Enzymes that catalyze the hydrolysis of ester bonds within RNA. EC 3.1.-.
An enzyme that catalyzes the endonucleolytic cleavage of pancreatic ribonucleic acids to 3'-phosphomono- and oligonucleotides ending in cytidylic or uridylic acids with 2',3'-cyclic phosphate intermediates. EC 3.1.27.5.
An enzyme catalyzing the endonucleolytic cleavage of RNA at the 3'-position of a guanylate residue. EC 3.1.27.3.
A ribonuclease that specifically cleaves the RNA moiety of RNA:DNA hybrids. It has been isolated from a wide variety of prokaryotic and eukaryotic organisms as well as RETROVIRUSES.
An RNA-containing enzyme that plays an essential role in tRNA processing by catalyzing the endonucleolytic cleavage of TRANSFER RNA precursors. It removes the extra 5'-nucleotides from tRNA precursors to generate mature tRNA molecules.
A family of enzymes that catalyze the endonucleolytic cleavage of RNA. It includes EC 3.1.26.-, EC 3.1.27.-, EC 3.1.30.-, and EC 3.1.31.-.
Hormones produced by the placenta include CHORIONIC GONADOTROPIN, and PLACENTAL LACTOGEN as well as steroids (ESTROGENS; PROGESTERONE), and neuropeptide hormones similar to those found in the hypothalamus (HYPOTHALAMIC HORMONES).
An endoribonuclease that is specific for double-stranded RNA. It plays a role in POST-TRANSCRIPTIONAL RNA PROCESSING of pre-RIBOSOMAL RNA and a variety of other RNA structures that contain double-stranded regions.
A 19-kDa cationic peptide found in EOSINOPHIL granules. Eosinophil-derived neurotoxin is a RIBONUCLEASE and may play a role as an endogenous antiviral agent.
A group of ribonucleotides (up to 12) in which the phosphate residues of each ribonucleotide act as bridges in forming diester linkages between the ribose moieties.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A nodular organ in the ABDOMEN that contains a mixture of ENDOCRINE GLANDS and EXOCRINE GLANDS. The small endocrine portion consists of the ISLETS OF LANGERHANS secreting a number of hormones into the blood stream. The large exocrine portion (EXOCRINE PANCREAS) is a compound acinar gland that secretes several digestive enzymes into the pancreatic ductal system that empties into the DUODENUM.
Cytidine (dihydrogen phosphate). A cytosine nucleotide containing one phosphate group esterified to the sugar moiety in the 2', 3' or 5' position.
A family of enzymes that catalyze the exonucleolytic cleavage of RNA. It includes EC 3.1.13.-, EC 3.1.14.-, EC 3.1.15.-, and EC 3.1.16.-. EC 3.1.-
Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
A ribonuclease activity that is a component of the HIV REVERSE TRANSCRIPTASE. It removes the RNA strand of the RNA-DNA heteroduplex produced by reverse transcription. Once the RNA moiety is removed a double stranded DNA copy of the HIV RNA can be synthesized.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
A polynucleotide consisting essentially of chains with a repeating backbone of phosphate and ribose units to which nitrogenous bases are attached. RNA is unique among biological macromolecules in that it can encode genetic information, serve as an abundant structural component of cells, and also possesses catalytic activity. (Rieger et al., Glossary of Genetics: Classical and Molecular, 5th ed)
RNA that has catalytic activity. The catalytic RNA sequence folds to form a complex surface that can function as an enzyme in reactions with itself and other molecules. It may function even in the absence of protein. There are numerous examples of RNA species that are acted upon by catalytic RNA, however the scope of this enzyme class is not limited to a particular type of substrate.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
The rate dynamics in chemical or physical systems.
A guanine nucleotide containing one phosphate group esterified to the sugar moiety and found widely in nature.
Ribonucleic acid in bacteria having regulatory and catalytic roles as well as involvement in protein synthesis.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
The spatial arrangement of the atoms of a nucleic acid or polynucleotide that results in its characteristic 3-dimensional shape.
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
Disruption of the non-covalent bonds and/or disulfide bonds responsible for maintaining the three-dimensional shape and activity of the native protein.
The small RNA molecules, 73-80 nucleotides long, that function during translation (TRANSLATION, GENETIC) to align AMINO ACIDS at the RIBOSOMES in a sequence determined by the mRNA (RNA, MESSENGER). There are about 30 different transfer RNAs. Each recognizes a specific CODON set on the mRNA through its own ANTICODON and as aminoacyl tRNAs (RNA, TRANSFER, AMINO ACYL), each carries a specific amino acid to the ribosome to add to the elongating peptide chains.
The extent to which an enzyme retains its structural conformation or its activity when subjected to storage, isolation, and purification or various other physical or chemical manipulations, including proteolytic enzymes and heat.
The most abundant form of RNA. Together with proteins, it forms the ribosomes, playing a structural role and also a role in ribosomal binding of mRNA and tRNAs. Individual chains are conventionally designated by their sedimentation coefficients. In eukaryotes, four large chains exist, synthesized in the nucleolus and constituting about 50% of the ribosome. (Dorland, 28th ed)
The parts of a macromolecule that directly participate in its specific combination with another molecule.
A group of 13 or more ribonucleotides in which the phosphate residues of each ribonucleotide act as bridges in forming diester linkages between the ribose moieties.
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
Enzymes that catalyze the hydrolysis of the internal bonds and thereby the formation of polynucleotides or oligonucleotides from ribo- or deoxyribonucleotide chains. EC 3.1.-.
A group of cytosine ribonucleotides in which the phosphate residues of each cytosine ribonucleotide act as bridges in forming diester linkages between the ribose moieties.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
An essential amino acid that is required for the production of HISTAMINE.
Separation of particles according to density by employing a gradient of varying densities. At equilibrium each particle settles in the gradient at a point equal to its density. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Enzymes which catalyze the hydrolases of ester bonds within DNA. EC 3.1.-.
A reaction that severs one of the sugar-phosphate linkages of the phosphodiester backbone of RNA. It is catalyzed enzymatically, chemically, or by radiation. Cleavage may be exonucleolytic, or endonucleolytic.
An enzyme of the transferase class that catalyzes the reaction RNA(n+1) and orthophosphate to yield RNA(n) and a nucleoside diphosphate, or the reverse reaction. ADP, IDP, GDP, UDP, and CDP can act as donors in the latter case. (From Dorland, 27th ed) EC 2.7.7.8.
A change from planar to elliptic polarization when an initially plane-polarized light wave traverses an optically active medium. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
An intracellular ribonucleolytic protein complex that participates in POSTRANSCRIPTIONAL RNA PROCESSING and RNA DEGRADATION.
Separation technique in which the stationary phase consists of ion exchange resins. The resins contain loosely held small ions that easily exchange places with other small ions of like charge present in solutions washed over the resins.
The property of objects that determines the direction of heat flow when they are placed in direct thermal contact. The temperature is the energy of microscopic motions (vibrational and translational) of the particles of atoms.
Processes involved in the formation of TERTIARY PROTEIN STRUCTURE.
Iodinated derivatives of acetic acid. Iodoacetates are commonly used as alkylating sulfhydryl reagents and enzyme inhibitors in biochemical research.
A basic science concerned with the composition, structure, and properties of matter; and the reactions that occur between substances and the associated energy exchange.
An imperfect fungus present on most agricultural seeds and often responsible for the spoilage of seeds in bulk storage. It is also used in the production of fermented food or drink, especially in Japan.
The composition, conformation, and properties of atoms and molecules, and their reaction and interaction processes.
The process of cleaving a chemical compound by the addition of a molecule of water.
Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.
Proteins found in EOSINOPHIL granules. They are primarily basic proteins that play a role in host defense and the proinflammatory actions of activated eosinophils.
Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.
The sum of the weight of all the atoms in a molecule.
RNA transcripts of the DNA that are in some unfinished stage of post-transcriptional processing (RNA PROCESSING, POST-TRANSCRIPTIONAL) required for function. RNA precursors may undergo several steps of RNA SPLICING during which the phosphodiester bonds at exon-intron boundaries are cleaved and the introns are excised. Consequently a new bond is formed between the ends of the exons. Resulting mature RNAs can then be used; for example, mature mRNA (RNA, MESSENGER) is used as a template for protein production.
Slow-moving exclusively arboreal mammals that inhabit the tropical forests of South and Central America.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
An order of New World mammals characterized by the absence of incisors and canines from among their teeth, and comprising the ARMADILLOS, the SLOTHS, and the anteaters. The order is distinguished from all others by what are known as xenarthrous vertebrae (xenos, strange; arthron, joint): there are secondary, and sometimes even more, articulations between the vertebrae of the lumbar series. The order was formerly called Edentata. (From Random House Unabridged Dictionary, 2d ed; Walker's Mammals of the World, 5th ed, vol. I, p515)
A metallic element that has the atomic symbol Mg, atomic number 12, and atomic weight 24.31. It is important for the activity of many enzymes, especially those involved in OXIDATIVE PHOSPHORYLATION.
Polymers made up of a few (2-20) nucleotides. In molecular genetics, they refer to a short sequence synthesized to match a region where a mutation is known to occur, and then used as a probe (OLIGONUCLEOTIDE PROBES). (Dorland, 28th ed)
Multicomponent ribonucleoprotein structures found in the CYTOPLASM of all cells, and in MITOCHONDRIA, and PLASTIDS. They function in PROTEIN BIOSYNTHESIS via GENETIC TRANSLATION.
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
A rigorously mathematical analysis of energy relationships (heat, work, temperature, and equilibrium). It describes systems whose states are determined by thermal parameters, such as temperature, in addition to mechanical and electromagnetic parameters. (From Hawley's Condensed Chemical Dictionary, 12th ed)
Proteins obtained from ESCHERICHIA COLI.
The relationship between the chemical structure of a compound and its biological or pharmacological activity. Compounds are often classed together because they have structural characteristics in common including shape, size, stereochemical arrangement, and distribution of functional groups.
Post-transcriptional biological modification of messenger, transfer, or ribosomal RNAs or their precursors. It includes cleavage, methylation, thiolation, isopentenylation, pseudouridine formation, conformational changes, and association with ribosomal protein.
Presence of warmth or heat or a temperature notably higher than an accustomed norm.
Positively charged atoms, radicals or groups of atoms with a valence of plus 2, which travel to the cathode or negative pole during electrolysis.
A group of compounds which consist of a nucleotide molecule to which an additional nucleoside is attached through the phosphate molecule(s). The nucleotide can contain any number of phosphates.
A thermostable extracellular metalloendopeptidase containing four calcium ions. (Enzyme Nomenclature, 1992) 3.4.24.27.
One of several basic proteins released from EOSINOPHIL cytoplasmic granules. Eosinophil cationic protein is a 21-kDa cytotoxic peptide with a pI of 10.9. Although eosinophil cationic protein is considered a member of the RNAse A superfamily of proteins, it has only limited RNAse activity.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Disruption of the secondary structure of nucleic acids by heat, extreme pH or chemical treatment. Double strand DNA is "melted" by dissociation of the non-covalent hydrogen bonds and hydrophobic interactions. Denatured DNA appears to be a single-stranded flexible structure. The effects of denaturation on RNA are similar though less pronounced and largely reversible.
Proteins prepared by recombinant DNA technology.
Chromatography on non-ionic gels without regard to the mechanism of solute discrimination.
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
An enzyme that synthesizes DNA on an RNA template. It is encoded by the pol gene of retroviruses and by certain retrovirus-like elements. EC 2.7.7.49.
RNA consisting of two strands as opposed to the more prevalent single-stranded RNA. Most of the double-stranded segments are formed from transcription of DNA by intramolecular base-pairing of inverted complementary sequences separated by a single-stranded loop. Some double-stranded segments of RNA are normal in all organisms.
A group of uridine ribonucleotides in which the phosphate residues of each uridine ribonucleotide act as bridges in forming diester linkages between the ribose moieties.
An actinomycete from which the antibiotic CHLORTETRACYCLINE is obtained.
The extent to which an RNA molecule retains its structural integrity and resists degradation by RNASE, and base-catalyzed HYDROLYSIS, under changing in vivo or in vitro conditions.
A low-energy attractive force between hydrogen and another element. It plays a major role in determining the properties of water, proteins, and other compounds.
Complexes of RNA-binding proteins with ribonucleic acids (RNA).
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
A serine endopeptidase that is formed from TRYPSINOGEN in the pancreas. It is converted into its active form by ENTEROPEPTIDASE in the small intestine. It catalyzes hydrolysis of the carboxyl group of either arginine or lysine. EC 3.4.21.4.
A strong organic base existing primarily as guanidium ions at physiological pH. It is found in the urine as a normal product of protein metabolism. It is also used in laboratory research as a protein denaturant. (From Martindale, the Extra Pharmacopoeia, 30th ed and Merck Index, 12th ed) It is also used in the treatment of myasthenia and as a fluorescent probe in HPLC.
The level of protein structure in which regular hydrogen-bond interactions within contiguous stretches of polypeptide chain give rise to alpha helices, beta strands (which align to form beta sheets) or other types of coils. This is the first folding level of protein conformation.
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
A basic enzyme that is present in saliva, tears, egg white, and many animal fluids. It functions as an antibacterial agent. The enzyme catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. EC 3.2.1.17.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Determination of the spectra of ultraviolet absorption by specific molecules in gases or liquids, for example Cl2, SO2, NO2, CS2, ozone, mercury vapor, and various unsaturated compounds. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Ribonucleic acid that makes up the genetic material of viruses.
A genus of zygomycetous fungi of the family Mucoraceae, order MUCORALES, a common saprophyte and facultative parasite of mature fruits and vegetables. It may cause cerebral mycoses in diabetes and cutaneous infection in severely burned patients.
A transfer RNA which is specific for carrying tyrosine to sites on the ribosomes in preparation for protein synthesis.
A compound formed in the liver from ammonia produced by the deamination of amino acids. It is the principal end product of protein catabolism and constitutes about one half of the total urinary solids.
A genus of mitosporic fungi containing about 100 species and eleven different teleomorphs in the family Trichocomaceae.
Techniques used to separate mixtures of substances based on differences in the relative affinities of the substances for mobile and stationary phases. A mobile phase (fluid or gas) passes through a column containing a stationary phase of porous solid or liquid coated on a solid support. Usage is both analytical for small amounts and preparative for bulk amounts.
A group of inosine ribonucleotides in which the phosphate residues of each inosine ribonucleotide act as bridges in forming diester linkages between the ribose moieties.
Genetically engineered MUTAGENESIS at a specific site in the DNA molecule that introduces a base substitution, or an insertion or deletion.
5'-Uridylic acid. A uracil nucleotide containing one phosphate group esterified to the sugar moiety in the 2', 3' or 5' position.
A family of iminourea derivatives. The parent compound has been isolated from mushrooms, corn germ, rice hulls, mussels, earthworms, and turnip juice. Derivatives may have antiviral and antifungal properties.
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
Chemical groups containing the covalent disulfide bonds -S-S-. The sulfur atoms can be bound to inorganic or organic moieties.
Techniques for measuring specific nucleic acid interaction with another nucleic acid or with a protein by digestion of the non-interacting nucleic acid by various nucleases. After all non-interacting regions are eliminated by nuclease digestion, the protected nucleic acid that remains is analyzed. DNA FOOTPRINTING utilizes this technique to analyze the DNA contact sites of DNA-BINDING PROTEINS.
A type of ion exchange chromatography using diethylaminoethyl cellulose (DEAE-CELLULOSE) as a positively charged resin. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Stable phosphorus atoms that have the same atomic number as the element phosphorus, but differ in atomic weight. P-31 is a stable phosphorus isotope.
A group of adenine ribonucleotides in which the phosphate residues of each adenine ribonucleotide act as bridges in forming diester linkages between the ribose moieties.
The scattering of x-rays by matter, especially crystals, with accompanying variation in intensity due to interference effects. Analysis of the crystal structure of materials is performed by passing x-rays through them and registering the diffraction image of the rays (CRYSTALLOGRAPHY, X-RAY). (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
An analytical technique for resolution of a chemical mixture into its component compounds. Compounds are separated on an adsorbent paper (stationary phase) by their varied degree of solubility/mobility in the eluting solvent (mobile phase).
The thick, yellowish-white, viscid fluid secretion of male reproductive organs discharged upon ejaculation. In addition to reproductive organ secretions, it contains SPERMATOZOA and their nutrient plasma.
RNA, usually prepared by transcription from cloned DNA, which complements a specific mRNA or DNA and is generally used for studies of virus genes, distribution of specific RNA in tissues and cells, integration of viral DNA into genomes, transcription, etc. Whereas DNA PROBES are preferred for use at a more macroscopic level for detection of the presence of DNA/RNA from specific species or subspecies, RNA probes are preferred for genetic studies. Conventional labels for the RNA probe include radioisotope labels 32P and 125I and the chemical label biotin. RNA probes may be further divided by category into plus-sense RNA probes, minus-sense RNA probes, and antisense RNA probes.
Nucleotides in which the purine or pyrimidine base is combined with ribose. (Dorland, 28th ed)
A phylum of fungi that produce their sexual spores (basidiospores) on the outside of the basidium. It includes forms commonly known as mushrooms, boletes, puffballs, earthstars, stinkhorns, bird's-nest fungi, jelly fungi, bracket or shelf fungi, and rust and smut fungi.
The biosynthesis of RNA carried out on a template of DNA. The biosynthesis of DNA from an RNA template is called REVERSE TRANSCRIPTION.
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
Topical antiseptic used mainly in wound dressings.
An electrochemical process in which macromolecules or colloidal particles with a net electric charge migrate in a solution under the influence of an electric current.
A deoxyribonucleotide polymer that is the primary genetic material of all cells. Eukaryotic and prokaryotic organisms normally contain DNA in a double-stranded state, yet several important biological processes transiently involve single-stranded regions. DNA, which consists of a polysugar-phosphate backbone possessing projections of purines (adenine and guanine) and pyrimidines (thymine and cytosine), forms a double helix that is held together by hydrogen bonds between these purines and pyrimidines (adenine to thymine and guanine to cytosine).
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
Widely used technique which exploits the ability of complementary sequences in single-stranded DNAs or RNAs to pair with each other to form a double helix. Hybridization can take place between two complimentary DNA sequences, between a single-stranded DNA and a complementary RNA, or between two RNA sequences. The technique is used to detect and isolate specific sequences, measure homology, or define other characteristics of one or both strands. (Kendrew, Encyclopedia of Molecular Biology, 1994, p503)
A serine endopeptidase secreted by the pancreas as its zymogen, CHYMOTRYPSINOGEN and carried in the pancreatic juice to the duodenum where it is activated by TRYPSIN. It selectively cleaves aromatic amino acids on the carboxyl side.
The monomeric units from which DNA or RNA polymers are constructed. They consist of a purine or pyrimidine base, a pentose sugar, and a phosphate group. (From King & Stansfield, A Dictionary of Genetics, 4th ed)
Theoretical representations that simulate the behavior or activity of chemical processes or phenomena; includes the use of mathematical equations, computers, and other electronic equipment.
Sulfur-sulfur bond isomerases that catalyze the rearrangement of disulfide bonds within proteins during folding. Specific protein disulfide-isomerase isoenzymes also occur as subunits of PROCOLLAGEN-PROLINE DIOXYGENASE.
A transfer RNA which is specific for carrying aspartic acid to sites on the ribosomes in preparation for protein synthesis.
A reverse transcriptase encoded by the POL GENE of HIV. It is a heterodimer of 66 kDa and 51 kDa subunits that are derived from a common precursor protein. The heterodimer also includes an RNAse H activity (RIBONUCLEASE H, HUMAN IMMUNODEFICIENCY VIRUS) that plays an essential role the viral replication process.
A double-stranded polyribonucleotide comprising polyadenylic and polyuridylic acids.

