacterium glutamicum and their application for predicting pentose phosphate pathway flux in vivo. (7/92)

The glucose-6-phosphate (Glc6P) and 6-phosphogluconate (6PG) dehydrogenases of the amino-acid-producing bacterium Corynebacterium glutamicum were purified to homogeneity and kinetically characterized. The Glc6P dehydrogenase was a heteromultimeric complex, which consists of Zwf and OpcA subunits. The product inhibition pattern of the Glc6P dehydrogenase was consistent with an ordered bi-bi mechanism. The 6PG dehydrogenase was found to operate according to a Theorell-Chance ordered bi-ter mechanism. Both enzymes were inhibited by NADPH and the 6PG dehydrogenase additionally by ATP, fructose 1,6-bisphosphate (Fru1,6P2), D-glyceraldehyde 3-phosphate (Gra3P), erythrose 4-phosphate and ribulose 5-phosphate (Rib5P). The inhibition by NADPH was considered to be most important, with inhibition constants of around 25 microM for both enzymes. Intracellular metabolite concentrations were determined in two isogenic strains of C. glutamicum with plasmid-encoded NAD- and NADP-dependent glutamate dehydrogenases. NADP+ and NADPH levels were between 130 microM and 290 microM, which is very much higher than the respective Km and Ki values. The Glc6P concentration was around 500 microM in both strains. The in vivo fluxes through the oxidative part of the pentose phosphate pathway calculated on the basis of intracellular metabolite concentrations and the kinetic constants of the purified enzymes determined in vitro were in agreement with the same fluxes determined by NMR after 13C-labelling. From the derived kinetic model thus validated, it is concluded that the oxidative pentose phosphate pathway in C. glutamicum is mainly regulated by the ratio of NADPH and NADP+ concentrations and the specific enzyme activities of both dehydrogenases.  (+info)

Is there scope for improving balance between RuBP-regeneration and carboxylation capacities in wheat at elevated CO2? (8/92)

Carboxylation and RuBP-regeneration capacities, which determine light-saturated photosynthetic rate, were analysed in leaves of spring wheat (Triticum aestivum L. cv. Minaret) grown under different atmospheric CO2 partial pressure (pCa) and N supply regimes. Capacities were estimated from a large number of gas exchange, Rubisco and ATP-synthase content measurements, and from these, the pCa at which the two capacities are equal was derived, to allow direct comparison with growth pCa. Acclimation of the balance between the two capacities to growth at elevated pCa in wheat was only partial and appears to occur mostly in older flag leaves and at low N. However, in contrast to conclusions drawn from previous analyses of these data, there was evidence of a specific effect of growth at 70 Pa pCa, where carboxylation capacity is reduced more than RuBP-regeneration capacity for a given leaf N content. A model was used to estimate the effects of fluctuations in PPFD and temperature in the growth environment on the optimal balance between these capacities. This showed that the observed balance between carboxylation and RuBP-regeneration capacities in young wheat leaves could be consistent with adaptation to the current, or even the preindustrial pCa.  (+info)

[[{fid:101,view_mode:default,fields:{format:default,field_file_image_alt_text[und][0][value]:,field_file_image_title_text[und][0][value]:,field_caption[und][0][value]:%3Cp%3EFigure%202.2.%26nbsp%3BA%20simplified%20(above)%20and%20detailed%20(below)%20description%20of%20the%20photosynthetic%20carbon%20reduction%20(PCR)%20cycle.%20The%20fixation%20of%20CO%3Csub%3E2%3C%2Fsub%3E%20by%20Rubisco%20to%20the%20acceptor%20molecule%20RuBP%20initiates%20the%20cycle%20with%20the%20production%20of%20two%20molecules%20of%20PGA.%20The%20subsequent%2C%20enzyme%20catalysed%2C%20gene
Several hits in gapped BLAST to lacA-related proteins, e.g. residues 4-150 are 43% similar to the enzyme from M.tuberculosis. Residues 5-151 are 40% similar to MG396, a predicted lacA/rpiB galactoside acetyltransferase. Other similarities involve hypothetical proteins and predicted phosphoriboisomerase B proteins (rpiB), e.g. residues 2-153 are 36% similar to RPIB_ECOLI. No significant similarities to T.pallidum or C.trachomatis ...
