AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsTechnology, Industry, AgricultureInformation Science
Pyridoxal PhosphatePyridoxalPyridoxal KinasePyridoxinePyridoxaminePhosphatesVitamin B 6 DeficiencyBorohydridesTransaminasesTryptophan SynthaseAspartate AminotransferasesApoenzymesPyridoxaminephosphate OxidaseVitamin B 6LyasesKineticsGlycine HydroxymethyltransferaseSchiff BasesPhosphorylasesD-Alanine TransaminasePyridoxic AcidL-Serine DehydrataseTyrosine Phenol-LyaseSpectrophotometryCarboxy-LyasesOrnithine-Oxo-Acid TransaminaseBinding SitesSemicarbazidesIminesEscherichia coliCalcium PhosphatesSpectrophotometry, UltravioletTyrosine DecarboxylaseHydrogen-Ion ConcentrationGlucose-6-PhosphateGlyceraldehyde-3-Phosphate DehydrogenasesAldehydesSugar PhosphatesHemoglobin C DiseaseTryptophanaseLysinePhosphorylase bPimelic AcidsCysteine SynthaseCystathionine beta-SynthaseSubstrate Specificity5-Aminolevulinate SynthetasePlants, EdibleAmino Acid SequenceAmino AcidsMolecular Sequence DataCoenzymesAnemia, SideroblasticSkin CreamErythrocytesDimercaprol4-Aminobutyrate TransaminaseDialysisAminooxyacetic AcidCatalysisProtein BindingTyrosine TransaminaseChemistryBoratesChemical PhenomenaPQQ CofactorGlyceraldehyde 3-PhosphateThreonine DehydrataseInositol PhosphatesHydroxylaminesLiverMagnetic Resonance SpectroscopyTransferasesMolecular WeightProtein ConformationAlanine TransaminaseAdenosine TriphosphateSerineSpectrometry, FluorescenceChromatography, High Pressure LiquidGlucosephosphate DehydrogenaseSwineSickle Cell TraitSpectrum AnalysisPentose Phosphate PathwayCysteineOrnithineAdenosine MonophosphateCytosine NucleotidesPicolinesOrnithine DecarboxylaseGlycineModels, MolecularDihydroxyacetone PhosphateVitamin B ComplexElectrophoresis, Polyacrylamide GelGlucosephosphatesCyanidesPhosphate Transport ProteinsCircular DichroismStereoisomerismHistidineMacromolecular SubstancesHomocysteinePurinergic P2 Receptor AntagonistsGlucose-6-Phosphate IsomeraseMutationTryptophanRibosemonophosphatesBase SequenceAlanineRecombinant ProteinsSulfhydryl ReagentsChromatographyStructure-Activity RelationshipCloning, Molecular
Pyridoxal Phosphate: This is the active form of VITAMIN B 6 serving as a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid. During transamination of amino acids, pyridoxal phosphate is transiently converted into pyridoxamine phosphate (PYRIDOXAMINE).Pyridoxal: The 4-carboxyaldehyde form of VITAMIN B 6 which is converted to PYRIDOXAL PHOSPHATE which is a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid.Pyridoxal Kinase: An enzyme that catalyzes reversibly the phosphorylation of pyridoxal in the presence of ATP with the formation of pyridoxal 5-phosphate and ADP. Pyridoxine, pyridoxamine and various derivatives can also act as acceptors. EC 2.7.1.35.Pyridoxine: The 4-methanol form of VITAMIN B 6 which is converted to PYRIDOXAL PHOSPHATE which is a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid. Although pyridoxine and Vitamin B 6 are still frequently used as synonyms, especially by medical researchers, this practice is erroneous and sometimes misleading (EE Snell; Ann NY Acad Sci, vol 585 pg 1, 1990).Pyridoxamine: The 4-aminomethyl form of VITAMIN B 6. During transamination of amino acids, PYRIDOXAL PHOSPHATE is transiently converted into pyridoxamine phosphate.Phosphates: Inorganic salts of phosphoric acid.Vitamin B 6 Deficiency: A nutritional condition produced by a deficiency of VITAMIN B 6 in the diet, characterized by dermatitis, glossitis, cheilosis, and stomatitis. Marked deficiency causes irritability, weakness, depression, dizziness, peripheral neuropathy, and seizures. In infants and children typical manifestations are diarrhea, anemia, and seizures. Deficiency can be caused by certain medications, such