Gene silencing: plants and viruses fight it out. (1/4689)

Plants can become 'immune' to attack by viruses by degrading specific viral RNA, but some plant viruses have evolved the general capacity to suppress this resistance mechanism.  (+info)

Structural basis for the specificity of the initiation of HIV-1 reverse transcription. (2/4689)

Initiation of human immunodeficiency virus type 1 (HIV-1) reverse transcription requires specific recognition of the viral genome, tRNA3Lys, which acts as primer, and reverse transcriptase (RT). The specificity of this ternary complex is mediated by intricate interactions between HIV-1 RNA and tRNA3Lys, but remains poorly understood at the three-dimensional level. We used chemical probing to gain insight into the three-dimensional structure of the viral RNA-tRNA3Lys complex, and enzymatic footprinting to delineate regions interacting with RT. These and previous experimental data were used to derive a three-dimensional model of the initiation complex. The viral RNA and tRNA3Lys form a compact structure in which the two RNAs fold into distinct structural domains. The extended interactions between these molecules are not directly recognized by RT. Rather, they favor RT binding by preventing steric clashes between the nucleic acids and the polymerase and inducing a viral RNA-tRNA3Lys conformation which fits perfectly into the nucleic acid binding cleft of RT. Recognition of the 3' end of tRNA3Lys and of the first template nucleotides by RT is favored by a kink in the template strand promoted by the short junctions present in the previously established secondary structure.  (+info)

Possible involvement of proteasomes (prosomes) in AUUUA-mediated mRNA decay. (3/4689)

We have identified a cellular target for proteasomal endonuclease activity. Thus, 20 S proteasomes interact with the 3'-untranslated region of certain cytoplasmic mRNAs in vivo, and 20 S proteasomes isolated from Friend leukemia virus-infected mouse spleen cells were found to be associated with a mRNA fragment showing great homology to the 3'-untranslated region of tumor necrosis factor-beta mRNA that contains AUUUA sequences. We furthermore demonstrate that 20 S proteasomes destabilize oligoribonucleotides corresponding to the 3'-untranslated region of tumor necrosis factor-alpha, creating a specific cleavage pattern. The cleavage reaction is accelerated with increasing number of AUUUA motifs, and major cleavage sites are localized at the 5' side of the A residues. These results strongly suggest that 20 S proteasomes could be involved in the destabilization of cytokine mRNAs such as tumor necrosis factor mRNAs and other short-lived mRNAs containing AUUUA sequences.  (+info)

Characterization of nuclear structures containing superhelical DNA. (4/4689)

Structures resembling nuclei but depleted of protein may be released by gently lysing cells in solutions containing non-ionic detergents and high concentrations of salt. These nucleoids sediment in gradients containing intercalating agents in a manner characteristic of DNA that is intact, supercoiled and circular. The concentration of salt present during isolation of human nucleoids affects their protein content. When made in I-95 M NaCl they lack histones and most of the proteins characteristic of chromatin; in 1-0 M NaCl they contain variable amounts of histones. The effects of various treatments on nucleoid integrity were investigated.  (+info)

Purification of gibberellic acid-induced lysosomes from wheat aleurone cells. (5/4689)

Using isopycnic density gradient centrifugation, lysosomes were concentrated in a single region of a sucrose-Ficoll gradient (p = 1-10 g cm-3), well separated from most other cell organelles. Gibberellic acid-induced lysosomes were found to be rich in alpha-amylase and protease but not ribonuclease. The lysosomal band also contained a majority of the NADH2-cytochrome c reductase, a marker enzyme for endoplasmic reticulum, found in the gradient. Examination of electron micrographs revealed that a purified band of lyosomes contained at least 3 vesicle types, ranging in size from 0-1 to 0-5 mum. The significance of these findings to proposed mechanisms of action of gibberellic acid is discussed.  (+info)

Conserved mechanism of PLAG1 activation in salivary gland tumors with and without chromosome 8q12 abnormalities: identification of SII as a new fusion partner gene. (6/4689)

We have previously shown (K. Kas et al, Nat. Genet., 15: 170-174, 1997) that the developmentally regulated zinc finger gene pleomorphic adenoma gene 1 (PLAG1) is the target gene in 8q12 in pleomorphic adenomas of the salivary glands with t(3;8)(p21;q12) translocations. The t(3;8) results in promoter swapping between PLAG1 and the constitutively expressed gene for beta-catenin (CTNNB1), leading to activation of PLAG1 expression and reduced expression of CTNNB1. Here we have studied the expression of PLAG1 by Northern blot analysis in 47 primary benign and malignant human tumors with or without cytogenetic abnormalities of 8q12. Overexpression of PLAG1 was found in 23 tumors (49%). Thirteen of 17 pleomorphic adenomas with a normal karyotype and 5 of 10 with 12q13-15 abnormalities overexpressed PLAG1, which demonstrates that PLAG1 activation is a frequent event in adenomas irrespective of karyotype. In contrast, PLAG1 was overexpressed in only 2 of 11 malignant salivary gland tumors analyzed, which suggests that, at least in salivary gland tumors, PLAG1 activation preferentially occurs in benign tumors. PLAG1 over-expression was also found in three of nine mesenchymal tumors, i.e., in two uterine leiomyomas and one leiomyosarcoma. RNase protection, rapid amplification of 5'-cDNA ends (5'-RACE), and reverse transcription-PCR analyses of five adenomas with a normal karyotype revealed fusion transcripts in three tumors. Nucleotide sequence analysis of these showed that they contained fusions between PLAG1 and CTNNB1 (one case) or PLAG1 and a novel fusion partner gene, i.e., the gene encoding the transcription elongation factor SII (two cases). The fusions occurred in the 5' noncoding region of PLAG1, leading to exchange of regulatory control elements and, as a consequence, activation of PLAG1 gene expression. Because all of the cases had grossly normal karyotypes, the rearrangements must result from cryptic rearrangements. The results suggest that in addition to chromosomal translocations and cryptic rearrangements, PLAG1 may also be activated by mutations or indirect mechanisms. Our findings establish a conserved mechanism of PLAG1 activation in salivary gland tumors with and without 8q12 aberrations, which indicates that such activation is a frequent event in these tumors.  (+info)

Simplified methods for pKa and acid pH-dependent stability estimation in proteins: removing dielectric and counterion boundaries. (7/4689)

Much computational research aimed at understanding ionizable group interactions in proteins has focused on numerical solutions of the Poisson-Boltzmann (PB) equation, incorporating protein exclusion zones for solvent and counterions in a continuum model. Poor agreement with measured pKas and pH-dependent stabilities for a (protein, solvent) relative dielectric boundary of (4,80) has lead to the adoption of an intermediate (20,80) boundary. It is now shown that a simple Debye-Huckel (DH) calculation, removing both the low dielectric and counterion exclusion regions associated with protein, is equally effective in general pKa calculations. However, a broad-based discrepancy to measured pH-dependent stabilities is maintained in the absence of ionizable group interactions in the unfolded state. A simple model is introduced for these interactions, with a significantly improved match to experiment that suggests a potential utility in predicting and analyzing the acid pH-dependence of protein stability. The methods are applied to the relative pH-dependent stabilities of the pore-forming domains of colicins A and N. The results relate generally to the well-known preponderance of surface ionizable groups with solvent-mediated interactions. Although numerical PB solutions do not currently have a significant advantage for overall pKa estimations, development based on consideration of microscopic solvation energetics in tandem with the continuum model could combine the large deltapKas of a subset of ionizable groups with the overall robustness of the DH model.  (+info)

Variants of ribonuclease inhibitor that resist oxidation. (8/4689)

Human ribonuclease inhibitor (hRI) is a cytosolic protein that protects cells from the adventitious invasion of pancreatic-type ribonucleases. hRI has 32 cysteine residues. The oxidation of these cysteine residues to form disulfide bonds is a rapid, cooperative process that inactivates hRI. The most proximal cysteine residues in native hRI are two pairs that are adjacent in sequence: Cys94 and Cys95, and Cys328 and Cys329. A cystine formed from such adjacent cysteine residues would likely contain a perturbing cis peptide bond within its eight-membered ring, which would disrupt the structure of hRI and could facilitate further oxidation. We find that replacing Cys328 and Cys329 with alanine residues has little effect on the affinity of hRI for bovine pancreatic ribonuclease A (RNase A), but increases its resistance to oxidation by 10- to 15-fold. Similar effects are observed for the single variants, C328A hRI and C329A hRI, suggesting that oxidation resistance arises from the inability to form a Cys328-Cys329 disulfide bond. Replacing Cys94 and Cys95 with alanine residues increases oxidation resistance to a lesser extent, and decreases the affinity of hRI for RNase A. The C328A, C329A, and C328A/C329A variants are likely to be more useful than wild-type hRI for inhibiting pancreatic-type ribonucleases in vitro and in vivo. We conclude that replacing adjacent cysteine residues can confer oxidation resistance in a protein.  (+info)