Affiliation:九大,(連合)農学研究科(研究院),教授, Research Field:作物学,作物,Crop science/Weed science, Keywords:光合成,水稲,光合成速度,水ストレス,クロロフィル蛍光,RuBPオキシゲナーゼ,ヘテロシス,RuBPカルボキシラーゼ,蒸散速度,光化学系, # of Research Projects:12, # of Research Products:4
This enzyme functions in the methionine salvage pathway by catalyzing the interconversion of methylthioribose-1-phosphate and methythioribulose-1-phosphate. Elevated expression of the encoded protein is associated with metastatic melanoma and this protein promotes melanoma cell invasion independent of its enzymatic activity. Mutations in this gene may be associated with vanishing white matter disease (VMWD). [provided by RefSeq, Jul 2016 ...
Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.
ID AEPER1_1_PE483 STANDARD; PRT; 370 AA. AC AEPER1_1_PE483; Q9YE84; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE RecName: Full=Putative methylthioribose-1-phosphate isomerase; DE Short=M1Pi; Short=MTR-1-P isomerase; EC=5.3.1 23;AltName: Full=MTNA-like DE protein; Short=aMTNA;AltName: Full=S-methyl-5-thioribose-1-phosphate DE isomerase; (AEPER1_1.PE483). GN OrderedLocusNames=APE_0686; OS AEROPYRUM PERNIX K1. OC Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales; OC Desulfurococcaceae; Aeropyrum. OX NCBI_TaxID=272557; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS AEPER1_1.PE483. CC Aeropyrum pernix K1, complete genome. CC annotated by Ensembl Genomes CC -!- ANNOTATIONS ORIGIN:MTNA_AERPE CC -!- FUNCTION: Catalyzes the interconversion of methylthioribose-1- CC phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P) CC (By similarity). CC -!- CATALYTIC ACTIVITY: ...
Carbohydrates,One-carbon Metabolism,Formaldehyde assimilation Ribulose monophosphate pathway,6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44 ...
Catalyzes the addition of molecular CO(2) and H(2)O to ribulose 1,5-bisphosphate (RuBP), generating two molecules of 3-phosphoglycerate (3-PGA). Functions in an archaeal AMP degradation pathway, together with AMP phosphorylase and R15P isomerase.
Rubisco. Molecular model of the enzyme rubisco (ribulose bisphosphate carboxylase oxygenase) complexed with 2-carboxyarabinitol biphosphate. Rubisco is thought to be the most abundant and important protein found in nature. It occurs in all plants and fixes carbon dioxide during photosynthesis. - Stock Image F006/9776
The enzyme at the centre of the fixation of carbon in photosynthesis (which is the ultimate source of our food) is RuBisCO (Ribulose Bisphosphate Carboxylase Oxygenase). It is sometimes called the lazy enzyme because it works so slowly. This is unjust since the process is so difficult that RuBisCO is the only enzyme that can…
involvement of APIP in the methionine salvage pathway, which plays a key role in many biological functions like cancer, apoptosis, microbial proliferation and inflammation ...
Given that the Calvin-Benson-Bassham (CBB) cycle enzymes downstream of RuBisCO require reducing equivalents, it is an advantage that Hg2+ inhibits RuBisCO, shutting GKT137831 nmr down the CBB cycle, making reducing equivalents available to mercuric reductase. We anticipate that enzymes of the Quayle pathway were inhibited (given the lack of carbon assimilation), forcing oxidation. of formaldehyde and formate to CO2 to generate reducing equivalents to meet requirements of the detoxification. It should be noted that hexulose-3-phosphate synthase (EC 4.1.2.43) - a key enzyme in the Quayle pathway - in M. capsulatus (Bath) is inhibited by Hg2+ at 100 μM (Ferenci et al., 1974). Cytochrome c oxidase was unable to reduce Hg2+ under the assay conditions employed PFT�� cost - either with cytochrome c550 or with ferrocyanide as the cofactor. - the specific activities were zero in both cases. The specific activity of an apparent mercuric reductase (± SEM; n = 7) was 352 (±18) nmol NADH oxidized ...