as isoniazid.Borohydrides: A class of inorganic or organic compounds that contain the borohydride (BH4-) anion.Transaminases: A subclass of enzymes of the transferase class that catalyze the transfer of an amino group from a donor (generally an amino acid) to an acceptor (generally a 2-keto acid). Most of these enzymes are pyridoxyl phosphate proteins. (Dorland, 28th ed) EC 2.6.1.Tryptophan Synthase: An enzyme that catalyzes the conversion of L-serine and 1-(indol-3-yl)glycerol 3-phosphate to L-tryptophan and glyceraldehyde 3-phosphate. It is a pyridoxal phosphate protein that also catalyzes the conversion of serine and indole into tryptophan and water and of indoleglycerol phosphate into indole and glyceraldehyde phosphate. (From Enzyme Nomenclature, 1992) EC 4.2.1.20.Aspartate Aminotransferases: Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. EC 2.6.1.1.Apoenzymes: The protein components of enzyme complexes (HOLOENZYMES). An apoenzyme is the holoenzyme minus any cofactors (ENZYME COFACTORS) or prosthetic groups required for the enzymatic function.Pyridoxaminephosphate Oxidase: An enzyme catalyzing the deamination of pyridoxaminephosphate to pyridoxal phosphate. It is a flavoprotein that also oxidizes pyridoxine-5-phosphate and pyridoxine. EC 1.4.3.5.Vitamin B 6: VITAMIN B 6 refers to several PICOLINES (especially PYRIDOXINE; PYRIDOXAL; & PYRIDOXAMINE) that are efficiently converted by the body to PYRIDOXAL PHOSPHATE which is a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, and aminolevulinic acid. During transamination of amino acids, pyridoxal phosphate is transiently converted into PYRIDOXAMINE phosphate. Although pyridoxine and Vitamin B 6 are still frequently used as synonyms, especially by medical researchers, this practice is erroneous and sometimes misleading (EE Snell; Ann NY Acad Sci, vol 585 pg 1, 1990). Most of vitamin B6 is eventually degraded to PYRIDOXIC ACID and excreted in the urine.Lyases: A class of enzymes that catalyze the cleavage of C-C, C-O, and C-N, and other bonds by other means than by hydrolysis or oxidation. (Enzyme Nomenclature, 1992) EC 4.Kinetics: The rate dynamics in chemical or physical systems.Glycine Hydroxymethyltransferase: A pyridoxal phosphate enzyme that catalyzes the reaction of glycine and 5,10-methylene-tetrahydrofolate to form serine. It also catalyzes the reaction of glycine with acetaldehyde to form L-threonine. EC 2.1.2.1.Schiff Bases: Condensation products of aromatic amines and aldehydes forming azomethines substituted on the N atom, containing the general formula R-N:CHR. (From Grant & Hackh's Chemical Dictionary, 5th ed)Phosphorylases: A class of glucosyltransferases that catalyzes the degradation of storage polysaccharides, such as glucose polymers, by phosphorolysis in animals (GLYCOGEN PHOSPHORYLASE) and in plants (STARCH PHOSPHORYLASE).D-Alanine Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the reversible transfer of an amino group between D-Alanine and alpha-ketoglutarate to form PYRUVATE and D-GLUTAMATE, respectively. It plays a role in the synthesis of the bacterial CELL WALL. This enzyme was formerly classified as EC 2.6.1.10.Pyridoxic Acid: The catabolic product of most of VITAMIN B 6; (PYRIDOXINE; PYRIDOXAL; and PYRIDOXAMINE) which is excreted in the urine.L-Serine Dehydratase: A PYRIDOXAL-phosphate containing enzyme that catalyzes the dehydration and deamination of L-serine to form pyruvate. This enzyme was formerly listed as EC 4.2.1.13.Tyrosine Phenol-Lyase: An enzyme that catalyzes the cleavage of tyrosine to phenol, pyruvate, and ammonia. It is a pyridoxal phosphate protein. The enzyme also forms pyruvate from D-tyrosine, L-cysteine, S-methyl-L-cysteine, L-serine, and D-serine, although at a slower rate. EC 