Ribonuclease activity in cell-free thymus homogenates was elevated for five strains of mice genetically predisposed toward leukemia or reticulum cell neoplasms (AKR, C58, PL, RF, and SJL). Such increased activity was directed against polyuridylic acid and was observed in 8-wk old mice, well before the onset of neoplastic transformation. Similarly, white blood cell ribonuclease activity was elevated in mice of the strains AKR, C2H/He, PL and RF. Statistical analysis indicated that such elevated activity in these strains related to their high incidence of spontaneous neoplastic disease. Elevated ribonuclease activity thus represents a new biochemical marker relating to the genetic propensity of some strains of mice to die prematurely of spontaneous neoplasia. ...
The affinity of RI for ribonucleases is among the highest for any protein-protein interaction; the dissociation constant of the RI-RNase A complex is in the femtomolar (fM) range under physiological conditions while that for the RI-angiogenin complex is less than 1 fM. Despite this high affinity, RI is able to bind a wide variety of RNases A despite their relatively low sequence identity. Both biochemical studies and crystallographic structures of RI-RNase A complexes suggest that the interaction is governed largely by electrostatic interactions, but also involves substantial buried surface area.[3][4] RIs affinity for ribonucleases is important, since many ribonucleases have cytotoxic and cytostatic effects that correlate well with ability to bind RI.[5] Mammalian RIs are unable to bind certain pancreatic ribonuclease family members from other species. In particular, amphibian RNases, such ranpirnase and amphinase from the Northern leopard frog, escape mammalian RI and have been noted to have ...
Cyclic GMP-AMP synthase (cGAS) is a key DNA sensor capable of detecting microbial DNA and activating the adaptor protein stimulator of interferon genes (STING), leading to interferon (IFN) production and host antiviral responses. Cells exhibited reduced type I IFN production in response to cytosolic DNA in the absence of cGAS. Although the cGAS/STING-mediated DNA-sensing signal is crucial for host defense against many viruses, especially for DNA viruses, few viral components have been identified to specifically target this signaling pathway. Herpes simplex virus 1 (HSV-1) is a DNA virus that has evolved multiple strategies to evade host immune responses. In the present study, we found that HSV-1 tegument protein UL41 was involved in counteracting the cGAS/STING-mediated DNA-sensing pathway. Our results showed that wild-type (WT) HSV-1 infection could inhibit immunostimulatory DNA-induced activation of the IFN signaling pathway compared with the UL41-null mutant virus (R2621), and ectopic expression of
Ribonucleases can specifically recognize and cleave RNA at the site of sequence mismatches in RNA-DNA or RNA-RNA hybrids. The cleavage products are then characterized by gel electrophoresis. In this unit, a procedure is presented for RNase cleavage of (32)P-labeled riboprobes (transcribed from a cloned copy of the normal sequence) that have been annealed to amplified sequences of a candidate gene or cDNA obtained from affected individuals. A Support Protocol explains how to prepare riboprobes from a genomic or cDNA template obtained from a nonmutant individual. An alternate protocol describes cleavage of RNARNA hybrids using a nonisotopic RNase cleavage mutation assay. Sequential PCR and in vitro transcription steps generate sufficient quantities of duplex RNA targets so that the cleavage products can be detected on a gel by ethidium bromide staining. The unit also discusses the use of alternative ribonucleases for cleaving singlebase mismatches.
TY - JOUR. T1 - The catalytic activity and secretion of zebrafish RNases are essential for their in vivo function in motor neurons and vasculature. AU - Ferguson, Ross. AU - Holloway, Daniel E. AU - Chandrasekhar, Anand. AU - Acharya, K Ravi. AU - Subramanian, Vasanta. PY - 2019/2/1. Y1 - 2019/2/1. N2 - Angiogenin (hANG), a member of the Ribonuclease A superfamily has angiogenic, neurotrophic and neuroprotective activities. Mutations in hANG have been found in patients with Amyotrophic lateral sclerosis (ALS). The zebrafish (Danio rerio) rnasel-1, 2 and 3 are orthologues of hANG and of these only Rnasel-1 and Rnasel-2 have been shown to be angiogenic. Herein we show that NCI-65828, a potent and specific small molecule inhibitor of hANG inhibits Rnasel-1 to a similar extent. Treatment of early zebrafish embryos with NCI-65828, or with terrein, a fungal metabolite which prevents the secretion of hANG, resulted in spinal neuron aberrations as well defects in trunk vasculature. Our detailed ...
The Ribonuclease A Superfamily is composed of a group of structurally similar peptides that are secreted by immune cells and epithelial tissues. Several members of the Ribonuclease A Superfamily demonstrate antimicrobial activity, and it has been suggested that some of these ribonucleases play an essential role in host defense. Ribonuclease 7 (RNase 7) is an epithelial-derived secreted peptide with potent broad-spectrum antimicrobial activity. This review summarizes the published literature on RNase 7s antimicrobial properties, structure, regulation, and contributions to host defense. In doing so, we conclude by highlighting key knowledge gaps that must be investigated to completely understand the potential of developing RNase 7 as a novel therapeutic for human infectious diseases.
The virion host shutoff protein (Vhs) is a herpes simplex virus (HSV) protein involved in early shutoff of the host cell. It is a component of the infecting virion, located in the tegument region, that works by rapidly ...
Herpes simplex virus 1 (HSV-1) induces a profound host shut-off during lytic infection. The virion host shut-off (vhs) protein plays a key role in this process by efficiently cleaving host and viral mRNAs. Furthermore, the onset of viral DNA replication is accompanied by a rapid decline in host transcriptional activity. To dissect relative contributions of both mechanisms and elucidate gene-specific host transcriptional responses throughout the first 8h of lytic HSV-1 infection, we employed RNA-seq of total, newly transcribed (4sU-labelled) and chromatin-associated RNA in wild-type (WT) and Δvhs infection of primary human fibroblasts. Following virus entry, vhs activity rapidly plateaued at an elimination rate of around 30% of cellular mRNAs per hour until 8h p.i. In parallel, host transcriptional activity dropped to 10-20%. While the combined effects of both phenomena dominated infection-induced changes in total RNA, extensive gene-specific transcriptional regulation was observable in ...
Ribonuclease Rnase Z complexed with transfer RNA (ribonucleic acid). Computer model showing the structure of bacterial ribonuclease Rnase Z (orange) complexed with synthetic transfer RNA (cyan). From Bacillus subtilis. - Stock Image C035/8314
Globally modulates RNA abundance by binding to RNase E (Rne) and regulating its endonucleolytic activity. Can modulate Rne action in a substrate-dependent manner by altering the composition of the degradosome. Modulates RNA-binding and helicase activities of the degradosome.
Fingerprint Dive into the research topics of Covalent linkage of ribonuclease S-peptide to microinjected proteins causes their intracellular degradation to be enhanced during serum withdrawal. Together they form a unique fingerprint. ...
The new understanding could help both approaches, says UW-Madison professor of biochemistry Ronald Raines, who has long studied ribonucleases - enzymes that break apart RNA, a messenger with multiple roles inside the cell. In 1998, he discovered how to alter one ribonuclease to avoid its deactivation in the body. Soon thereafter, he found that the engineered ribonuclease was more toxic to cancer cells than to others.. Raines patented the advance through the Wisconsin Alumni Research Foundation and with UW-Madison chemist Laura Kiessling cofounded Quintessence Biosciences in Madison. They remain shareholders in the firm, which has licensed the patent from WARF and begun early-phase human trials with the ribonuclease at the UW Carbone Cancer Center and MD Anderson Cancer Center in Houston.. The current study began as an effort to figure out why the ribonuclease was selective for cancer cells. To identify which structure on the cell surface helped it enter the cell, Raines screened 264 structures ...
The new understanding could help both approaches, says UW-Madison professor of biochemistry Ronald Raines, who has long studied ribonucleases - enzymes that break apart RNA, a messenger with multiple roles inside the cell. In 1998, he discovered how to alter one ribonuclease to avoid its deactivation in the body. Soon thereafter, he found that the engineered ribonuclease was more toxic to cancer cells than to others.. Raines patented the advance through the Wisconsin Alumni Research Foundation and with UW-Madison chemist Laura Kiessling cofounded Quintessence Biosciences in Madison. They remain shareholders in the firm, which has licensed the patent from WARF and begun early-phase human trials with the ribonuclease at the UW Carbone Cancer Center and MD Anderson Cancer Center in Houston.. The current study began as an effort to figure out why the ribonuclease was selective for cancer cells. To identify which structure on the cell surface helped it enter the cell, Raines screened 264 structures ...
X-ray structure of two crystalline forms of a streptomycete ribonuclease with cytotoxic activity. - Jozef Sevcik, Lubica Urbanikova, Peter A Leland, Ronald T Raines
CP000859.PE14 Location/Qualifiers FT CDS_pept 15398..16750 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Dole_0014 FT /product=putative ribonuclease BN FT /note=TIGRFAM: putative ribonuclease BN; PFAM: FT ribonuclease BN; KEGG: pin:Ping_1819 putative ribonuclease FT BN FT /db_xref=EnsemblGenomes-Gn:Dole_0014 FT /db_xref=EnsemblGenomes-Tr:ABW65824 FT /db_xref=GOA:A8ZRQ7 FT /db_xref=InterPro:IPR017039 FT /db_xref=InterPro:IPR036388 FT /db_xref=InterPro:IPR036390 FT /db_xref=UniProtKB/TrEMBL:A8ZRQ7 FT /protein_id=ABW65824.1 FT /translation=MNESKKKRLAARTSGALDFLRTGIWRVRLRELETRERVLVRYARI FT FMIAGREFITDGGPLRASALTFYTVLSLVPVMALAFAVAKGFGLQQTLEKEVLAQFPGQ FT EAVILQMIEYARALLDQTKGGLLAGVGVAVLIWTVIKVLNNIEKSFNAIWANTTPRSMG FT KKFSDYLSIMLVGPLLLILSGSATVLVATQVTAITNKIFFLGWFAPIIMTGLQLLPYLF FT VWLLFSFIYGFMPNTRVPVRSCIFGGVLAGTAFKLLQWAYLIFQVGVSRYNAIYGSFAA FT LPLFLIWMQLSWLVTLFGAELAYAHQSVGHYELEPDSRNISDFLKRIYGLYVAHLLVKT FT FKNGEPPLTADQISARLDLPIRMVNRLLETLSAAGLATQTLSGTGGDPAWQPGRDITDI FT ...
Ribonuclease - Instruments Consumables Reagents Advanced BioMatrix,RANDOX,RANDOX ELISA,Biomedical, biochemical reagents, laboratory supplies, equipment, antibodies, ELISA kits, diagnostic reagents, methods of experimental techniques, general analytical instruments, material testing instruments and equipment, used laboratory equipment, instruments and equipment, life sciences, environmental monitoring equipment , measurement, measuring instruments, rotating wall bioreactor, three-dimensional tissue / stem cell culture system; microcapsule
NMR study of the cold, heat, and pressure unfolding of ribonuclease A. Related Articles NMR study of the cold, heat, and pressure unfolding of
Buy our Natural cow Ribonuclease A protein. Ab52579 is an active full length protein produced in Nativesyntheticaly and has been validated in ChIP. Abcam…
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
RNases are an often feared in molecular biology labs because of their high stability and ominous presence in virtually all living systems. Consequently, people who work with RNA are trained to exercise extreme caution to avoid RNA degradation: change gloves often because human hands ooze RNases; use only sterilized labware as microbes may be sources of RNases; for surfaces that cant be autoclaved, use sprays like RNase Zap (SDS- or guanidine-containing solutions). Such cautionary steps are especially necessary when dealing with low abundance RNA samples.. RNAs can be produced by in vitro transcription (IVT), a simple reaction requiring only a DNA template (double-stranded or even single-stranded DNA as long as the promoter region is double-stranded), RNA polymerase (from T7, SP6, or T3 phage), NTPs, and a reaction buffer that provides appropriate salt and pH. Standard NTPs may be replaced with modified ones to either increase stability or to reduce immune-response when transfected into ...
The KOMP Repository is located at the University of California Davis and Childrens Hospital Oakland Research Institute. Question? Comments? For Mice, Cells, and germplasm please contact us at [email protected], US 1-888-KOMP-MICE or International +1-530-752-KOMP, or for vectors [email protected] or +1-510-450-7917 ...
Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity (Potential ...
RIBONUCLEASE A FAMILY, 1 (Ribonuclease pancreatic) is an enzyme that in humans is encoded by the RNASE1 gene. By genomic sequence analysis, RNASE1…
We characterized the activity of Barnase on an inducible plasmid constructed by UC Berkeley for iGEM 2007 (part I716408C). This construct works by expressing background levels of Barstar with in the presence of an inducible Barnase. When induced, Barnase will overwhelm Barstar. Higher levels of Barnase expression resulted in lower rates of growth in the bacteria, affirming the principle of Barnase-based growth control for the genetic fence, and confirming the results from Berkeley 2008. We characterized the growth repression of Barnase under a range of arabinose inducer concentrations ...
Complete information for RNY1 gene (RNA Gene), RNA, Ro-Associated Y1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for RNY5 gene (RNA Gene), RNA, Ro-Associated Y5, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
1AFK: Crystal structures of ribonuclease A complexes with 5-diphosphoadenosine 3-phosphate and 5-diphosphoadenosine 2-phosphate at 1.7 A resolution.
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPWSTVENPSMDT 1 - 70 VNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQLCRSPCLEPHILKRNEILQDF 71 - 140 KPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEADQ 141 - 210 TVSTINTITRETSSLESQRSESPMQEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLER 211 - 280 GHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGII 281 - 350 VSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGK 351 - 420 KCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQ 421 - 490 SDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGQYP 491 - 560 SMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERRFSLDTDYRISSVASDCSSEG 561 - 630 SMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHK 631 - 700 PPLPHLALHLPHSAVGARSSCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSR 701 - 770 QEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREK 771 - 840 ...
pep:known chromosome:VEGA66:14:51853768:51854643:1 gene:OTTMUSG00000036430 transcript:OTTMUST00000093341 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Ear6 description:eosinophil-associated, ribonuclease A family, member 6 ...
pep:known chromosome:VEGA66:14:44102654:44103534:1 gene:OTTMUSG00000034641 transcript:OTTMUST00000087933 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Ear2 description:eosinophil-associated, ribonuclease A family, member 2 ...
TITLE: Heist FORMAT: VHS Rated: R Year: 2002 Theatrical Release Date: STARRING: Danny DeVito, Delroy Lindo, Gene Hackman, Patti LuPone, R
Paracoccidioidomycosis is a chronic granulomatous disease caused by the fungus Paracoccidioides brasiliensis. Although eosinophils have long been associated with the immune defense against helminths, the role of eosinophils in the immune response to fungal diseases is not as well studied. The eosinophil granule major basic protein is toxic to helminths and mammalian cells in vitro, and its release has been used as a marker of eosinophil localization and degranulation. To determine whether eosinophil infiltration and degranulation, as evidenced by the deposition of major basic protein, occur in lesions of P. brasiliensis, we used an immunofluorescence technique to localize the P. brasiliensis organisms and eosinophils and major basic protein. Initially, all tissues were stained with polyclonal antibody to major basic protein; subsequently, colocalization of major basic protein and P. brasiliensis by double staining with mouse and rabbit antibodies, respectively, was performed. Nine biopsy tissues from
PRG2 antibody [1.B.787] (proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)) for ELISA, IHC-Fr, IHC-P, WB. Anti-PRG2 mAb (GTX14462) is tested in Human samples. 100% Ab-Assurance.
TY - JOUR. T1 - Preparation and properties of water-insoluble derivatives of ribonuclease T1. AU - Lee, J. C.. N1 - Funding Information: The author wishes to thank Professor V. M. Ingram for his interest and for the use of his laboratory during the initial phase of this investigation. The support by the U.S. Public Health Service (grant No. AM o839 o) is acknowledged.. PY - 1971/6/16. Y1 - 1971/6/16. N2 - Several enzymatically active water-insoluble ribonuclease T1 (ribonucleate guaninenucleotide-2′-transferase (cyclizing), EC 2.7.7.26) derivatives were prepared. One of these, Sepharose T1, which was prepared by chemically coupling ribonuclease T1 to Sepharose, was further characterized. The enzyme derivative was stable and had no detectable residual soluble enzymatic activity. Substrate specificity of the enzyme derivative remained unaltered. Kinetic values were similar to the free, native enzyme.. AB - Several enzymatically active water-insoluble ribonuclease T1 (ribonucleate ...
1. U.v. difference spectra show that the anionic surfactant sodium n-dodecyl sulphate unfolds ribonuclease A at pH7.3 and 10.3, but that the cationic surfactant n-dodecyltrimethylammonium bromide does not affect the conformation of the enzyme. 2. Equilibrium-dialysis experiments show that sodium n-dodecyl sulphate binds to ribonuclease A, but no binding of n-dodecyltrimethylammonium bromide could be detected at pH7.3. 3. The enzymic activity of ribonuclease A is unaffected by n-dodecyltrimethylammonium bromide up to a concentration of 0.03m at 25°C. 4. Ultracentrifuge studies support the conclusion that n-dodecyltrimethylammonium bromide does not interact significantly with ribonuclease A. 5. The enthalpy change as measured by microcalorimetry on binding of sodium n-dodecyl sulphate to ribonuclease A is consistent with an exothermic enthalpy of binding occurring simultaneously with an endothermic enthalpy of chain unfolding.. ...
Ribonuclease III (RNase III or RNase C)(BRENDA 3.1.26.3) is a type of ribonuclease that recognizes dsRNA and cleaves it at specific targeted locations to transform them into mature RNAs. These enzymes are a group of endoribonucleases that are characterized by their ribonuclease domain, which is labelled the RNase III domain. They are ubiquitous compounds in the cell and play a major role in pathways such as RNA precursor synthesis, RNA Silencing, and the pnp autoregulatory mechanism. Within the RNase III superfamily, there are four known classes: 1, 2, 3, and 4. Each class is defined by its structural difference. Class 1 RNase III Class 1 RNase III have a dimer structure whose function is to cleave dsRNA into multiple subunits. It is a Mg2+ dependent endonuclease and is largely found in bacteria and bacteriophage. Recently, class 1 RNase III was found in Glomeromycotan Fungi, which was suspected to be the result of horizontal gene transfer from cyanobacteria . Among the RNases III in the class ...