Mg2+ in various concentrations was added to purified Rubisco in vitro to gain insight into the mechanism of molecular interactions between Mg2+ and Rubisco. The enzyme activity assays showed that the
Glycine max Ribulose bisphosphate carboxylase small chain 1, chloroplastic (RBCS-1), mRNA; nuclear gene for chloroplast product ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
TY - JOUR. T1 - Characteristics of ribulose-1,5-bisphosphate carboxylase/oxygenase degradation by lysates of mechanically isolated chloroplasts from wheat leaves. AU - Miyadai, Kenji. AU - Mae, Tadahiko. AU - Makino, Amane. AU - Ojima, Kunihiko. PY - 1990/4. Y1 - 1990/4. N2 - The lysate from intact chloroplasts mechanically isolated from primary leaves of 9 day old seedlings of wheat (Triticum aestivum L. var Aoba) was incubated in the pH range of 5.5 to 8.5 at 37°C for 5 hours. Proteolytic activity against ribulose-1.5-bisphosphate carboxylase/oxygenase (Rubisco, EC 4.1.1.39) was estimated by disappearance of the large subunit of Rubisco or the appearance of its degradation products. Although the activity in lysates was weak, the products were detected by applying Western blotting. The degradation products were similar to those obtained when Rubisco was incubated with the lysate of vacuoles isolated from like leaves. Although some of the products were similar to those from vacuole lysates, ...
C4 photosynthesis is based on the division of labor between two distinct photosynthetically active cell types: mesophyll and bundle sheath cells. After conversion to HCO3−CO2 is initially fixed in mesophyll cells by phosphoenolpyruvate carboxylase in the form of either malate or Asp and then transported into bundle sheath cells. There CO2 is released, refixed by ribulose-1,5-bis-phosphate carboxylase/oxygenase (Rubisco), and finally enters the Calvin-Benson cycle as it occurs in C3 plants. As a bifunctional enzyme, Rubisco is able to catalyze the carboxylation as well as the oxygenation of its substrate ribulose 1,5-bisphosphate. The fixation of O2 leads to accumulation of phosphoglycolate, which is toxic for plant cells. To regenerate phosphoglycerate from phosphoglycolate, photorespiration is essential. However, this metabolic pathway leads to the loss of previously fixed CO2 and thus decreases the efficiency of photosynthesis. The high concentration of CO2 in the bundle sheath cells, caused ...
Lineage F.Lineage F is deeply diverging and defined by two highly similar DSR sequences not closely related to any available pure culture sequence. It demonstrates a weak specific association withDesulfotomaculum ruminis by KITCH analysis but forms an independent lineage by all other applied treeing methods.. There is a general need in microbial ecology to more directly relate community structure to community functions. Within the analytical framework of comparative gene sequencing, the most direct linkages are provided by genes encoding key physiological attributes. Several genes have been used in this way, including those for nitrogenase (3, 52-54), [NiFe] hydrogenase (48), ribulose bisphosphate carboxylase/oxygenase (33), methane monooxygenase (30), and ammonia monooxygenase (36, 37). However, with the possible exception of ammonia monooxygenase (restricted to two well-defined lineages within the proteobacteria), none of these genes provide fully comprehensive or consistent coverage. The DSR ...
Background on plant strategies under high heat/light low water conditions. C4 Plants: These plants thrive in environments with high temperatures and low humidities where the stomata in the leaves must be closed. Under these circumstances carbon dioxide concentrations fall in the leaves while oxygen rises, favoring photorespiration over photosynthesis and greatly reducing productivity. (In photorespiration oxygen binds competitively with carbon dioxide at the active site of RuBisCo: the net result is that Ru-1,5-bis P is oxidized and energy and carbon are lost instead of gained.) In C4 plants the photosynthesizing cells are protected from the atmosphere by a layer of mesophyll cells. In these cells the PEP carboxylase reaction is used to capture carbon dioxide, with the resulting oxaloacetate carbons transported to the photosynthesizing cell. [Figure 10.17, p 183] {overhead, H} The first compound incorporating the carbon dioxide thus has four carbons and hence the name (unlike in the Calvin cycle ...