4.1.99.2.Spectrophotometry: The art or process of comparing photometrically the relative intensities of the light in different parts of the spectrum.Carboxy-Lyases: Enzymes that catalyze the addition of a carboxyl group to a compound (carboxylases) or the removal of a carboxyl group from a compound (decarboxylases). EC 4.1.1.Ornithine-Oxo-Acid Transaminase: A pyridoxal phosphate enzyme that catalyzes the formation of glutamate gamma-semialdehyde and an L-amino acid from L-ornithine and a 2-keto-acid. EC 2.6.1.13.Binding Sites: The parts of a macromolecule that directly participate in its specific combination with another molecule.SemicarbazidesIminesEscherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.Calcium Phosphates: Calcium salts of phosphoric acid. These compounds are frequently used as calcium supplements.Spectrophotometry, Ultraviolet: Determination of the spectra of ultraviolet absorption by specific molecules in gases or liquids, for example Cl2, SO2, NO2, CS2, ozone, mercury vapor, and various unsaturated compounds. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Tyrosine Decarboxylase: A pyridoxal-phosphate protein that catalyzes the conversion of L-tyrosine to tyramine and carbon dioxide. The bacterial enzyme also acts on 3-hydroxytyrosine and, more slowly, on 3-hydroxyphenylalanine. (From Enzyme Nomenclature, 1992) EC 4.1.1.25.Hydrogen-Ion Concentration: The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Glucose-6-Phosphate: An ester of glucose with phosphoric acid, made in the course of glucose metabolism by mammalian and other cells. It is a normal constituent of resting muscle and probably is in constant equilibrium with fructose-6-phosphate. (Stedman, 26th ed)Glyceraldehyde-3-Phosphate Dehydrogenases: Enzymes that catalyze the dehydrogenation of GLYCERALDEHYDE 3-PHOSPHATE. Several types of glyceraldehyde-3-phosphate-dehydrogenase exist including phosphorylating and non-phosphorylating varieties and ones that transfer hydrogen to NADP and ones that transfer hydrogen to NAD.Aldehydes: Organic compounds containing a carbonyl group in the form -CHO.Sugar PhosphatesHemoglobin C Disease: A disease characterized by compensated hemolysis with a normal hemoglobin level or a mild to moderate anemia. There may be intermittent abdominal discomfort, splenomegaly, and slight jaundice.Tryptophanase: An enzyme that catalyzes the conversion of L-tryptophan and water to indole, pyruvate, and ammonia. It is a pyridoxal-phosphate protein, requiring K+. It also catalyzes 2,3-elimination and beta-replacement reactions of some indole-substituted tryptophan analogs of L-cysteine, L-serine, and other 3-substituted amino acids. (From Enzyme Nomenclature, 1992) EC 4.1.99.1.Lysine: An essential amino acid. It is often added to animal feed.Phosphorylase b: The inactive form of GLYCOGEN PHOSPHORYLASE that is converted to the active form PHOSPHORYLASE A via phosphorylation by PHOSPHORYLASE KINASE and ATP.Pimelic Acids: A group of compounds that are derivatives of heptanedioic acid with the general formula R-C7H11O4.Cysteine Synthase: An enzyme that catalyzes the biosynthesis of cysteine in microorganisms and plants from O-acetyl-L-serine and hydrogen sulfide. This enzyme was formerly listed as EC 4.2.99.8.Cystathionine beta-Synthase: A multifunctional pyridoxal phosphate enzyme. In the second stage of cysteine biosynthesis it catalyzes the reaction of homocysteine with serine to form cystathionine with the elimination of water. Deficiency of this enzyme leads to HYPERHOMOCYSTEINEMIA and HOMOCYSTINURIA. EC 4.2.1.22.Substrate Specificity: A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.5-Aminolevulinate Synthetase: An enzyme of the transferase class that catalyzes condensation of the succinyl group from