The isolation and characterization of the initial intermediates formed during the irreversible acid denaturation of enzyme Ribonuclease A are described. The products obtained when RNase A is maintained in 0.5 M HCl at 30° for periods up to 20 h have been analyzed by ion-exchange chromatography on Amberlite XE-64. Four distinct components were found to elute earlier to RNase A; these have been designated RNase Aa2, Aa1c, Aa1b, and Aa1a in order of their elution. With the exception of RNase Aa2, the other components are nearly as active as RNase A. Polyacrylamide gel electrophoresis at near-neutral pH indicated that RNase Aa1a, Aa1b, and Aa1c are monodeamidated derivatives of RNase A; RNase Aa2 contains, in addition, a small amount of a dideamidated component. RNase Aa2, which has 75% enzymic activity as compared to RNase A, consists of dideamidated and higher deamidated derivatives of RNase A. Except for differences in the proteolytic susceptibilities at an elevated temperature or acidic pH, the ...
Degradation of mRNA is a highly regulated step important for proper gene expression. Degradation of eukaryotic mRNA is initiated by shortening of the 3 end located poly(A) tail. Poly(A)-specific ribonuclease (PARN) is an oligomeric enzyme that degrades the poly(A) tail with high processivity. A unique property of PARN is its ability to interact not only with the poly(A) tail but also with the 5 end located mRNA cap structure. A regulatory role in protein synthesis has been proposed for PARN based on its ability to bind the cap that is required for efficient initiation of eukaryotic mRNA translation. Here we have investigated how the cap structure influences PARN activity and how PARN binds the cap. We show that the cap activates PARN and enhances the processivity of PARN. Further we show that the cap binding complex (CBC) inhibits PARN activity through a protein-protein interaction. To investigate the cap binding property of PARN, we identified the cap binding site at the molecular level using ...
TY - JOUR. T1 - Antitumor activity and toxicity of anti-HER2 immunoRNase scFv 4D5-dibarnase in mice bearing human breast cancer xenografts. AU - Balandin, Taras G.. AU - Edelweiss, Evelina. AU - Andronova, Natalia V.. AU - Treshalina, Elena M.. AU - Sapozhnikov, Alexander M.. AU - Deyev, Sergey M.. PY - 2011/2. Y1 - 2011/2. N2 - Summary: Ribonucleases (RNases) are a non-mutagenic alternative to harmful DNA-damaging anticancer drugs. Targeting of RNases with antibodies to surface antigens that are selectively expressed on tumor cells endows specificity to the cytotoxic actions of RNases. Barnase, a ribonuclease from Bacillus amyloliquefaciens, is a promising candidate for targeted delivery to cancer cells because of its insusceptibility to the ubiquitous cytoplasmic ribonuclease inhibitor, and its high stability and catalytic activity. Here, we characterized in vitro and in vivo an immunoRNase, scFv 4D5-dibarnase, which consists of two barnase molecules that are fused serially to the single-chain ...
Ribonuclease bound to transfer RNA. Computer model showing the molecular structure of a ribonuclease Z (RNase Z, blue) enzyme bound to a transfer RNA (tRNA) molecule (red). RNase is a type of nuclease that catalyses the degradation of RNA (ribonucleic acid) into smaller components in preparation for other genetic processes. tRNA is RNA that transfers a specific active amino acid to a growing polypeptide chain at the site of protein synthesis during gene translation. RNase Z causes conformational changes in both molecules to promote reorganization of the catalytic site and tRNA cleavage. - Stock Image C008/8444
In this study, we evaluated nine laboratory buffers and water samples to assess the level of RNase contamination present in a RNase-free laboratory. We also assessed the ability of Recombinant RNasin Ribonuclease Inhibitor to protect RNA in all of the sampled water and buffers. In the samples that were contaminated to some degree with RNases, Recombinant RNasin Inhibitor was able to protect introduced RNA from degradation.
Fingerprint Dive into the research topics of Mouse eosinophil-associated ribonucleases: A unique subfamily expressed during hematopoiesis. Together they form a unique fingerprint. ...
Other articles where Barnase is discussed: bacillus: … encoding an enzyme known as barnase in B. amyloliquefaciens is of interest in the development of genetically modified (GM) plants. Barnase combined with another protein synthesized by B. amyloliquefaciens known as barstar, forming the barnase-barstar gene system, was used to develop a line of non-self-fertilizing transgenic mustard (Brassica juncea) plants…
The circular-dichroism and proton-magnetic-resonance spectra of complexes of ribonuclease A with dihydrouridine 3′-phosphate, 2′- and 3′-CMP, arabinosyl-3′-CMP, 1-(2-hydroxyethyl)cytosine 2′-phosphate and 1-(3-hydroxypropyl)cytosine 3′-phosphate were studied. Comparison of the results shows that non-additivity of the circular-dichroic spectrum of an enzyme-nucleotide complex may be due to: (a), alteration of the circular dichroic spectrum of the nucleotide under the influence of the asymmetric protein matrix (induced dichroism), and (b) a change in the nucleotide conformation. The contribution of each of the two factors was estimated to calculate the circular-dichoroic spectra of 2′-CMP and 3′-CMP in complex with ribonuclease A. 3′-CMP in this complex was characterized by negative circular dichroism in the long-wavelength absorption band of the nucleotide, whereas 2′-CMP was characterized by positive circular dichroism. Since both nucleotides in the complex are known to be in ...
The circular-dichroism and proton-magnetic-resonance spectra of complexes of ribonuclease A with dihydrouridine 3′-phosphate, 2′- and 3′-CMP, arabinosyl-3′-CMP, 1-(2-hydroxyethyl)cytosine 2′-phosphate and 1-(3-hydroxypropyl)cytosine 3′-phosphate were studied. Comparison of the results shows that non-additivity of the circular-dichroic spectrum of an enzyme-nucleotide complex may be due to: (a), alteration of the circular dichroic spectrum of the nucleotide under the influence of the asymmetric protein matrix (induced dichroism), and (b) a change in the nucleotide conformation. The contribution of each of the two factors was estimated to calculate the circular-dichoroic spectra of 2′-CMP and 3′-CMP in complex with ribonuclease A. 3′-CMP in this complex was characterized by negative circular dichroism in the long-wavelength absorption band of the nucleotide, whereas 2′-CMP was characterized by positive circular dichroism. Since both nucleotides in the complex are known to be in ...
Thank you for your interest in spreading the word about Science.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Nocturnin (NOCT) is a rhythmically expressed protein that regulates metabolism under the control of circadian clock. It has been proposed that NOCT deadenylates and regulates metabolic enzyme mRNAs. However, in contrast to other deadenylases, purified NOCT lacks the deadenylase activity. To identify the substrate of NOCT, we conducted a mass spectrometry screen and report that NOCT specifically and directly converts the dinucleotide NADP+ into NAD+ and NADPH into NADH. Further, we demonstrate that the Drosophila NOCT ortholog, Curled, has the same enzymatic activity. We obtained the 2.7 Å crystal structure of the human NOCT•NADPH complex, which revealed that NOCT recognizes the chemically unique ribose-phosphate backbone of the metabolite, placing the 2′-terminal phosphate productively for removal. We provide evidence for NOCT targeting to mitochondria and propose that NADP(H) regulation, which takes place at least in part in mitochondria, establishes the molecular link between circadian clock and
Compare angiogenin, ribonuclease, RNase A family, 5 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
The 5S rRNA maturase, ribonuclease M5, is a Toprim domain family member: The maturation of 5S ribosomal RNA in low G+C Gram-positive bacteria is catalyzed by a
Specifically, the enzymes are involved in endonucleolytic cleavage of 3-phosphomononucleotides and 3-phosphooligonucleotides ending in C-P or U-P with 2,3-cyclic phos
Reaktivität: Huhn, Rind (Kuh), Hund and more. 57 verschiedene RNASET2 ELISA Kits vergleichen. Alle direkt auf antikoerper-online.de bestellbar!
Other articles where Renaturation is discussed: denaturation: …subject to this process, called renaturation, include serum albumin from blood, hemoglobin (the oxygen-carrying pigment of red blood cells), and the enzyme ribonuclease. The denaturation of many proteins, such as egg white, is irreversible. A common consequence of denaturation is loss of biological activity (e.g., loss of the catalytic ability…
Enzymes are nanomachines that are exceptionally efficient at catalyzing a chemical reaction. They play a role in all cellular mechanisms. Like all proteins, they are made up of amino acid chains that are folded and assembled in a very precise 3D structure. Some enzymes, like ribonuclease A, are so efficient that they catalyze the transformation of chemical molecules thousands of times per second.. In this study, Donald Gagné, a researcher in Professor Doucets lab holding a PhD in biology from INRS, analyzed the impact of removing a methyl group located near a loop distant from the reaction site of ribonuclease A-a very slight change that presumably would have no effect. The mutation does not perturb the 3D structure of the enzyme. However, it did result in a four-fold reduction in the affinity of ribonuclease A for nucleotides (molecules to which it must bind to carry out its function). How is this possible?. Using crystallography techniques and nuclear magnetic resonance to examine the enzyme ...
N-2-Benzoyl-5-O-dimethoxytrityl-2-O-tetrahydropyranylguanosine (5) and 1-acetyl-5-bromo-4-chloroindol-3-yl-3-phosphorodichloridate (7) were synthesized and coupled to give the title compound 9.. Keywords: Identification of ribonuclease activity. ...
sample_1: Ribonuclease III, [U-100% 13C; U-100% 15N], 1 mM; H2O 90%; D2O, [U-100% 2H], 10%; sodium phosphate 20 mM; sodium chloride 150 mM. sample_2: Ribonuclease III, [U-100% 13C; U-100% 15N], 1 mM; D2O, [U-100% 2H], 100%; sodium chloride 10 mM; sodium phosphate 150 mM. sample_conditions_1: ionic strength: 150 mM; pH: 6.5; pressure: 1 atm; temperature: 298 K ...
Differential scanning calorimetry, urea denaturation, and X-ray crystallography were combined to study the structural and energetic consequences of refilling an engineered cavity in the hydrophobic core of RNase T1 with CH(3), SH, and OH groups. Three valines that cluster together in the major hydrophobic core of T1 were each replaced with Ala, Ser, Thr, and Cys. Compared to the wild-type protein, all these mutants reduce the thermodynamic stability of the enzyme considerably. The relative order of stability at all three positions is as follows: Val , Ala approximately equal to Thr , Ser. The effect of introducing a sulfhydryl group is more variable. Surprisingly, a Val --, Cys mutation in a hydrophobic environment can be as or even more destabilizing than a Val --, Ser mutation. Furthermore, our results reveal that the penalty for introducing an OH group into a hydrophobic cavity is roughly the same as the gain obtained from filling the cavity with a CH(3) group. The inverse equivalence of the ...
Ribonuclease, Ribonuclease Iii, mRNA, Ribose, RNA, RNA Cleavage, Gene, Gene Expression, Report, Distance, Family, Hydroxyl, Micrornas, miRNA, Mirnas, Pre-mirna, Rnase, Rnase Iii, Seed, Concentrations
The accessibility of methionines in RNAase A to reaction with OBQ has been studied at highly acidic pH. The differences between the rate constants of reactions of the methionine and methionines of RNAase A with OBQ is a reflection on the limited accessibility of methionines in the protein conformation. Nevertheless, at sufficiently high OBQ concentration, all the four methionines of the enzyme can be modified. At lower concentration of OBQ, a derivative may be prepared in which a specific methionine is modified. The introduced chromophore ionizes at around pH 3 in this derivative. The derivative has partial activity towards RNA which is enhanced on addition of S-protein. ...
To gain preferential access to the protein synthesis machinery and to disrupt induction of antiviral responses by infected cell many viruses block host gene expression. This blockade is called host shutoff and it is mediated by viral factors that either destroy host messenger RNAs (mRNAs) or interfere with their synthesis. Influenza A virus (IAV) encodes…
The Presto™ Midi Plasmid Kit was designed for Plasmid DNA Purification from 50-150 ml of cultured bacterial cells using an efficient plasmid midiprep system. For processing smaller volumes, the Presto™ Mini Plasmid Kit is also available. Both plasmid kits include TrueBlue Lysis Buffer (an optional color indicator) to prevent common handling errors, while ensuring efficient cell lysis and neutralization. The Presto™ Midi Plasmid Kit uses a modified alkaline lysis method and RNase treatment to obtain clear cell lysate with minimal genomic DNA/RNA contaminants. Using an efficient gravity-flow procedure, plasmid DNA in the crude lysate is bound by the plasmid midi column and the contaminants are removed with PW Buffer. The purified plasmid DNA is eluted by a high salt buffer and then precipitated with Isopropanol for desalting. The entire procedure can be completed in 80 minutes without ultracentrifuges, HPLC or other toxic reagents.. ...
The ribonuclease (RNase) molecule which takes part in the formation of enzyme-substrate complexes, was investigated to determine factors which affect the binding of various competitive inhibitors of RNase activity. The binding of inhibitory nucleotides, such as 2-cytidylic acid, by RNase was measured not only by enzyme inhibition, but also by spectral changes and dialysis equilibrium. As measured spectrophotometrically, complex formation between nucleotideAND RNase is manifested by changes in the spectral contributions from both pyrimidine and tyrosyl groups. The affinities of RNase for 2-cytidylic acid as measured by all 3 methods were in excellent agreement. As measured by dialysis equilibrium and spectral changes, only one molecule of nucleotide is bound per molecule of enzyme. Since 2-cytidylic acid is a competitive inhibitor of both catalytic actions (transferase and hydralase) of the enzyme, it may be inferred that the same catalytic site is responsible for both reactions. (Author)
Ribonuclease HII and HIII are endonucleases that specifically degrade the RNA of RNA-DNA hybrids. Proteins which belong to this family have been found in bacteria, archaea, and eukaryota.. The domain represented by this entry is found in ribonucleases HII.. ...
RNase A is an important enzyme for the removal of RNA for RNA free DNA purification reactions such as plasmid DNA purification and genomic DNA purification, RNA removal from recombinant protein preparations, Ribonuclease protection assays, mapping single-base mutations in DNA/RNA. RNase A effectively cleaves the phosphodiester bond between the 5-ribose of a ...
Ribonuclease H1, Ribonuclease H1, 5-R(*GP*GP*AP*GP*UP*GP*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3), 5-D(*DGP*DGP*DAP*DAP*DTP*DCP*DAP*DGP*DGP*DTP*DGP*DTP*DCP*DGP*DCP*DAP*DCP*DTP*DCP*DT)-3 ...
1mgwA:56-137 1mgrA:56-137 1uckB:11-92 1i70A:11-92 2sarA:11-92 1ucjB:11-92 1lniB:11-92 1ay7A:11-92 1t2hB:11-92 1boxA:11-92 1uclA:11-92 1rgeB:11-92 1t2iA:11-92 1c54A:11-92 1rsnB:11-92 1gmqA:11-92 1uciA:11-92 1sarB:11-92 1gmpA:11-92 1rgfA:11-92 1rggB:11-92 1rghB:11-92 1i8vB:11-92 1gmrB:11-92 1ynvX:11-92 1py3B:79-159 1pylA:79-159 2rbiB:72-161 1goyA:72-161 1gouB:72-161 1govA:72-161 1bujA:72-161 1baoB:67-156 1bsdA:67-156 1banB:67-156 1brhA:67-156 1brgC:67-156 1brkC:67-156 1bnsA:67-156 1bnfB:67-156 1bgsB:67-156 1bnjB:67-156 1bsaB:67-156 1bsbC:67-156 1b3sB:67-156 1x1wB:67-156 1bniB:67-156 1b2xB:67-156 1b2zA:67-156 1bscC:67-156 1bseB:67-156 1x1yB:67-156 1briC:67-156 1b2uC:67-156 1b27C:67-156 1b20B:67-156 1bnr :67-156 1b2sC:67-156 1yvs :67-156 1brsC:67-156 1brjC:67-156 1bneA:67-156 1bngC:67-156 1a2pA:67-156 1x1uB:67-156 1fw7A:67-156 1rnbA:67-156 1b21C:67-156 1x1xB:67-156 1brnM:67-156 1b2mA:46-129 1i0vA:46-129 1rls :46-129 1fysA:46-129 1bviB:46-129 1i2eA:46-129 2hohD:46-129 3rnt :46-129 6gsp :46-129 4gsp ...
Ribonucleases[edit]. The trans-form (two separate strands) of the 17E DNAzyme. Most ribonuclease DNAzymes have a similar form, ... The first known deoxyribozyme was a ribonuclease, discovered in 1994 by Ronald Breaker while a postdoctoral fellow in the ... 13] Other notable deoxyribozyme ribonucleases are those that are highly selective for a certain cofactor. Among this group are ... The most abundant class of deoxyribozymes are ribonucleases, which catalyze the cleavage of a ribonucleotide phosphodiester ...
Microbial ribonucleases. Berlin: Springer. ISBN 3-642-87498-3. ed.-in-chief, George M. Garrity (2012). Bergey's manual of ...
The female component ribonuclease, termed S-RNase[3] probably causes degradation of the ribosomal RNA (rRNA) inside the pollen ... The RNase mechanism[edit]. The female component of GSI in the Solanaceae was found in 1989.[3] Proteins in the same family were ... Steinbachs, J. E. & K. E. Holsinger (2002). "S-RNase-mediated gametophytic self-incompatibility is ancestral in eudicots". Mol ... "Style selfincompatibility gene products of Nicotiana alata are ribonucleases". Nature. 342 (6252): 955-7. doi:10.1038/342955a0 ...
D'Alessio, Giuseppe; Riordan, James F. (1997). Ribonucleases structures and functions. San Diego: Academic Press. p. 214. ISBN ... "Total synthesis and cloning of a gene coding for the ribonuclease S protein" (PDF). Science. 223 (4642): 1299-1301. Bibcode: ... "Reconstructing the evolutionary history of the artiodactyl ribonuclease superfamily" (PDF). Nature. 374 (6517): 57-9. Bibcode: ...
Such a ribonuclease is in a human clinical trial as an anti-cancer agent. Mechanistic Insight on cellular redox homeostasis and ... Leland, P. A.; Raines, R. T. (2001). "Cancer chemotherapy - Ribonucleases to the rescue". Chem. Biol. 8 (5): 405-413. doi: ... where he cloned and expressed the gene encoding bovine pancreatic ribonuclease. Raines was a member of the faculty at the ...
... and structure-function studies on ribonuclease (RNase). Hofmann was born in Germany but when his father died, his mother ... Enzymic Properties of Partially Synthetic De(16-20)- and De(15-20)-ribonucleases S', J. Am. Chem. Soc. 88 3633-39 1966 Finn, F ... Enzymic Properties of Partially Synthetic Ribonucleases. J. Am. Chem. Soc. 87 645-51 1965. Hofmann, K. and Bohn, H. Studies on ... In 1959, Fred Richards discovered that a proteolytic enzyme, Subtilisin, had the ability to cleave the enzyme Ribonuclease A ...