Myers, R.W., Wray, J.W., Fish, S. and Abeles, R.H. (1993). Purification and characterization of an enzyme involved in oxidative carbon-carbon bond cleavage reactions in the methionine salvage pathway of Klebsiella pneumoniae. J. Biol. Chem. 268: 24785-24791. PMID 8227039. ...
The CO2-fixing enzyme ribulose bisphosphate carboxylase (Rubisco) works most efficiently at high concentrations of CO2. Many organisms have evolved…
K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] , (GenBank) rbcL; Ribulose bisphosphate carboxylase, large ...
csg:Cylst_2043 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) ribulose bisphosphate carboxylase small subunit (A) MQTLPKERRYETLSYLPPLSDAQIAKQIQYILNQGYIPAIEFNETSEPTELYWTMWKLPL FGAKSTQEVLGEVQGCRSQFNNCYIRVVGFDNIKQCQVLSFLVHKPNKY ...
syc:syc0129_c K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) rbcS; ribulose bisphosphate carboxylase small subunit (A) MSMKTLPKERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKL PLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRPGRY ...
K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) cbbS; ribulose bisphosphate carboxylase small ...
Heineke, D.; Sonnewald, U.; Buessis, D.; Guenter, G.; Leidreiter, K.; Wilke, I.; Raschke, K.; Willmitzer, L.; Heldt, H.-W.: Apoplastic Expression of Yeast-Derived Invertase in Potato - Effects on Photosynthesis, Leaf Solute Composition, Water Relations, and Tuber Composition. Plant Physiology 100 (1), S. 301 - 308 (1992 ...
Heineke, D.; Sonnewald, U.; Buessis, D.; Guenter, G.; Leidreiter, K.; Wilke, I.; Raschke, K.; Willmitzer, L.; Heldt, H.-W.: Apoplastic Expression of Yeast-Derived Invertase in Potato - Effects on Photosynthesis, Leaf Solute Composition, Water Relations, and Tuber Composition. Plant Physiology 100 (1), S. 301 - 308 (1992 ...
Phospho-4EBP1 (Thr36, Thr45), eFluor 660, clone: V3NTY24, eBioscience™ 100 Tests; eFluor 660 Phospho-4EBP1 (Thr36, Thr45), eFluor 660, clone: V3NTY24,...
Photosynthesis has two main stages: light reactions and the Calvin cycle; the Calvin cycle has three stages called carbon fixation, reduction and regeneration of RuBP. Photosynthesis is a chemical...
The group 1 methanol-utilizing bacteria examined in this study are gram-negative, nonsporeforming, rod-shaped organisms which use the ribulose monophosphate pathway for methanol utilization. These organisms are generally motile by means of a single polar flagellum, but a small number of strains are nonmotile, and although most are obligately methylotrophic, several strains utilize D-fructose in addition to methanol. Their deoxyribonucleic acid base composition ranges from 50.0 to 56.0 mol% guanine plus cytosine. Their cellular fatty acids consist predominantly of large amounts of straight-chain saturated C16:0 acid and unsaturated C16:1 acid. The major ubiquinone is Q-8, and Q-7 and Q-9 are present as minor components. Type strain TK 0113 (= Yordy and Weaver T-11 = ATCC 29475 = JCM 2850 = NCIB 11375) of Methylobacillus glycogenes is included in this group. The genus Methylobacillus was established based on the description of only one nonmotile strain, which does not utilize D-fructose. Therefore, we
Variations were observed in the large and small subunit amino acid compositions of RuBP carboxylase of 15 cassava cultivars. The Km (CO2) values ranged from 12.2 to 18.7 μM, while the Km (RuBP) values ranged from 11.8 to 55.6 μM. © 1989 ...
Remember to wear gloves and be very careful of the fixatives!!! Remember which side of the coverslip has the cells. Remember to discard used fix into the appropriate hazardous waste container in the chemical hood in the main lab.. Paraformaldehyde fixation. Fixative Stocks: 32% Paraformaldehyde: bottle under chemical hood in main lab. Detergent: 10% triton X 100. To make 10 mls of fixative: Paraformaldehyde: 1 mL stock 10% triton: 0.5 ml 10X PBS -/- 1 mL add water make 10 mL (8.5 mL). Use same method as Formaldehyde fixation.. ...