succinyl coenzyme A with glycine to form delta-aminolevulinate. It is a pyridoxyal phosphate protein and the reaction occurs in mitochondria as the first step of the heme biosynthetic pathway. The enzyme is a key regulatory enzyme in heme biosynthesis. In liver feedback is inhibited by heme. EC 2.3.1.37.Plants, Edible: An organism of the vegetable kingdom suitable by nature for use as a food, especially by human beings. Not all parts of any given plant are edible but all parts of edible plants have been known to figure as raw or cooked food: leaves, roots, tubers, stems, seeds, buds, fruits, and flowers. The most commonly edible parts of plants are FRUIT, usually sweet, fleshy, and succulent. Most edible plants are commonly cultivated for their nutritional value and are referred to as VEGETABLES.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Amino Acids: Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Coenzymes: Small molecules that are required for the catalytic function of ENZYMES. Many VITAMINS are coenzymes.Anemia, Sideroblastic: Anemia characterized by the presence of erythroblasts containing excessive deposits of iron in the marrow.Skin Cream: A water-soluble medicinal preparation applied to the skin.Erythrocytes: Red blood cells. Mature erythrocytes are non-nucleated, biconcave disks containing HEMOGLOBIN whose function is to transport OXYGEN.Dimercaprol: An anti-gas warfare agent that is effective against Lewisite (dichloro(2-chlorovinyl)arsine) and formerly known as British Anti-Lewisite or BAL. It acts as a chelating agent and is used in the treatment of arsenic, gold, and other heavy metal poisoning.4-Aminobutyrate Transaminase: An enzyme that converts brain gamma-aminobutyric acid (GAMMA-AMINOBUTYRIC ACID) into succinate semialdehyde, which can be converted to succinic acid and enter the citric acid cycle. It also acts on beta-alanine. EC 2.6.1.19.Dialysis: A process of selective diffusion through a membrane. It is usually used to separate low-molecular-weight solutes which diffuse through the membrane from the colloidal and high-molecular-weight solutes which do not. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Aminooxyacetic Acid: A compound that inhibits aminobutyrate aminotransferase activity in vivo, thereby raising the level of gamma-aminobutyric acid in tissues.Catalysis: The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.Protein Binding: The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.Tyrosine Transaminase: An enzyme that catalyzes the conversion of L-TYROSINE and 2-oxoglutarate to 4-hydroxyphenylpyruvate and L-GLUTAMATE. It is a pyridoxal-phosphate protein. L-PHENYLALANINE is hydroxylated to L-tyrosine. The mitochondrial enzyme may be identical with ASPARTATE AMINOTRANSFERASES (EC 2.6.1.1.). Deficiency of this enzyme may cause type II Tyrosinemia (see TYROSINEMIAS). EC 2.6.1.5.Chemistry: A basic science concerned with the composition, structure, and properties of matter; and the reactions that occur between substances and the associated energy exchange.Borates: Inorganic or organic salts and esters of boric acid.Chemical Phenomena: The composition, conformation, and properties of atoms and molecules, and their reaction and interaction processes.PQQ Cofactor: A pyrrolo-quinoline having two adjacent keto-groups at the 4 and 5 positions and three acidic carboxyl groups. It is a coenzyme of some DEHYDROGENASES.Glyceraldehyde 3-Phosphate: An aldotriose which is an important intermediate in glycolysis and in tryptophan biosynthesis.Threonine Dehydratase: A pyridoxal-phosphate protein that catalyzes the deamination of THREONINE to 2-ketobutyrate and AMMONIA. The role of this enzyme can be biosynthetic or biodegradative. In the former role it supplies 2-ketobutyrate required for ISOLEUCINE biosynthesis, while in the latter it is only involved in the breakdown of threonine to supply energy. This enzyme was formerly listed as EC 4.2.1.16.Inositol Phosphates: Phosphoric acid esters of inositol. They include mono- and polyphosphoric acid esters, with the exception of inositol hexaphosphate which is PHYTIC ACID.Hydroxylamines: Organic compounds that contain the (-NH2OH) radical.