... coli Ribonuclease H1. Some other examples are ancestral visual pigments in vertebrates, enzymes in yeast that break down sugars ... 800Ma); enzymes in bacteria that provide resistance to antibiotics (2 - 3Ga); the ribonucleases involved in ruminant digestion ... "Reconstructing the evolutionaryhistory of the artiodactyl ribonuclease superfamily". Nature. 374 (6517): 57-9. Bibcode: ...
"Avoiding Ribonuclease Contamination , NEB". www.neb.com. Retrieved 2016-04-10. "The Basics: RNase Control". www.thermofisher. ...
Behe versus ribonuclease; the origin and evolution of protein-protein binding sites, Ian Musgrave, The Panda's Thumb April 13, ...
Ribonuclease H1 also known as RNase H1 is an enzyme that in humans is encoded by the RNASEH1 gene. The RNase H1 is a non- ... and mapping of ribonucleases H of human and mouse related to bacterial RNase HI". Genomics. 53 (3): 300-7. doi:10.1006/geno. ... 2003). "Human RNase H1 uses one tryptophan and two lysines to position the enzyme at the 3'-DNA/5'-RNA terminus of the ... "Entrez Gene: ribonuclease H1". ten Asbroek AL, van Groenigen M, Jakobs ME, Koevoets C, Janssen B, Baas F (June 2002). " ...
Done in 1966 and published in 1967, the analyses of RNase S and RNase A jointly made ribonuclease the third distinct protein ... Using a particular protease (Subtilisin), RNase A was converted into a split protein (RNase S), which is composed of two parts ... Richards found that, when separated, S-protein and S-peptide had no RNase activity, but that the RNase enzymatic activity was ... On December 2, 1957, at Yale University, Richards performed a simple experiment on the protein Ribonuclease A (RNase A) that ...
Wool, I. G.; Huber, P. W.; Endo, Y. (1983-02-25). "The ribonuclease activity of the cytotoxin alpha-sarcin. The characteristics ... Fungal ribotoxins are a group of extracellular ribonucleases (RNases) secreted by fungi. Their most notable characteristic is ... Yoshida, H. (2001). "The ribonuclease T1 family". Methods in Enzymology. 341: 28-41. doi:10.1016/S0076-6879(01)41143-8. ISBN ... "Deletion of the NH2-terminal β-Hairpin of the Ribotoxin α-Sarcin Produces a Nontoxic but Active Ribonuclease". Journal of ...
His lab solved the structure of the pancreatic enzyme ribonuclease A, the third protein structure ever solved by protein ... Kartha G, Bello J, Harker D (1967). "Tertiary Structure of Ribonuclease". Nature. 213: 862-865. Bibcode:1967Natur.213..862K. ...
DNase and RNase. Biotechnology and Genetic Engineering. Archived from the original on 5 August 2004. Retrieved 8 January 2017. ...
Ribonuclease H2 subunit A, also known as RNase H2 subunit A, is an enzyme that in humans is encoded by the RNASEH2A gene. The ... "Entrez Gene: ribonuclease H2". Crow YJ, Leitch A, Hayward BE, et al. (2006). "Mutations in genes encoding ribonuclease H2 ... 1998). "Cloning of the cDNA encoding the large subunit of human RNase HI, a homologue of the prokaryotic RNase HII". Proc. Natl ... RNaseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It ...
1967 - Ribonuclease A (PDB file 2RSA) is an RNA-cleaving enzyme stabilized by 4 disulfide bonds. It was used in Anfinsen's ... Ribonuclease S, the cleaved, two-component form studied by Fred Richards, was also enzymatically active, had a nearly identical ... Wyckoff HW, Hardman KD, Allewell NM, Inagami T, Johnson LN, Richards FM (1967). "The structure of ribonuclease-S at 3.5 Å ... Doscher MS, Richards FM (1963). "The activity of an enzyme in the crystalline state: Ribonuclease-S". Journal of Biological ...
Most such primers are excised from newly synthesized lagging strand DNA by endonucleases of the family RNase H. In eukaryotes ... They are further subcategorized as deoxyribonucleases and ribonucleases. The former acts on DNA, the latter on RNA. In the late ...
For example, RNase 7, a member of the RNase A superfamily, is secreted by human skin and serves as a potent antipathogen ... Rosenberg, H. F. (2008). "RNase a ribonucleases and host defense: An evolving story". Journal of Leukocyte Biology. 83 (5): ... Harder, J. (2002). "RNase 7, a Novel Innate Immune Defense Antimicrobial Protein of Healthy Human Skin". Journal of Biological ... Köten, B.; Simanski, M.; Gläser, R.; Podschun, R.; Schröder, J. M.; Harder, J. R. (2009). "RNase 7 Contributes to the Cutaneous ...
"Entrez Gene: RNASE1 ribonuclease, RNase A family, 1 (pancreatic)". Nogués MV, Vilanova M, Cuchillo CM (Nov 1995). "Bovine ... This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A super-family. The ... Gaur D, Swaminathan S, Batra JK (Jul 2001). "Interaction of human pancreatic ribonuclease with human ribonuclease inhibitor. ... "Three-dimensional structure of a human pancreatic ribonuclease variant, a step forward in the design of cytotoxic ribonucleases ...
First, the modRNA must be protected from ribonucleases. This can be accomplished, for example, by wrapping it in liposomes. ... There are nearly-ubiquitous enzymes called ribonucleases (also called RNAses) that break down unprotected mRNA. There are also ...
One well-known example is ribonuclease A, which can be purified by treating crude extracts with hot sulfuric acid so that other ... p. 6. ISBN 978-0-7167-2317-2. "Ribonuclease A". Protein Data Bank. Bryan John Smith (2002). "Chapter 71-75". In John M. Walker ... proteins become degraded while ribonuclease A is left intact. Certain chemicals cause proteolysis only after specific residues ...
Among the tightest known protein-protein complexes is that between the enzyme angiogenin and ribonuclease inhibitor; the ... Dickson KA, Haigis MC, Raines RT (2005). "Ribonuclease inhibitor: structure and function". Progress in Nucleic Acid Research ... "Molecular recognition of human angiogenin by placental ribonuclease inhibitor--an X-ray crystallographic study at 2.0 A ...
This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy ... "Entrez Gene: RNASET2 ribonuclease T2". Patel S, Chen H, Monti L, Gould E, Haralambieva E, Schmid J, Toomey D, Woessmann W, ... Ribonuclease T2 is an enzyme that in humans is encoded by the RNASET2 gene. It is a type of endoribonuclease. ... Trubia M, Sessa L, Taramelli R (Sep 1997). "Mammalian Rh/T2/S-glycoprotein ribonuclease family genes: cloning of a human member ...
Cleavage enzymes include Angiogenin, Dicer, RNase Z and RNase P. Especially in the case of Angiogenin, the tRFs have a ... The 5′ sequence is removed by RNase P, whereas the 3′ end is removed by the tRNase Z enzyme. A notable exception is in the ... Randau L, Schröder I, Söll D (May 2008). "Life without RNase P". Nature. 453 (7191): 120-123. Bibcode:2008Natur.453..120R. doi: ... Frank DN, Pace NR (1998). "Ribonuclease P: unity and diversity in a tRNA processing ribozyme". Annual Review of Biochemistry. ...
Chase, J.W.; Richardson, C.C. (1974). "Ribonuclease VII of Escherichia coli". J. Biol. Chem. 249 (14): 4545-4552. PMID 4602029 ...
purified 1 kg of pure bovine pancreatic ribonuclease A and made it freely available to scientists; this gesture helped ... Protein binding can be extraordinarily tight and specific; for example, the ribonuclease inhibitor protein binds to human ... Kalman SM, Linderstrøm-Lang K, Ottesen M, Richards FM (February 1955). "Degradation of ribonuclease by subtilisin". Biochimica ... ribonuclease A become a major target for biochemical study for the following decades. Linus Pauling is credited with the ...
Ribonuclease. 7.9 × 10−3. 7.9 × 102. 1.0 × 105 Carbonic anhydrase. 2.6 × 10−2. 4.0 × 105. 1.5 × 107 ...
Using ribonucleases, digest the RNA not protected by ribosomes. Isolate the mRNA-ribosome complexes using sucrose gradient ...
For example, bacillus subtilis instead of using RNase E as the endo-ribonuclease, it uses RNase Y or RNase J or in the archaea ... the hydrolytic endo-ribonuclease RNase E, the phosphorolytic exo-ribonuclease PNPase, the ATP-dependent RNA helicase (RhIB) and ... It is mediated mainly by endo- and ribo- nucleases. The enzymes RNase II and PNPase (polynucleotide phosphorylase) degrade mRNA ... a large hydrolytic endo-ribonuclease that can be divided into the N-terminal half of RNase E, that contains the catalytic ...
Lee FS, Shapiro R, Vallee BL (Jan 1989). "Tight-binding inhibition of angiogenin and ribonuclease A by placental ribonuclease ... Kobe B, Deisenhofer J (Dec 1996). "Mechanism of ribonuclease inhibition by ribonuclease inhibitor protein based on the crystal ... Guanidinium thiocyanate - a chemical RNase inhibitor.. References[edit]. *^ a b PDB: 2BNH​; Kobe B, Deisenhofer J (1993). " ... RIs affinity for ribonucleases is important, since many ribonucleases have cytotoxic and cytostatic effects that correlate ...
EC 3.1.27.5: RNase A is an RNase that is commonly used in research. RNase A (e.g., bovine pancreatic ribonuclease A: PDB: 2AAS​ ... EC 3.1.27.8: RNase V is specific for polyadenine and polyuridine RNA. EC 3.1.26.12: RNase E is a ribonuclease of plant origin, ... EC number 3.1.??: RNase R is a close homolog of RNase II, but it can, unlike RNase II, degrade RNA with secondary structures ... RNase H leaves a 5-phosphorylated product. EC 3.1.26.3: RNase III is a type of ribonuclease that cleaves rRNA (16s rRNA and ...
Ribonuclease T (RNase T, exonuclease T, exo T) is a ribonuclease enzyme involved in the maturation of transfer RNA and ... Structurally, RNAse T exists as an anti-parallel dimer and requires a divalent cation to function. RNAse T is able to achieve ... Specifically, RNAse T cleaves the 3 AMP residue from the 3 CCA sequences at the end of tRNA, which explains RNAse Ts ... Despite the apparent usefulness of RNAse T, the enzyme is only found in gammaproteobacteria. In E. coli, RNAse T is encoded by ...
Drappier M., Michiels T. (2018) Ribonuclease L (RNase L). In: Choi S. (eds) Encyclopedia of Signaling Molecules. Springer, Cham ... The roles of RNase-L in antimicrobial immunity and the cytoskeleton-associated innate response. Int J Mol Sci. 2016;17. https ... Expression cloning of 2-5A-dependent RNAse: a uniquely regulated mediator of interferon action. Cell. 1993;72:753-65.PubMed ... Han Y, Donovan J, Rath S, Whitney G, Chitrakar A, Korennykh A. Structure of human RNase L reveals the basis for regulated RNA ...
RNAse T2-deficient leukoencephalopathy is a disorder that affects the brain. Explore symptoms, inheritance, genetics of this ... Ribonucleases help break down RNA, a chemical cousin of DNA. Studies suggest that ribonuclease T2 may also be involved in other ... RNAse T2-deficient leukoencephalopathy is a disorder that affects the brain. People with RNAse T2-deficient leukoencephalopathy ... This gene provides instructions for making a protein called ribonuclease T2 (RNAse T2), which is normally abundant in the brain ...
... determined in this way was bovine pancreatic ribonuclease, which has 124 amino acids in its chain and a molecular weight of ... Other articles where Bovine pancreatic ribonuclease is discussed: catalysis: Biological catalysts: the enzymes: … ... Bovine pancreatic ribonuclease. enzyme. THIS IS A DIRECTORY PAGE. Britannica does not currently have an article on this topic. ... determined in this way was bovine pancreatic ribonuclease, which has 124 amino acids in its chain and a molecular weight of ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Ribonuclease III domain (IPR000999). Short name: RNase_III_dom Overlapping homologous superfamilies *Ribonuclease III, ... This domain is found in eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded ... Prokaryotic RNAse III also plays a role in the maturation of tRNA precursors and in the processing of phage and plasmid ... RNase III enzymes and the initiation of gene silencing.. Nat. Struct. Mol. Biol. 11 214-8 2004 ...
... Dr. Hiranya S. Roychowdhury hroychow at nmsu.edu Mon Jul 29 09:46:10 EST 2002 *Previous message: RNase-free ... RNase-free. , , , , Presumably you are autoclaving it which if so does not leave anything , , other than ethanol behind. If you ...
RNase B has a single N-linked glycosylation site which makes it ideal for SDS-PAGE gel shift assays. ... RNase B is a high mannose glycoprotein that can be used as a positive control for endoglycosidases that cleave N-linked ... RNase B RNase B is a high mannose glycoprotein that can be used as a positive control for endoglycosidases that cleave N-linked ... RNase B is a high mannose glycoprotein (1-3) that can be used as a positive control for endoglycosidases that cleave N-linked ...
Pancreatic ribonucleases (EC 3.1.27.5, RNase, RNase I, RNase A, pancreatic RNase, ribonuclease I, endoribonuclease I, ... Pancreatic ribonucleases (EC 3.1.27.5, RNase, RNase I, RNase A, pancreatic RNase, ribonuclease I, endoribonuclease I, ... ribonucleic phosphatase, alkaline ribonuclease, ribonuclease, gene S glycoproteins, Ceratitis capitata alkaline ribonuclease, ... ribonucleic phosphatase, alkaline ribonuclease, ribonuclease, gene S glycoproteins, Ceratitis capitata alkaline ribonuclease, ...
Ribonuclease inhibitors with broad-spectrum RNase inhibitory properties. Recombinant and native available. Plus version ... RNasin® Ribonuclease Inhibitor *Inhibits RNase A, B and C as well as human placental RNase. ... RNasin® Plus RNase Inhibitor for High-Temperature RNase Inhibition. *RNasin® Ribonuclease Inhibitors: Superior Performance for ... RNasin®: The Most Trusted Name in RNase Inhibition Promega RNasin® Ribonuclease Inhibitors are the gold standard for RNase ...
RNase synonyms, RNase pronunciation, RNase translation, English dictionary definition of RNase. also RNA·ase n. See ... ribonuclease. n. any of a class of enzymes that catalyze the hydrolysis of RNA. Also called RNase, RNAase. ri`bo•nu•cle′ic, adj ... Related to RNase: RNase P, RNase H RN·ase. (är′ĕn-ās′, -āz′) also RNA·ase (är′ĕn-ā′ās′, -āz′). n.. See ribonuclease. ... RNase - a transferase that catalyzes the hydrolysis of ribonucleic acid. ribonuclease, ribonucleinase ...
IPR000026, Gua-sp_ribonuclease_N1/T1/U2. IPR016191, Ribonuclease/ribotoxin. Pfami. View protein in Pfam. PF00545, ... Belongs to the ribonuclease N1/T1 family.Curated. Keywords - Domaini. Signal. Phylogenomic databases. evolutionary genealogy of ... Ribonuclease (EC:3.1.27.-*Search proteins in UniProtKB for this EC number. ... "Amino-acid sequence of extracellular ribonuclease (barnase) of Bacillus amyloliquefaciens.". Hartley R.W., Barker E.A.. Nature ...
RNase Inhibitor, Murine is a 50 kDa recombinant protein of murine origin. The inhibitor specifically inhibits RNases A, B and C ... It is not effective against RNase 1, RNase T1, S1 Nuclease, RNase H or RNase from Aspergillus. In addition, no inhibition of ... RNase Inhibitor, Murine GMP-grade reagent also available. Learn more. RNase Inhibitor, Murine, specifically inhibits RNases A, ... Protocol for Avoiding Rnase Contamination using Murine Rnase Inhibitor (M0314) * Poly(A) Tailing of RNA using E. coli Poly(A) ...
... Vesselina Ivanova vivanova at iastate.edu Tue May 13 21:46:40 EST 1997 *Previous message: Host ... Hello, everybody! Does anyone have any experience with RNase Protection Assay? I have been doing it for a few months now, using ...
The protein concentration of RNase, DNase-free is 0.5 μg/μL. ... 0.1 mU RNase, DNase-free degrades 1 μg RNA in 30 min at + 37 °C ... Conditions for RNase digestion. 0.1 mU RNase, DNase-free degrades 1 μg RNA in 30 min at + 37 °C in a reaction volume of 50 μL ... add 1.5 μL RNase and incubate 30 min at + 37 °C. For nucleic acids from 108 cells, add 16 μL RNase and incubate 30 min at + 37 ... To remove RNA from your samples, add RNase, DNase-free and incubate at either +15 to +25 °C or +37 °C.. For example, add 0.5 μL ...
EC 3.1.27.5: RNase A is an RNase that is commonly used in research. RNase A (e.g., bovine pancreatic ribonuclease A: PDB: 2AAS ... RNase H leaves a 5-phosphorylated product.[7]. *EC 3.1.26.3: RNase III is a type of ribonuclease that cleaves rRNA (16s rRNA ... EC 3.1.26.4: RNase H is a ribonuclease that cleaves the RNA in a DNA/RNA duplex to produce ssDNA. RNase H is a non-specific ... EC number 3.1.??: RNase R is a close homolog of RNase II, but it can, unlike RNase II, degrade RNA with secondary structures ...
RNase P) is essential in all free-living organisms. The RNA subunit, itself, is an enzyme and, from its evolutionary tree, we ... The gene coding for the RNA subunit of ribonuclease P ( ... The gene coding for the RNA subunit of ribonuclease P (RNase P ... Ribonuclease P Philos Trans R Soc Lond B Biol Sci. 2011 Oct 27;366(1580):2936-41. doi: 10.1098/rstb.2011.0142. ...
Make research projects and school reports about RNase easy with credible articles from our FREE, online encyclopedia and ... RNase (ribonuclease; RNAase Any enzyme that catalyses the cleavage of nucleotides in RNA. Each RNase has a specificity for a ... RNase A Dictionary of Biology © A Dictionary of Biology 2004, originally published by Oxford University Press 2004. ... RNase The Oxford Dictionary of Abbreviations © The Oxford Dictionary of Abbreviations 1998, originally published by Oxford ...
RIBONUCLEASE A. A. 124. Bos taurus. Mutation(s): 0 Gene Names: RNASE1, RNS1. EC: 3.1.27.5 (PDB Primary Data), 4.6.1.18 (UniProt ... We report the crystal structures of the copper and nickel complexes of RNase A. The overall topology of these two complexes is ... We report the crystal structures of the copper and nickel complexes of RNase A. The overall topology of these two complexes is ... Consequently, the copper- and nickel-ion-bound dimers of RNase A act as nucleation sites for generating different crystal ...
RNase A family, or Pancreatic RNases family; includes vertebrate RNase homologs to the bovine pancreatic ribonuclease A (RNase ... ECP/RNase 3), RNase 4, Angiogenin (RNase 5), RNase 6 or k6, the skin derived RNase (RNase 7) and RNase 8. These eight human ... RNase A family, or Pancreatic RNases family; includes vertebrate RNase homologs to the bovine pancreatic ribonuclease A (RNase ... 8 RNase A homologs had initially been identified in the human genome, pancreatic RNase (RNase 1), Eosinophil Derived Neurotoxin ...
Ribonuclease from Promega,RNase ONE Ribonuclease is a 27kDa periplasmic enzyme from E. coli that catalyzes the degradation of ... Slower hydrolysis further catalyzes the degradation of these intermediates to 3-NMPs (1). RNase ONE Ribonuclease is one of the ... RNase H from Roche Applied Science. 5. RNase-Free Dnase from BD Biosciences Pharmingen. 6. RQ1 RNase-Free DNase from Promega. 7 ... DNase I (RNase-free) (2 U/l) from Ambion. 2. QIAGEN RNase Inhibitor (7500 U) from QIAGEN. 3. ShortCut RNase III from New ...
"RNase Inhibitor" molecule. This new candidate therapy works by "caging" RNase enzymes that otherwise destroy RNA molecules (see ... Ribonucleases - a new target in SCI?. Funded in: 2014, 2015, 2016. Back to overview Problem: The ability of axons to produce ... Target: Applying RNase inhibitors might dampen the destructive response of RNases. Goal: A new candidate target for improving ... Expected Results: The team now wishes to determine whether "RNase Inhibitor" promotes CNS axon regeneration and functional ...