Journal of Ecology 2007 What is the relationship between changes in canopy leaf Blackwell Publishing Ltd area and changes in photosynthetic CO 2 flux in arctic ecosystems? L. E. STREET, G. R. SHAVER, M.
Effects of season-long elevated CO2 concentration and temperature on photosynthesis and rubisco activity and amount in field sown ...
Zhang Y, Heinsen MH, Kostic M, Pagani GM, Riera TV, Perovic I, Hedstrom L, Snider BB, Pochapsky TC. Analogs of 1-phosphonooxy-2,2-dihydroxy-3-oxo-5-(methylthio)pentane, an acyclic intermediate in the methionine salvage pathway: a new preparation and characterization of activity with E1 enolase/phosphatase from Klebsiella oxytoca. Bioorg Med Chem. 2004;12(14):3847-55. ...
FIG. 3. Immunoblot analyses of CbbLS-1, CbbLS-2, and CbbM RubisCOs. CFE (3 μg) were resolved on an SDS-15% polyacrylamide gel and transferred to a polyvinylidene difluoride membrane. An anti-CbbLS-1 oligopeptide antibody (a), an anti-CbbLS-2 oligopeptide antibody (b), and an anti-form II RubisCO antibody raised against CbbM from H. marinus (c) were used. CFE were prepared from 15% (lane 1), 2% (lane 2), 0.15% (lane 3), or 0.03% (lane 4) CO2 cultures. ...
This volume was digitized and made accessible online due to deterioration of the original print copy. If you are the author of this work and would like to have online access removed, please contact the Library Administration Office, 785-532-7400, [email protected] ...
Definition: one of three metabolic pathways for carbon fixation in photosynthesis, along with C4 and CAM. This process converts carbon dioxide and ribulose bisphosphate (RuBP, a 5-carbon sugar) into 3-phosphoglycerate through the following reaction: CO2 + H2O + RuBP → (2) 3-phosphoglycerate This reaction occurs in all plants as the first step of the Calvin-Benson cycle ...
Definition: one of three metabolic pathways for carbon fixation in photosynthesis, along with C4 and CAM. This process converts carbon dioxide and ribulose bisphosphate (RuBP, a 5-carbon sugar) into 3-phosphoglycerate through the following reaction: CO2 + H2O + RuBP → (2) 3-phosphoglycerate This reaction occurs in all plants as the first step of the Calvin-Benson cycle ...
Definition: one of three metabolic pathways for carbon fixation in photosynthesis, along with C4 and CAM. This process converts carbon dioxide and ribulose bisphosphate (RuBP, a 5-carbon sugar) into 3-phosphoglycerate through the following reaction: CO2 + H2O + RuBP → (2) 3-phosphoglycerate This reaction occurs in all plants as the first step of the Calvin-Benson cycle ...
Electron microscopy shows the chloroplast to consist of an envelope enclosing a complex of membranes, the thylakoid system often joined or stacked into grana; the lipid membranes, contrast with the background when stained with lipophilic electron dense osmium. The space between the envelope and thylakoid membranes is the chloroplast stroma. The envelope is composed of two membranes each about 5.6 nm thick separated by the intra envelope space (10 nm) with areas of high electron density which are possibly contact points between the membranes; they may be involved in transport, i.e., of proteins between cytosol and stroma. The membranes are lipid bilayers, of galactosyl glycerides and phosphatidyl choline, containing carotenoids but no chlorophyll.. The stroma contains indistinct granules and particles, mainly of proteins; the enzyme ribulose bisphosphate carboxylase (Rubisco) is the major soluble protein and may crystallize in unfavorable conditions such as water stress or air pollution. Other ...
Galdieria sulphuraria is a unicellular red alga found in hot sulphur springs. It is acido-thermophilic and can grow both autotrophically and heterotrophically in the dark. Other than living in extreme conditions of temperature and acidity, it can also tolerate high concentrations of metal ions. All these characteristics make it an ideal organism for genome sequencing and understanding the process of adaptation to extreme conditions and also genome evolution.The estimates for the genome size of Galdieria sulphuraria vary, depending on the method used, around 10 Mbp (Muravenko et al. 2001; Moreira et al., 1994) and 17 Mbp. There are also conflicting reviews on the chromosome number, ranging from 2 (Muravenko et al., 2001) to 40 (Moreira et al., 1994). ...