A table detailing the properties of Ribonucleases (RNases), Nucleases that catalyze the degradation of RNA, used to remove RNA ... Ribonuclease. Applications. Reaction catalyzed. Substrate. Reaction products. RNase A, DNase and protease-free. *Removal of RNA ... Combines the activities of RNase A and RNase T1. ssRNA. *3-CMP ... RNase A/T1 Mix. *Removal of RNA from DNA solutions *Removal of ... Ribonuclease protection assays. Cleavage of phosphodiester bonds between 3-C or 3-U residues and the 5-OH residue of an ...
... were created for the RNase HII, III, II and PH and D families as well as a double-stranded RNA binding domain present in RNase ... Escherichia coli ribonucleases (RNases) HII, III, II, PH and D have been used to characterise new and known viral, bacterial, ... Results suggest that the RNase D family, which includes Werner syndrome protein and the 100 kDa antigenic component of the ... Polynucleotide phosphorylases and the RNase PH family, which includes the 75 kDa PMSCL autoantigen, possess a common domain ...
"Bacillus subtilis mutants with knockouts of the genes encoding ribonucleases RNase Y and RNase J1 are viable, with major ... M. B. Stead, S. Marshburn, B. K. Mohanty et al., "Analysis of Escherichia coli RNase e and RNase III activity in vivo using ... S. Durand, L. Gilet, P. Bessières, P. Nicolas, and C. Condon, "Three essential ribonucleases-RNase Y, J1, and III-control the ... end of Bacillus subtilis 16S rRNA by the essential ribonuclease YkqC/RNase J1," Molecular Microbiology, vol. 63, no. 1, pp. 127 ...
On the oxidation of a linear partially protected octapeptide corresponding to the sequence of amino acids of the ribonuclease ... On the oxidation of a linear partially protected octapeptide corresponding to the sequence of amino acids of the ribonuclease ...
S proteins, pistil-specific ribonucleases that cosegregate with S alleles, have previously been shown to control rejection of ... Here, the ribonuclease activity of S3 protein of P. inflata was abolished, and the effect on the pistils ability to reject S3 ... The ribonuclease activity of S proteins was thought to degrade RNA of self-pollen tubes, resulting in the arrest of their ... Ribonuclease Activity of Petunia inflata S Proteins Is Essential for Rejection of Self-Pollen. *Huang S ...
5 While this Ribonuclease Inhibitor inhibits RNase A, RNase B, and RNase C, it does not inhibit RNase H, RNase 1, RNase T1, S1 ... should be avoided as they may cause release of active ribonuclease from the complex. The Ribonuclease Inhibitor may be removed ... Blackburn, P., and Moore, S., Pancreatic Ribonucleases, in The Enzymes, Vol XV, Part B Academic Press, (New York, NY: 1982). ... Ribonuclease Inhibitor, recombinant is derived from E. coli cells expressing a recombinant clone containing portions of the ...
  • Top view of porcine ribonuclease inhibitor, showing its horseshoe shape. (wikipedia.org)
  • Ribonuclease inhibitor (RI) is a large (~450 residues, ~49 kDa), acidic (pI ~4.7), leucine-rich repeat protein that forms extremely tight complexes with certain ribonucleases . (wikipedia.org)
  • Ribonuclease I (yellow) and inhibitor (pink helixes) complex heterotetramer, Human. (wikipedia.org)
  • Guanidinium thiocyanate - a chemical RNase inhibitor. (wikipedia.org)
  • Mechanism of ribonuclease inhibition by ribonuclease inhibitor protein based on the crystal structure of its complex with ribonuclease A". Journal of Molecular Biology . (wikipedia.org)
  • RNase Inhibitor, Murine is a 50 kDa recombinant protein of murine origin. (neb.com)
  • In addition, no inhibition of polymerase activity is observed when RNase Inhibitor is used with Taq DNA Polymerase, AMV or M-MuLV Reverse Transcriptases, or Phage RNA Polymerases (SP6, T7, or T3). (neb.com)
  • Recombinant murine RNase inhibitor does not contain the pair of cysteines identified in the human version that is very sensitive to oxidation, which causes inactivation of the inhibitor (1). (neb.com)
  • As a result, RNase Inhibitor, Murine has significantly improved resistance to oxidation compared to the human/porcine RNase inhibitors, and is stable at low DTT concentrations (less than 1 mM). (neb.com)
  • An E. coli strain that carries the Ribonuclease Inhibitor gene from mouse. (neb.com)
  • Since ribonucleases typically retain activity under denaturing conditions, care must be taken to avoid denaturing RNase Inhibitor molecules which have complexed with a ribonuclease. (neb.com)
  • The recommended concentration of RNase Inhibitor in a reaction is 1 unit/μl. (neb.com)
  • During assembly of a reaction, RNase Inhibitor should be added before other components that are a possible source of RNase contamination (i.e. enzymes, plasmid from a mini prep. (neb.com)
  • Problem to be investigated: After spinal cord injury, axons might not re-grow long distances because many pro-regenerative RNAs are destroyed by enzymes called "RNases" (see panel A). Methods: The team has discovered that injured neurons can be induced to regrow longer axons more rapidly when they genetically engineer injured neurons to contain increased levels of an "RNase Inhibitor" molecule. (wingsforlife.com)
  • Expected Results: The team now wishes to determine whether "RNase Inhibitor" promotes CNS axon regeneration and functional recovery in rats after spinal cord injury. (wingsforlife.com)
  • Ribonuclease Inhibitor, recombinant is derived from E. coli cells expressing a recombinant clone containing portions of the human placental ribonuclease inhibitor. (sigmaaldrich.com)
  • The Ribonuclease Inhibitor may be removed by phenol extraction or inactivated by heating at 65 °C for 10 minutes. (sigmaaldrich.com)
  • Ribonuclease inhibitor 1 (RNH1) is a ubiquitously expressed protein that binds to and inhibits pancreatic-type ribonucleases. (jci.org)
  • The Ki value for the binding of RNasin Ribonuclease Inhibitor to RNase (e.g. (bio-medicine.org)
  • Promega offers two different preparations: Natural RNasin Ribonuclease Inhibitor(a) and Recombinant RNasin Ribonuclease Inhibitor(a,b). (bio-medicine.org)
  • One mechanism in particular is ribonuclease inhibitor (RI), which binds to ribonucleases with the highest affinity of any protein-protein interaction: the dissociation constant for the RI:RNase complex is ~20 fM under physiological conditions. (kenyon.edu)
  • In this tutorial, we report the structure and chemical interactions within the human pancreatic ribonuclease (RNase 1) and human ribonuclease inhibitor (hRI) complex. (kenyon.edu)
  • Human ribonuclease inhibitor (hRI) is a 50 kDa cytosolic leucine-rich repeat protein comprised of 461 amino acids. (kenyon.edu)
  • We offer Ribonuclease Inhibitor RNAi for use in common research applications. (novusbio.com)
  • Each Ribonuclease Inhibitor RNAi is fully covered by our Guarantee+, to give you complete peace of mind and the support when you need it. (novusbio.com)
  • Our Ribonuclease Inhibitor RNAi can be used in a variety of model species: Human. (novusbio.com)
  • Choose from our Ribonuclease Inhibitor RNAi. (novusbio.com)
  • In RNase Inhibitor, RNaseOUT Recombinant Ribonuclease Inhibitor, RNA secure RNase Inactivation Reagent, and RNase Inhibitor. (thermofisher.com)
  • Ribonuclease Inhibitor Polyclonal antibody specifically detects Ribonuclease Inhibitor in Human samples. (fishersci.com)
  • Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of human Ribonuclease Inhibitor. (fishersci.com)
  • Due to the highly catalytic nature of RNase A for RNA strands, mammalian cells have developed a protective inhibitor to prevent pancreatic ribonucleases from degrading cystolic RNA. (proteopedia.org)
  • Ribonuclease Inhibitor (RI) tightly associates to the active site due to its non-globular nature. (proteopedia.org)
  • RNA changes are associated with a significant increase in alkaline ribonuclease activity due to an abnormality in the ribonuclease-inhibitor complex. (sciencemag.org)
  • RiboSafe RNase Inhibitor is a recombinant protein which completely inhibits a broad spectrum of eukaryotic RNases, including RNases A, B and C. (bioline.com)
  • RiboSafe RNase Inhibitor is a recombinant protein which completely inhibits a broad spectrum of eukaryotic RNases, including RNases A, B and C. Furthermore, RiboSafe shows no inhibition of polymerase or reverse transcriptase activity and so can be used for cDNA synthesis and in one-step RT-PCR reactions. (bioline.com)
  • RiboSafe RNase Inhibitor is tested for activity, SDS-PAGE purity and the absence of endonucleases, nickases and exonucleases and functions robustly at a variety of temperatures and pH and in the presence or absence of DTT, allowing flexibility in designing experiments in highly-sensitive techniques such as single-cell RT-PCR, in vitro RNA synthesis and in vitro translation. (bioline.com)
  • Either RNase A and RNase inhibitor were incubated directly with yeast total RNA (blue column) or RNase A and RNase inhibitor were mixed and pre-incubated before addition to yeast total RNA (grey column). (bioline.com)
  • In both cases using RiboSafe RNase Inhibitor blocks more of the RNase A activity than RNase inhibitors from Supplier S. (bioline.com)
  • HeLa cell total RNA was incubated at 37°C for 30 min with RiboSafe RNase Inhibitor in the presence of between 2 ng - 125 pg of RNase A (Lanes 1-4), no RiboSafe RNase Inhibitor and 125 pg of RNase A (Lane 5) and no RiboSafe RNase Inhibitor, no RNase A (Lane 6). (bioline.com)
  • Even at high concentrations of RNase A, RiboSafe RNase Inhibitor showed no visible levels of degradation. (bioline.com)
  • A two-fold serial dilution of total HeLa cell total RNA (1 µg - 0.075 µg) was reverse transcribed in the presence (Lanes 1-5) and in the absence (Lanes 7-11) of RiboSafe RNase Inhibitor, followed by the amplification of a 1 kb fragment of the Angiotensin receptor II gene using MyFi Mix. (bioline.com)
  • There was no detectable difference in PCR product in the presence or absence of RiboSafe RNase Inhibitor. (bioline.com)
  • 2 µg aliquots of mouse total RNA was incubated at 37 o C with RiboSafe RNase Inhibitor and no RNase A (lane 1), no RiboSafe RNase Inhibitor and RNase A (lane 2), or with RiboSafe RNase Inhibitor and RNase A at 37 o C, 42 o C, 45 o C, 50 o C and 55 o C (lanes 3-7 respectively). (bioline.com)
  • Regardless of the temperature, there is no visible levels of degradation when incubated with RiboSafe RNase Inhibitor. (bioline.com)
  • A highly effective, broad-spectrum eukaryotic RNase inhibitor. (bioline.com)
  • Would you like to share your experience of the RiboSafe RNase Inhibitor as part of our new customer review program? (bioline.com)
  • RiboLock RNase Inhibitor specifically inhibits the activity of RNases A, B, and C, protecting RNA under a variety of reaction conditions. (fishersci.ca)
  • RiboLock RNase Inhibitor inhibits the activity of RNases A , B, and C by binding them in a noncompetitive mode at a 1:1 ratio. (fishersci.ca)
  • An endogenous ribonuclease inhibitor regulates the antimicrobial activity of ribonuclease 7 in the human urinary tract. (curehunter.com)
  • RNase H is a non-specific endonuclease and catalyzes the cleavage of RNA via a hydrolytic mechanism, aided by an enzyme-bound divalent metal ion. (wikipedia.org)
  • RNase L is an interferon-induced nuclease that, upon activation, destroys all RNA within the cell EC 3.1.26.5: RNase P is a type of ribonuclease that is unique in that it is a ribozyme - a ribonucleic acid that acts as a catalyst in the same way as an enzyme. (wikipedia.org)
  • In bacteria RNase P is also responsible for the catalytic activity of holoenzymes, which consist of an apoenzyme that forms an active enzyme system by combination with a coenzyme and determines the specificity of this system for a substrate. (wikipedia.org)
  • Ribonuclease T (RNase T, exonuclease T, exo T) is a ribonuclease enzyme involved in the maturation of transfer RNA and ribosomal RNA in bacteria, as well as in DNA repair pathways. (wikipedia.org)
  • Despite the apparent usefulness of RNAse T, the enzyme is only found in gammaproteobacteria. (wikipedia.org)
  • Cette enzyme est capable de dérouler la double hélice d'ADN en se complexant avec un brin d'ADN monocaténaire à l'aide de liaisons salines entre résidus de lysine et d'arginine de la protéine et groupes phosphate des nucléotides. (dbpedia.org)
  • It encodes an enzyme known as RNase L, which degrades RNA, a chemical relative of DNA. (thefreedictionary.com)
  • For example, RNase A is a digestive enzyme secreted by the pancreas that hydrolyses phosphodiester bonds in the nucleotide chain. (encyclopedia.com)
  • RNase ONE Ribonuclease is a 27kDa periplasmic enzyme from E. coli that catalyzes the degradation of RNA to cyclic nucleotide monophosphate (NMP) intermediates. (bio-medicine.org)
  • The ability to have a single lot of purified enzyme instantly made RNase the model system for protein studies. (bionity.com)
  • Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. (abcam.com)
  • It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. (abcam.com)
  • RNase P is unique from other RNases in that it is a ribozyme - a ribonucleic acid that acts as a catalyst in the same way that a protein based enzyme would. (wikidoc.org)
  • Because hRI is large and non-globular relative to RNase 1, it provides an extensive binding area for the enzyme. (kenyon.edu)
  • RNAse is a pretty hardy enzyme -- if it's not working, it's likely because of the way you're using it, not the way you're making it. (protocol-online.org)
  • The properties of leukocytic RNase were found to be similar to those of serum acid RNase, but the latter enzyme differed in substrate specificity substantially from leukocytic RNase, preferring polyuridylate to polycytidylate. (biomedsearch.com)
  • Bovine pancreatic ribonuclease A (RNase A) is an enzyme that catalyzes the hydrolysis of RNA through acid-base catalysis . (proteopedia.org)
  • Poly(A)-specific ribonuclease (PARN) , also known as polyadenylate-specific ribonuclease or deadenylating nuclease (DAN) , is an enzyme that in humans is encoded by the PARN gene . (wikidoc.org)
  • Schomburg D., Salzmann M. (1991) Ribonuclease P. In: Schomburg D., Salzmann M. (eds) Enzyme Handbook 3. (springer.com)
  • A ribonuclease, or RNase, is an enzyme which degrades RNA into smaller nucleotides. (mobio.com)
  • the condition i have is called RNase Enzyme Deficiency Disease [1] (i love the acronym: REDD). (integralworld.net)
  • RNase is an enzyme produced by the human body when it is attacked by viruses or bacteria. (integralworld.net)
  • 1. U.v. difference spectra show that the anionic surfactant sodium n -dodecyl sulphate unfolds ribonuclease A at pH7.3 and 10.3, but that the cationic surfactant n -dodecyltrimethylammonium bromide does not affect the conformation of the enzyme. (biochemj.org)
  • The evolution of the ribonuclease A (RNase A) vertebrate-specific enzyme family is interesting in that specific gene lineages appear to be responding to unique selective pressures in wildly diverse manners to generate proteins that are capable of reducing the infectivity of viruses, killing systemic pathogens, and inducing the growth of blood vessels all while maintaining the signature motifs of a ribonuclease. (umich.edu)
  • Poly(A)-specific ribonuclease (PARN) is an oligomeric enzyme that degrades the poly(A) tail with high processivity. (diva-portal.org)
  • An Adsorbent showing enhanced selectivity for the enzyme RNase A was prepared by a surface imprinting procedure based on metal coordination. (lu.se)
  • However only the first eight identified human RNases, which are refered to as "canonical" RNases, contain the catalytic residues required for RNase A activity. (nih.gov)
  • RNases 9-13 have the characteristic disulfide bridge pattern but are unlikely to share RNase activity. (nih.gov)
  • This hypothesis is supported by the fact that only RNase 5-like RNases have been reported outside the mammalian class. (nih.gov)
  • RNase ONE Ribonuclease is one of the few known RNases that can cleave a phosophodiester bond between any two ribonucleotides (1,2). (bio-medicine.org)
  • Applying RNase inhibitors might dampen the destructive response of RNases. (wingsforlife.com)
  • Natural and Recombinant RNasin Ribonuclease Inhibitors have broad spectrum RNase inhibitory properties, including the inhibition of eukaryotic RNases of the neutral type (1). (bio-medicine.org)
  • As ribonucleases III ou RNases III son encimas ribonucleases que se unen especificamente e clivan (cortan) ARNs bicatenarios. (wikipedia.org)
  • Small amounts of ribonucleases (RNases) can sometimes co-purify with isolated RNA and compromise downstream applications. (thermofisher.com)
  • It is essential to maintain RNase-free conditions at all times when working with RNA as they are very susceptible to degradation from environmental RNases. (horizondiscovery.com)
  • Ribonucleases (RNases) are key players of the host immunity and contribute to maintaining tissue homeostasis and body fluid sterility. (frontiersin.org)
  • You may not have the right sequence in your RNA oligo to be cleaved by RNase A and you might need to use another RNases (say RNase T1). (protocol-online.org)
  • The RNase activity-dependent antimicrobial activity of the S-like RNase NE shares similarities with the only other biological activity demonstrated for plant RNases, the inhibition of elongation of pollen tubes by the S-RNase in gametophytic self-incompatibility, suggesting a functional link between self and nonself interactions in plants. (apsnet.org)
  • Buffer RPE concentrate and RNase-free water are tested for absence of RNases by incubating 4 µg of total HeLa-RNA in these solutions for 3 hours at 37°C, followed by monitoring RNA integrity via denaturing agarose gel electrophoresis and ethidium bromide staining. (qiagen.com)
  • Buffer RLT and Buffer RW1 are inherently RNase-free, since the buffers themselves inactivate RNases during the RNeasy procedure . (qiagen.com)
  • Ultrafiltration cartridges included in EMD Millipore water purification systems are an effective alternative to DEPC treatment allowing delivery of highpurity RNase-free water on demand (based on the results of several experiments on RNA preparation, RNA digestion, an RNA stability test and dosage of RNases). (selectscience.net)
  • Alternative function of a protein kinase homology domain in 2′, 5′-oligoadenylate dependent RNase L. Nucleic acids research. (springer.com)
  • It is worth noting that all intracellular RNAs are protected from RNase activity by a number of strategies including 5' end capping, 3' end polyadenylation, and folding within an RNA protein complex (ribonucleoprotein particle or RNP). (wikipedia.org)
  • A form of RNase P that is a protein and does not contain RNA has recently been discovered. (wikipedia.org)
  • This gene provides instructions for making a protein called ribonuclease T2 (RNAse T2), which is normally abundant in the brain. (medlineplus.gov)
  • The RNASET2 gene mutations that cause RNAse T2-deficient leukoencephalopathy result in loss of ribonuclease T2 protein function. (medlineplus.gov)
  • To assess the sensitivity to protein amounts, denaturation profiles of bovine pancreatic RNAse A were generated with three different amounts of protein: 10 [micro]g, 1 [micro]g, and 100 ng. (thefreedictionary.com)
  • 8 RNase A homologs had initially been identified in the human genome, pancreatic RNase (RNase 1), Eosinophil Derived Neurotoxin (EDN/RNASE 2), Eosinophil Cationic Protein (ECP/RNase 3), RNase 4, Angiogenin (RNase 5), RNase 6 or k6, the skin derived RNase (RNase 7) and RNase 8. (nih.gov)
  • The RNase A family most likely started off in vertebrates as a host-defense protein, and comparative analysis in mammals and birds indicates that the family may have originated from a RNase 5-like gene. (nih.gov)
  • Here, the ribonuclease activity of S3 protein of P. inflata was abolished, and the effect on the pistil's ability to reject S3 pollen was examined. (mendeley.com)
  • The mutant S3 protein produced in these two transgenic plants did not exhibit any detectable ribonuclease activity. (mendeley.com)
  • Kinetoplastid RNA editing protein B3 (KREPB3, formerly TbMP61) is part of the multiprotein complex that catalyzes editing in T. brucei and contains an RNase III motif that suggests nuclease function. (pnas.org)
  • Kinetoplastid RNA editing protein (KREP) B1, KREPB2, and KREPB3 have RNase III, U1-like Zn 2+ finger, and dsRNA-binding motifs indicative of endonucleases. (pnas.org)
  • RNase III and dsRNA-binding motifs are typical in bacterial and eukaryotic endonucleases, and U1-like Zn 2+ finger motifs imply RNA and protein interactions in a complex ( 12 ). (pnas.org)
  • The genes for eosinophil cationic protein (ECP) and eosinophil-derived neurotoxin (EDN) in primates belong to the ribonuclease gene family, and the ECP gene, whose product has an anti-pathogen function not displayed by EDN, was generated by duplication of the EDN gene about 31 million years ago. (pnas.org)
  • The structure of RNase P protein from the hyperthermophilic bacterium Thermotoga maritima was determined at 1.2-A resolution by using x-ray crystallography. (rcsb.org)
  • This protein structure is from an ancestral-type RNase P and bears remarkable similarity to the recently determined structures of RNase P proteins from bacteria that have the distinct, Bacillus type of RNase P. These two types of protein span the extent of bacterial RNase P diversity, so the results generalize the structure of the bacterial RNase P protein. (rcsb.org)
  • We exploited intein-mediated protein ligation to produce a semisynthetic ribonuclease A. Of the 124 residues of RNase A, residues 1-94 were linked to an intein. (hindawi.com)
  • After expression of the fusion protein and thiol-induced cleavage, the RNase A(1-94) fragment possessed a C-terminal thioester. (hindawi.com)
  • Bovine pancreatic RNase A is one of the classic model systems of protein science. (bionity.com)
  • RNase A was the model protein used to work out many spectroscopic methods for assaying protein structure, including absorbance, circular dichroism/optical rotary dispersion, Raman, EPR and NMR spectroscopy. (bionity.com)
  • RNase A was also the first model protein for the development of several chemical structural methods, such as limited proteolysis of disordered segments, chemical modification of exposed side chains, and antigenic recognition. (bionity.com)
  • RNase A was the third protein to have its structure solved, in 1967. (bionity.com)
  • Studies of the oxidative folding of RNase A led Chris Anfinsen to enunciate the thermodynamic hypothesis of protein folding, which states that the folded form of a protein represents the minimum of its free energy. (bionity.com)
  • RNase A was the first protein for showing the effects of non-native isomers of X-Pro peptide bonds in protein folding. (bionity.com)
  • RNase A was the first protein to be studied by multiple sequence alignment and by comparing the properties of evolutionarily related proteins. (bionity.com)
  • RNase A is a relatively small protein (124 residues, ~13.7 kDa). (bionity.com)
  • As shown by F. M. Richards, this linker may be cleaved by subtilisin between residues 20 and 21 without causing the N-terminal helix to dissociate from the rest of RNase A. The peptide-protein complex is called RNase S , the peptide (residues 1-20) is called the S-peptide and the remainder (residues 21-124) is called the S-protein . (bionity.com)
  • RNase 1 is a 156 amino acid protein that resembles the shape of a kidney. (kenyon.edu)
  • The active site of RNase 1 is located in a cleft between the two main lobes of the protein. (kenyon.edu)
  • Additionally, regions of high shape complementarity between residues of hRI and RNase 1 are ultimately responsible for the protein-protein interaction affinity in the femtomolar range. (kenyon.edu)
  • Intact ribonucleic acid (RNA) has been prepared from tissues rich in ribonuclease such as the rat pancreas by efficient homogenization in a 4 M solution of the potent protein denaturant guanidinium thiocyanate plus 0.1 M 2-mercaptoethanol to break protein disulfide bonds. (nih.gov)
  • The bacterial RNase P RNA component (or P RNA) consists of between 350-450 nucleotides, while the protein component is a small, basic protein of around 120 amino acids. (stanford.edu)
  • Click on the protein counts, or double click on taxonomic names to display all proteins containing RNAse_Pc domain in the selected taxonomic class. (embl-heidelberg.de)
  • Zusätzlich bieten wir Ihnen Ribonuclease T2 Antikörper (64) und Ribonuclease T2 Proteine (12) und viele weitere Produktgruppen zu diesem Protein an. (antikoerper-online.de)
  • We showed that RNase HII and HIII are capable of incision on Okazaki fragments in vitro and that both enzymes show mild stimulation by single-stranded DNA binding protein (SSB). (asm.org)
  • We find that the balance of packing energetics between CORE and the rest of the protein is different across the different RNase-Hs. (rsc.org)
  • In this paper, we present the DNA sequence and gene structure of Mus musculus RNase 6 and examine the expression pattern and enzymatic activity of the recombinant protein. (umich.edu)
  • M. musculus RNase 6 has a limited expression pattern compared to human RNase 6 and is an efficient ribonuclease, with a catalytic efficiency 17-fold higher than that of human protein. (umich.edu)
  • Ribonuclease (commonly abbreviated RNase) is a type of nuclease that catalyzes the degradation of RNA into smaller components. (wikipedia.org)
  • It is not effective against RNase 1, RNase T1, S1 Nuclease, RNase H or RNase from Aspergillus . (neb.com)
  • RNase L attenuates mitogen-stimulated gene expression via transcriptional and post-transcriptional mechanisms to limit the proliferative response. (springer.com)
  • RNAse T2-deficient leukoencephalopathy is caused by mutations in the RNASET2 gene. (medlineplus.gov)
  • In E. coli, RNAse T is encoded by the rnt gene and is hypothesized to have diverged from the proofreading subunits of polymerase III during the emergence of gammaproteobacteria. (wikipedia.org)
  • He said that now that they have the human RNase L structure, we can begin to understand the effects of carcinogenic mutations in the RNase L gene. (thefreedictionary.com)
  • The gene coding for the RNA subunit of ribonuclease P (RNase P) is essential in all free-living organisms. (nih.gov)
  • The S3 gene was mutagenized by replacing the codon for His-93, which has been implicated in ribonuclease activity, with a codon for asparagine, and the mutant S3 gene was introduced into P. inflata plants of S1S2 genotype. (mendeley.com)
  • This gene is called the EDN gene, because its product has physicochemical properties similar to those of EDN and has no toxicity against bacteria and parasites, though the RNase activity is much lower than that of human EDN ( 16 ). (pnas.org)
  • Zou H, Lee J, Kilani AF, Kim K, Trang P, Kim J, Liu F. Engineered RNase P ribozymes increase their cleavage activities and efficacies in inhibiting viral gene expression in cells by enhancing the rate of cleavage and binding of the target mRNA. (harvard.edu)
  • Zou H, Lee J, Umamoto S, Kilani AF, Kim J, Trang P, Zhou T, Liu F. Engineered RNase P ribozymes are efficient in cleaving a human cytomegalovirus mRNA in vitro and are effective in inhibiting viral gene expression and growth in human cells. (harvard.edu)
  • This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. (antikoerper-online.de)
  • Ribonuclease (RNase) NE gene expression is induced in tobacco leaves in response to Phytophthora parasitica . (apsnet.org)
  • This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. (novusbio.com)
  • These data suggest that the ancestral rodent RNase 6 was subject to accelerated evolution, resulting in the conserved modern gene, which most likely plays an important role in mouse physiology. (umich.edu)
  • Sequence and transcriptional analysis of the Escherichia coli rnt gene encoding RNase T. J Biol Chem. (pubmedcentralcanada.ca)
  • The production of extracellular proteins is regulated by ribonuclease III via two different pathways in staphylococcus aureus," PLoS ONE , vol. 6, no. 5, Article ID e20554, 2011. (hindawi.com)
  • S proteins, pistil-specific ribonucleases that cosegregate with S alleles, have previously been shown to control rejection of self-pollen in Petunia inflata and Nicotiana alata, two solanaceous species that display gametophytic self-incompatibility. (mendeley.com)
  • The ribonuclease activity of S proteins was thought to degrade RNA of self-pollen tubes, resulting in the arrest of their growth in the style. (mendeley.com)
  • Thus, the results reported here provide direct evidence that the biochemical mechanism of gametophytic self-incompatibility in P. inflata involves the ribonuclease activity of S proteins. (mendeley.com)
  • We therefore sought to determine whether the editosome proteins with an RNase III motif were RNA editing endonucleases. (pnas.org)
  • The broad phylogenetic conservation of structure and distribution of potential RNA-binding elements in the RNase P proteins indicate that all of these homologous proteins bind to their cognate RNAs primarily by interaction with the phylogenetically conserved core of the RNA. (rcsb.org)
  • There are 1376 RNAse_Pc domains in 1365 proteins in SMART's nrdb database. (embl-heidelberg.de)
  • Taxonomic distribution of proteins containing RNAse_Pc domain. (embl-heidelberg.de)
  • The complete taxonomic breakdown of all proteins with RNAse_Pc domain is also avaliable . (embl-heidelberg.de)
  • This entry includes a variety of exonuclease proteins, such as ribonuclease T [( PUBMED:8506149 )] and the epsilon subunit of DNA polymerase III. (embl.de)
  • It has been conjectured that the folding mechanism of ribonuclease-H (RNase-H) proteins is determined by the topology of their fold. (rsc.org)
  • However, these simulated folding routes do not agree with the folding routes of those RNase-H proteins that have been experimentally characterized. (rsc.org)
  • We next simulated the proteins using an SBM which specifically accounts for packing energetics and found that these routes not only vary substantially across the simulated RNase-H proteins but also agree with experiments. (rsc.org)
  • Thus, the packing energetics determine the folding mechanism of the RNase-H proteins. (rsc.org)
  • Our studies suggest that proteins from the RNase-H family should be used for experimentally detecting structurally distinct folding routes. (rsc.org)
  • RNAse T is able to achieve its sequence specificity in RNA digestion via several aromatic residues that sandwich between nucleobases. (wikipedia.org)
  • Exclusive expression of KREPB3 with point mutations in critical RNase III motif residues has similar inhibitory effects. (pnas.org)
  • The N-terminal α-helix of RNase A (residues 3-13) is connected to the rest of RNase A by a flexible linker (residues 16-23). (bionity.com)
  • A total number of 23 residues of RNase 1 make contact with hRI. (kenyon.edu)
  • Amongst all of the residues responsibe for intermolecular hydrogen bonding between regions of high shape complementarity in the hRI:RNase 1 complex, three residues in particular provide the highest energetic contribution to complex stabilization. (kenyon.edu)
  • Figure I: Bovine Ribonuclease A. Colored residues are representative of amino acids important to both the acid base catalysis (Red: His12 and 119) and stabilization of the transition state (Blue: Lys41). (proteopedia.org)
  • The highest ribonuclease activity was displayed by the compounds built of catalytic domain containing imidazole and carboxylic groups, and RNA binding domain built of cationic 1,4-diazabicyclo[2.2.2]octane (DABCO) residues bearing an aliphatic fragment (Fig. 1A). (jbsdonline.com)
  • The importance of bovine pancreatic RNase A was secured when the Armour & Co. (of hot dog fame) purified a kilogram of it, and gave 10 mg samples away free to any interested scientists. (bionity.com)
  • The properties of muscle ribonuclease I are very similar to those of bovine pancreatic ribonuclease A. Muscle ribonucleases II and III have characteristics similar to those of ribonucleases found in various other bovine tissues. (biochemj.org)
  • In common with all previously studied pyrimidine-specific endoribonucleases, the bovine muscle ribonucleases are inhibited by such purine homopolynucleotides as polyadenylate. (biochemj.org)
  • The cross-linked dimer of bovine pancreatic RNase (M.W. 28,000) is significantly more effective than the monomer in inhibiting tumor development in mice when administered i.p. 1 day after inoculation with sarcoma 180J ascites cells. (aacrjournals.org)
  • RNase inhibitors are commonly used as a precautionary measure in enzymatic manipulations of RNA to inhibit and control for such contaminants. (thermofisher.com)
  • Analyses of the tissues of untreated leukemic mice for RNase and RNase inhibitors show that the tumor tissues are not deficient in RNase activity. (aacrjournals.org)
  • catalytic site of RNase A consists of pyrimidine binding ( B1) and catalytic ( P1) subsites. (nih.gov)
  • EDN has high catalytic activity of RNase and nonphysiological neurotoxicity (lethal to experimental rabbits when injected into the brain) ( 12 ). (pnas.org)
  • Major progress in the study of RNase P has resulted from crystallography of bacterial catalytic subunits and the discovery of catalytic activity in eukaryotes. (rsc.org)
  • Early studies on RNase A catalysis showed that alkylation of His12 and His119 significantly decreased its catalytic activity, prompting the hypothesis that these two histidines were the acid/base catalyst. (proteopedia.org)
  • Each RNase has a specificity for a different cleavage site. (encyclopedia.com)
  • RNase A is involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. (nih.gov)
  • RNase ONE Ribonuclease may be used to remove RNA from DNA preparations, for RNase protection assays and for mapping or quantitation of RNA by selective cleavage of single-stranded regions. (bio-medicine.org)
  • This deficit may be overcome using RNase H and single-stranded DNA complementary to the desired cleavage sequence. (wikidoc.org)
  • The ribonuclease (RNase) family is comprised of a ubiquitous group of enzymes that share the common ability to catalyze the cleavage of RNA. (kenyon.edu)
  • RNase A catalyzes the cleavage of the Phosphodiester bonds in two steps: the formation of the pentavalent phosphate transition state and subsequent degradation of the 2'3' cyclic phosphate intermediate. (proteopedia.org)
  • The cleavage specificity of these aRNases is similar to that of ribonuclease A (CAUACG). (jbsdonline.com)
  • RNase II is responsible for the processive 3'-to-5' degradation of single-stranded RNA . (wikidoc.org)
  • RNA degradation by RNase serves as a defense mechanism against RNA viruses, provides the machinery for RNAi through the activity of the Dicer and Drosha enzymes, and has been recently targeted as a promising chemotherapeutic agent. (kenyon.edu)
  • Intracellular RNAs that are not targeted for degradation are protected from RNase activity by a number of different mechanisms. (kenyon.edu)
  • RNase-free to prevent degradation of RNA reagents and oligonucleotides. (horizondiscovery.com)
  • Conversion into an enzymatically inactive form after mutagenesis of the active site-histidine 97 residue to phenylalanine leads to the suppression of this activity, suggesting that RNase NE inhibits the elongation of germ tubes by degradation of microbial RNAs. (apsnet.org)
  • Ribonucleases are enzymes that catalyse the degradation of RNA. (sciencephoto.com)
  • RNase H is tested for the specific degradation of RNA hybridized to DNA and is free of detectable exo- and endodeoxyribonuclease, and non-RNase H RNase activities. (epibio.com)
  • RNA is extremely susceptible to degradation, so RNase contamination is of great concern in the medical device and pharmaceutical industries as well as the biotech and research fields. (mobio.com)
  • RNase can cause degradation of valuable RNA samples, which may make it impossible to analyze the RNA via RT-PCR, RT-QPCR or RNA sequencing. (mobio.com)
  • 1977 ). Further, a correlation was found between this RNase activity and the synthesis of unusual 2′-5′ oligoadenylates (2-5A) (Fig. 1 ) by a family of enzymes called oligoadenylate synthetases (OAS) [(Baglioni et al. (springer.com)
  • Ribonucleases can be divided into endoribonucleases and exoribonucleases, and comprise several sub-classes within the EC 2.7 (for the phosphorolytic enzymes) and 3.1 (for the hydrolytic enzymes) classes of enzymes. (wikipedia.org)
  • one method of isolating it is to boil a crude cellular extract until all enzymes other than RNase A are denatured. (wikipedia.org)
  • This new candidate therapy works by "caging" RNase enzymes that otherwise destroy RNA molecules (see panel B). This enables higher levels of important pro-regenerative molecules to be produced from their RNAs, resulting in faster, longer re-growth of injured nerve fibers. (wingsforlife.com)
  • There appear to be no RNase analogs of the restriction enzymes , which cleave highly specific sequences of double-stranded DNA . (wikidoc.org)
  • With 0.63 mM yeast RNA as substrate, all three enzymes (ribonucleases I, II and III) are optimally active in alkaline solution (pH 7.5-8.5) containing 0.05-0.15 M univalent salts, do not require bivalent cations, and have molecular weights of 13 000-20 000. (biochemj.org)
  • The RNase III motifs of KREPB1, KREPB2, and KREPB3 all conserve the amino acids that are critical to endonuclease function ( 13 ). (pnas.org)
  • Ribonuclease A (RNase A) is an endonuclease that cleaves single-stranded RNA . (bionity.com)
  • Ribonuclease P, or RNase P, is the only endonuclease responsible for processing the 5' end of tRNA by cleaving a precursor and leading to tRNA maturation. (stanford.edu)
  • Ribonuclease H (RNase H) from E. coli is an endonuclease that specifically degrades the RNA in an RNA:DNA hybrid, without affecting DNA or unhybridized RNA. (epibio.com)
  • Uses include in vitro inhibition of ribonucleases in procedures such as cDNA synthesis from mRNA, in vitro transcription/ translation reactions, 3 ribonuclease protection assays, 4 and RT-PCR. (sigmaaldrich.com)