The light activation of ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) in vivo requires the presence of Rubisco activase, a nuclear-encoded chloropla
This record was replaced or removed. The sequence YP_007084606 is 100% identical to WP_015147336.1 over its full length. Be aware that a NCBI nonredundant RefSeq protein (WP_) can be annotated on large numbers of bacterial genomes that encode that identical protein.. Old YP_007084606.1 New WP_015147336.1 Identical proteins Re-annotation project. ...
DNA barcoding is a way to identify species via their species-specific genetic signatures. To do this for pollen, scientists sequence the DNA from a genetic region known to occur in all plants, but which varies from species to species. There are two parts to the standardized sequence we use for plant DNA barcoding. One is a section of the large subunit of a gene called ribulose-1,5-bisphosphate carboxylase/oxygenase (rbcL for short). The other is a gene called maturase-K (matK). These genes are both essential for a plant to survive, and are thus present in all plants. Once an investigator sequences these gene regions from a sample, they can be compared to a database containing all the known DNA sequences of rbcL and matK to identify the species ...
3rub: Crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase/oxygenase from tobacco refined at 2.0-A resolution.
The Calvin cycle of photosynthesis begins after light energy is transformed into chemical energy by the cells of plants. The adenosine triphosphate, or ATP, molecules created power the Calvin cycle....
Also, are you *sure* that you can trust the authors re: location of your protein ? Could *they* have created an artifact somehow ? Could this protein be nuclear-localized in certain types of cells or under specific conditions, and cytoplasm-localized under other conditions or in other cells ? A. Paul ,pd1 at mole.bio.cam.ac.uk, wrote in message news:3BBC9CFA.FEF22A0A at mole.bio.cam.ac.uk... , , , Melissa Greeve wrote: , , , Is this a logical explanation? Why would one protein act like this , , when fixed in 95% ethanol and not the other (both have similar , , cellular functions)? Can a PhD get any more complicated?? , , , , , , You could try formaldehyde fixation. 4% formaldehyde in PBS for 20 min , at RT , works well for a wide variety of antigens and cell types and in my hands , give sensible results for various nuclear antigens. , , Paul , , , , ...
Expression of MRI1 (MGC3207, MRDI, mtnA, Ypr118w) in kidney tissue. Antibody staining with HPA042744 and CAB045988 in immunohistochemistry.
Staphylococcus aureus; strain: USA300_FPR3757; locus tag: SAUSA300_0504 (SAUSA300_RS02700); symbol: pdxS; product: pyridoxal biosynthesis lyase PdxS
If were supposed to have the same amount of Calvin cycle-chemicals before and after, then how many C3 molecules can you make from 48 C1 molecules? If you calculate this, you should be able to get the rest ...
A hearty bowl of cereal gives you the energy to start your day, but how exactly did that energy make its way into your bowl? It all begins with photosynthesis,
Calvin and Hobbes: The Series is a Fan Fic series co-authored by Swing 123 and garfieldodie. It is perhaps the main installment in what is unofficially …
... ribulosephosphates MeSH D09.894.680.700 - polyisoprenyl phosphate monosaccharides MeSH D09.894.680.700.250 - dolichol ...
... ribulosephosphates MeSH D09.894.680.700 - polyisoprenyl phosphate monosaccharides MeSH D09.894.680.700.250 - dolichol ...
Ribulosephosphates. Serine. Trending Feeds. COVID-19. Coronaviruses encompass a large family of viruses that cause the common ...
2. Such ribulose phosphates are well‐known products of aldolases and a reverse aldol reaction will clearly generate ...
... while 10 return to remake 5 Ribulose phosphates (5-C each). ...
Ribulosephosphates Identity. International Standard Serial Number (ISSN) * 0076-6879 PubMed ID * 7144568 ...
Ribulosephosphates [D09.894.643.720] Ribulosephosphates * Polyisoprenyl Phosphate Sugars [D09.894.680] + Polyisoprenyl ...
Ribulosephosphates - metabolism , Photosynthesis - physiology ...
The ribulosephosphates are then converted back to their original form by the action of transketolase and transaldolase. ...

No FAQ available that match "ribulosephosphates"