  • After production in Pichia pastoris and biochemical purification, we show that the S-like RNase NE inhibits hyphal growth from P. parasitica zoospores and from Fusarium oxysporum conidia in vitro. (apsnet.org)
  • Exogenous application of RNase NE in the extracellular space of leaves inhibits the development of P. parasitica . (apsnet.org)
  • DNA-OFF and RNase-OFF may be used in laboratory settings to eliminate DNA and RNase contamination, respectively. (clontech.com)
  • RNase-OFF is a non-alkaline, non-corrosive and non-carcinogenic cleansing solution that is very active against RNase contamination. (clontech.com)
  • RNase-OFF is stable, heat-resistant, and comes ready-to-use to eliminate RNase contamination from any surface, including the interior surfaces of microcentrifuge tubes. (clontech.com)
  • i hope this is the correct method.but after the rnase treatment the rna contamination stays in the isolated plasmid. (protocol-online.org)
  • just add 5microlt of the rnase that should be sufficient to digest 100-800ng of rna completely.but i still see the rna contamination in gel even after increasing the rnase amount. (protocol-online.org)
  • RNase Blaster has been designed to protect the integrity of your RNA sample as well as eliminate RNase contamination in reaction vessels. (clontech.com)
  • of water and assurance that the water is free from DNase, RNase and protease contamination. (thomassci.com)
  • Some guidelines on how to best avoid RNase contamination. (openwetware.org)
  • A wide variety of products are certified to be free of RNase contamination and ready for direct use in all RNA work using this test. (mobio.com)
  • Sources of RNase contamination in the laboratory include human skin, air, and dust. (mobio.com)
  • All testing apparatus are treated with Diethyl Pyrocarbonate (DEPC) to inhibit possible RNase contamination of the experiment from outside sources. (mobio.com)
  • The positive control should be a very blurry, quick-running band, indicating the effect of RNase contamination on the RNA standard pool that is used for all the samples. (mobio.com)
  • Purification and characterization of Escherichia coli RNase T". The Journal of Biological Chemistry. (wikipedia.org)
  • H. D. Robertson, R. E. Webster, and N. D. Zinder, "Purification and properties of ribonuclease III from Escherichia coli ," The Journal of Biological Chemistry , vol. 243, no. 1, pp. 82-91, 1968. (hindawi.com)
  • Analysis of Escherichia coli RNase e and RNase III activity in vivo using tiling microarrays," Nucleic Acids Research , vol. 39, no. 8, pp. 3188-3203, 2011. (hindawi.com)
  • [ 1 ] Un exemplo é a ribonuclease III procariótica de Escherichia coli ( EC 3.1.26.3 ) (xene rnc), [ 2 ] que é un encima que dixire ARN bicatenario, e está implicado no procesamento de precursores do ARN ribosómico e dalgúns ARNm . (wikipedia.org)
  • It shows more homology to the RNase HII of Escherichia coli. (abcam.com)
  • Deutscher MP, Marlor CW, Zaniewski R. RNase T is responsible for the end-turnover of tRNA in Escherichia coli. (pubmedcentralcanada.ca)
  • Maki H, Horiuchi T, Sekiguchi M. Structure and expression of the dnaQ mutator and the RNase H genes of Escherichia coli: overlap of the promoter regions. (pubmedcentralcanada.ca)
  • Our RNeasy buffers are subjected to stringent quality-control tests to ensure that they are indeed RNase-free. (qiagen.com)
  • Drappier M, Michiels T. Inhibition of the OAS/RNase L pathway by viruses. (springer.com)
  • Activity is measured by the inhibition of hydrolysis of cytidine 2', 3'-cyclic monophosphate by RNase A. (neb.com)
  • Unit definition: One unit will cause the inhibition of 50% of the activity of 5 ng of ribonuclease A in a cytidine 2',3'-cyclic monophosphate system. (sigmaaldrich.com)
  • This interaction contributes most extensively to RNase 1 inhibition upon binding to hRI. (kenyon.edu)
  • Of note, SCD1 inhibition phenocopies IRE1α RNase activity suppression in vivo. (jci.org)
  • Purification and properties of acid ribonucleases in human serum and leukocytes. (biomedsearch.com)
  • It does not require any cofactors for its activity EC 3.1.26.4: RNase H is a ribonuclease that cleaves the RNA in a DNA/RNA duplex to produce ssDNA. (wikipedia.org)
  • EC 3.1.26.3: RNase III is a type of ribonuclease that cleaves rRNA (16s rRNA and 23s rRNA) from transcribed polycistronic RNA operon in prokaryotes. (wikipedia.org)
  • Specifically, RNAse T cleaves the 3' AMP residue from the 3' CCA sequences at the end of tRNA, which explains RNAse T's sequence specificity for stopping at the 3' CC sequence. (wikipedia.org)
  • RNase H is a ribonuclease that cleaves the RNA in a DNA/RNA duplex to produce ssDNA. (wikipedia.org)
  • RNase I cleaves 3'-end of ssRNA at all dinucleotide bonds leaving a 5´ hydroxyl, 2',3'-cyclic monophosphate. (wikidoc.org)
  • Many stress-response toxins of prokaryotic toxin-antitoxin systems have been shown to have RNase activity and homology. (wikipedia.org)
  • The amino acid sequence of poly(A)-specific ribonuclease shows homology to the RNase D family of 3'- exonucleases . (wikidoc.org)
  • RNase PhyM is sequence specific for single-stranded RNAs. (wikipedia.org)
  • EC 3.1.27.3: RNase T1 is sequence specific for single-stranded RNAs. (wikipedia.org)
  • We use Rfoot to precisely map RNase-protected regions within small nucleolar RNAs, spliceosomal RNAs, microRNAs, tRNAs, long noncoding (lnc)RNAs and 3′ untranslated regions of mRNAs in human cells. (mit.edu)
  • RNase V1 is non-sequence specific for double stranded RNAs. (wikidoc.org)
  • RNase T is the major contributor for the 3'-to-5' maturation of many stable RNAs. (wikidoc.org)
  • Lariat RNAs and circRNAs are both RNase R resistant RNAs. (mdpi.com)
  • therefore, the circular parts of lariat RNAs and the circRNAs can be segregated from eukaryotic total RNAs by their RNase R resistance. (mdpi.com)
  • Thus, RNase R resistant RNAs could provide unexplored splicing information not available from mRNAs. (mdpi.com)
  • Tsukahara, T. A View of Pre-mRNA Splicing from RNase R Resistant RNAs. (mdpi.com)
  • RNase A (structure on top) is scary for RNAs and RNA researchers. (openwetware.org)
  • RNase T is capable of cleaving both DNA and RNA, with extreme sequence specificity discriminating against cytosine at the 3' end of the substrate. (wikipedia.org)
  • The structure allowed us to make important observations regarding the general architecture of the S-domain, the structure of a region conserved in RNase P's of all organisms and the position of nucleotides involved in interactions with the substrate, and in this way defining regions that are crucial for activity. (stanford.edu)
  • One unit of RNase III, E. coli , solubilizes 1 nmol of ribonucleotide in 30 minutes at 37°C using poly(A)-poly(U) as the substrate under standard assay conditions. (epibio.com)
  • Under conditions of excess of RNA substrate, each molecule of the ribonuclease mimic can cleave up to 150 phosphodiester bonds within 24h. (jbsdonline.com)
  • In this review, we describe the compounds, reported up to today, which inhibit the HIV-1 RNase H function, their chemical structures, the structure-activity relationships and the mechanism of action. (ingentaconnect.com)
  • While E. coli can survive without RNAse T, its absence leads to slower life cycles and weakened response to starvation. (wikipedia.org)
  • Additionally, the presence of RNAse T in E. coli is linked to increased resistance to UV damage. (wikipedia.org)
  • The E. coli RNase H has been discontinued. (epibio.com)
  • However, in contrast to Hybridase™ Thermostable RNase H, which can be used at temperatures up to 95°C, E. coli RNase H is inactivated at 65°C in 10 minutes. (epibio.com)
  • Ribonuclease III (RNase III) from E. coli is an endoribonuclease that specifically digests dsRNA to dsRNA fragments that have two-base, 3´ overhangs. (epibio.com)
  • Using antibodies directed against RNase NE, we demonstrate that RNase NE is extracellular at the early steps of the interaction, while the fungal tip growth is initiated in the apoplas-tic compartment. (apsnet.org)
  • Based on its induction by inoculation, its localization, and its activity against two plant pathogens, we propose that RNase NE participates in tobacco defense mechanisms by a direct action on hyphal development in the extracellular space. (apsnet.org)
  • Le Roy F, Silhol M, Salehzada T, Bisbal C. Regulation of mitochondrial mRNA stability by RNase L is translation-dependent and controls IFN alpha-induced apoptosis. (springer.com)
  • It also digests double strands RNA (dsRNA)-Dicer family of RNAse, cutting pre-miRNA (60-70bp long) at a specific site and transforming it in miRNA (22-30bp), that is actively involved in the regulation of transcription and mRNA life-time. (wikipedia.org)
  • In addition to the lead molecule, RSLV-132, the company is developing additional molecules that contain both RNase and DNase activities, which may also be useful in the treatment of lupus and other autoimmune diseases resulting from aberrant nucleic acid deposition. (thefreedictionary.com)
  • Small RNA cleaving molecules artificial ribonucleases (aRNases) can find applications in biotechnology for manipulating RNA and may provide new opportunities for design of RNA-targeted therapeutics. (jbsdonline.com)
  • One group of the compounds was prepared by conjugation of cationic organic molecules to different structures containing the groups known to be involved in catalysis in the active sites of natural ribonucleases: imidazole, carboxylic, and amino groups. (jbsdonline.com)
  • The RNase H function catalyzes the selective hydrolysis of the RNA strand of the RNA:DNA heteroduplex replication intermediate. (ingentaconnect.com)
  • RNase A uses acid/base catlysis to speed up RNA hydrolysis. (proteopedia.org)
  • The active site for RNase A, although fairly nonspecific, has some specificity for sites RNA hydrolysis. (proteopedia.org)
  • Molecular model of a poly(A)-specific ribonuclease (PARN) molecule. (sciencephoto.com)
  • Expression of KREPB3 alleles with single amino acid mutations in the RNase III motif had similar consequences. (pnas.org)
  • To prevent the release of active ribonuclease, temperatures greater than 50°C and high concentrations of urea or other denaturing agents should be avoided. (neb.com)
  • 6 The concentration for use is 250-1000 units/mL. 7 Denaturing conditions (i.e., urea or temperatures ≥50 °C) should be avoided as they may cause release of active ribonuclease from the complex. (sigmaaldrich.com)
  • 0.1 mU RNase, DNase-free degrades 1 μg RNA in 30 min at + 37 °C in a reaction volume of 50 μL PCR grade water. (sigmaaldrich.com)
  • RQ1 RNase-Free DNase is a preparation of deoxyribonuclease I that degrades single-stranded or double-stranded DNA to produce 3-hydroxyl oligonucleotides. (bio-medicine.org)
  • the dissociation constant of the RI- RNase A complex is in the femtomolar (fM) range under physiological conditions while that for the RI- angiogenin complex is less than 1 fM. (wikipedia.org)
  • This Research Topic gathers some of the latest research on two secretory RNase families, RNaseA and RNaseT2, which participate in the host immune response and share similar mechanisms of action. (frontiersin.org)
  • A member of the larger DEDD family of exoribonucleases, RNAse T plays a key role in the maturation of tRNA as well as the maturation of the 5S and 23S rRNA domains. (wikipedia.org)
  • CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III," Nature , vol. 471, no. 7340, pp. 602-607, 2011. (hindawi.com)
  • The mechanism of Okazaki fragment maturation, which involves RNA removal and subsequent DNA replacement, in bacteria lacking RNase HI remains unclear. (asm.org)
  • We also showed that RNase HIII and DNA polymerase I provide the primary pathway for Okazaki fragment maturation in vitro . (asm.org)
  • Together, our data showed that RNase HIII and DNA polymerase I provide the primary pathway for Okazaki fragment maturation, whereas YpcP also contributes to the removal of RNA from an Okazaki fragment in vitro . (asm.org)
  • RNAse T catalyzes the removal of nucleotides from the 3' end of both RNA and DNA. (wikipedia.org)
  • RNase III can digest dsRNA composed of canonical ribonucleotides as well as DuraScript® RNA produced using Epicentre's DuraScribe® T7 Transcription Kit, which contains 2´-fluorine-CMP and 2´-fluorine-UMP in place of the canonical CMP and UMP nucleotides. (epibio.com)
  • The structure is consistent with all the available data for bacterial RNase P's and extends our understanding of RNase P across all kingdoms of life. (stanford.edu)
  • Computer model showing the structure of bacterial ribonuclease Rnase Z (orange) complexed with synthetic transfer RNA (cyan). (sciencephoto.com)
  • 2. Equilibrium-dialysis experiments show that sodium n -dodecyl sulphate binds to ribonuclease A, but no binding of n -dodecyltrimethylammonium bromide could be detected at pH7.3. (biochemj.org)
  • At what step and for how long do you do the RNAse digestion? (protocol-online.org)
  • Hi, I am working on RNA stability against RNase A digestion. (protocol-online.org)
  • But when the same concentration of RNase A was used with a 21-nt RNA (at the same amount as the 80-mer RNA), no digestion was observed throughout the 40-min incubation. (protocol-online.org)
  • For example, add 0.5 μL RNase to the nucleic acids from 10 6 cells and incubate at +15 to + 25 °C or +37 °C. For nucleic acids from 10 7 cells, add 1.5 μL RNase and incubate 30 min at + 37 °C. For nucleic acids from 10 8 cells, add 16 μL RNase and incubate 30 min at + 37 °C. (sigmaaldrich.com)
  • Colorless Liquid CAS Number: 7732-18-5 Molecular Formula: H 2 O Molecular Weight: 18.02 The high quality DNAse & RNAse Free water is indicated for reagent preparation in nucleic acid research. (thomassci.com)
  • 1. On the oxidation of a linear partially protected octapeptide corresponding to the sequence of amino acids of the ribonuclease chain in the 65-72 segment, the corresponding disulfide is formed in high yield, which apparently shows the definite predisposition of this fragment to the formation of a disulfide bond between the terminal cysteines. (springer.com)
  • Your search returned 3 ribonuclease P/MRP 30 subunit ELISA ELISA Kit across 1 supplier. (biocompare.com)
  • Parniak, Professor of Molecular Genetics & Biochemistry at the University of Pittsburgh and Principal Investigator of this multi-team research effort, has nearly 20 years experience in HIV research and is regarded as a thought leader in the discovery of drugs targeting HIV RNase H. (thefreedictionary.com)
  • UltraPure DNase/RNase-Free Distilled Water is designed for use in all molecular biology applications. (bio-medicine.org)
  • hi guys im facing difficulty in preparing rnase that works properly .i use the protocol in molecular cloning ,sambrook ,but my rnase doesnt work whatso ever time i try.is there any other method to prepare rnase solution from powder form. (protocol-online.org)
  • Additionally, the structure of the S-domain of B. subtilis RNase P provides a molecular framework for studying many of the interactions that must occur during tRNA processing by this crucial ribozyme. (stanford.edu)
  • water is ideal for the preparation of reagents, rinsing glassware and plasticware, and other molecular biology applications where Rnase, Dnase, and Protease-free water is required. (thomassci.com)
  • DNase, RNase and protease tested Endotoxin and mycoplasma tested Applications Molecular Biology Water is ideal for the preparation of reagents, rinsing glassware and plasticware, and other molecular biology applications where RNase, DNase, and Protease-free water is required. (thomassci.com)
  • Certified RNase and DNase free for use in molecular biology applications. (thomassci.com)
  • EC 3.1.27.5: RNase A is an RNase that is commonly used in research. (wikipedia.org)
  • La ribonucleasa pancreática (EC 3.1.27.5) es una endonucleasa específica a la pirimidina que se encuentra en grandes cantidades en los páncreas de ciertos mamíferos y algunos reptiles. (dbpedia.org)
  • Mammalian RIs are unable to bind certain pancreatic ribonuclease family members from other species. (wikipedia.org)
  • Belongs to the pancreatic ribonuclease family. (abcam.com)
  • Ribonuclease Rnase Z complexed with transfer RNA (ribonucleic acid). (sciencephoto.com)
  • Comparative sequence analysis of ribonucleases HII, III, II PH and D. (nih.gov)
  • RNase T shares conserved sequence motifs with DNA proofreading exonucleases. (pubmedcentralcanada.ca)
  • Hipp K, Galani K, Batisse C, Prinz S, Böttcher B. Modular architecture of eukaryotic RNase P and RNase MRP revealed by electron microscopy. (harvard.edu)
  • ECP and EDN in hominoids and Old World (OW) monkeys belong to the ribonuclease (RNase) superfamily, and they are present in the large specific granules of eosinophilic leukocytes ( 12 ). (pnas.org)
  • The Ribonuclease A Superfamily is composed of a group of structurally similar peptides that are secreted by immune cells and epithelial tissues. (mdpi.com)
  • Several members of the Ribonuclease A Superfamily demonstrate antimicrobial activity, and it has been suggested that some of these ribonucleases play an essential role in host defense. (mdpi.com)
  • EC 3.1.26.12: RNase E is a ribonuclease of plant origin, which modulates SOS responses in bacteria, for a response to the stress of DNA damage by activation of the SOS mechanism by the RecA/LexA dependent signal transduction pathway that transcriptionally depresses a multiplicity of genes leading to transit arrest of cell division as well as initiation of DNA repair. (wikipedia.org)
  • The mechanism of RNA removal from Okazaki fragments remains unknown in bacteria that lack RNase HI. (asm.org)
  • in REDD, the mechanism that produces RNase is damaged by any number of causes, the most notable being environmental toxins. (integralworld.net)
  • this 37 kD RNase has no turn-off mechanism, because the body only recognizes the 80 kD forms. (integralworld.net)
  • 3. The enzymic activity of ribonuclease A is unaffected by n -dodecyltrimethylammonium bromide up to a concentration of 0.03 m at 25°C. 4. (biochemj.org)
  • RNase and DEPC Treatment (This is a very good source with systematic studies of the effect of different variables on RNase activity. (openwetware.org)
  • Cheney hypothesizes that CFS moves through three distinct stages that begin when an intracellular organism activates the RNase L pathway. (thefreedictionary.com)
  • The roles of RNase-L in antimicrobial immunity and the cytoskeleton-associated innate response. (springer.com)
  • Ribonuclease 7 (RNase 7) is an epithelial-derived secreted peptide with potent broad-spectrum antimicrobial activity. (mdpi.com)
  • This review summarizes the published literature on RNase 7's antimicrobial properties, structure, regulation, and contributions to host defense. (mdpi.com)
  • Ribonuclease 7, an antimicrobial peptide upregulated during infection, contributes to microbial defense of the human urinary tract. (curehunter.com)
  • Ribonuclease 7 is a potent antimicrobial peptide within the human urinary tract. (curehunter.com)