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.Magnetic Resonance Spectroscopy: Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).Transferases: Transferases are enzymes transferring a group, for example, the methyl group or a glycosyl group, from one compound (generally regarded as donor) to another compound (generally regarded as acceptor). The classification is based on the scheme "donor:acceptor group transferase". (Enzyme Nomenclature, 1992) EC 2.Molecular Weight: The sum of the weight of all the atoms in a molecule.Protein Conformation: The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).Alanine Transaminase: An enzyme that catalyzes the conversion of L-alanine and 2-oxoglutarate to pyruvate and L-glutamate. (From Enzyme Nomenclature, 1992) EC 2.6.1.2.Adenosine Triphosphate: An adenine nucleotide containing three phosphate groups esterified to the sugar moiety. In addition to its crucial roles in metabolism adenosine triphosphate is a neurotransmitter.Serine: A non-essential amino acid occurring in natural form as the L-isomer. It is synthesized from GLYCINE or THREONINE. It is involved in the biosynthesis of PURINES; PYRIMIDINES; and other amino acids.Spectrometry, Fluorescence: Measurement of the intensity and quality of fluorescence.Chromatography, High Pressure Liquid: Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.Glucosephosphate DehydrogenaseSwine: Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).Sickle Cell Trait: The condition of being heterozygous for hemoglobin S.Spectrum Analysis: The measurement of the amplitude of the components of a complex waveform throughout the frequency range of the waveform. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Pentose Phosphate Pathway: An oxidative decarboxylation process that converts GLUCOSE-6-PHOSPHATE to D-ribose-5-phosphate via 6-phosphogluconate. The pentose product is used in the biosynthesis of NUCLEIC ACIDS. The generated energy is stored in the form of NADPH. This pathway is prominent in tissues which are active in the synthesis of FATTY ACIDS and STEROIDS.Cysteine: A thiol-containing non-essential amino acid that is oxidized to form CYSTINE.Ornithine: An amino acid produced in the urea cycle by the splitting off of urea from arginine.Adenosine Monophosphate: Adenine nucleotide containing one phosphate group esterified to the sugar moiety in the 2'-, 3'-, or 5'-position.Cytosine NucleotidesPicolines: A group of compounds that are monomethyl derivatives of pyridines. (From Dorland, 28th ed)Ornithine Decarboxylase: A pyridoxal-phosphate protein, believed to be the rate-limiting compound in the biosynthesis of polyamines. It catalyzes the decarboxylation of ornithine to form putrescine, which is then linked to a propylamine moiety of decarboxylated S-adenosylmethionine to form spermidine.Glycine: A non-essential amino acid. It is found primarily in gelatin and silk fibroin and used therapeutically as a nutrient. It is also a fast inhibitory neurotransmitter.Models, Molecular: Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.Dihydroxyacetone Phosphate: An important intermediate in lipid biosynthesis and in glycolysis.Vitamin B Complex: A group of water-soluble vitamins, some of which are COENZYMES.Electrophoresis, Polyacrylamide Gel: Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.GlucosephosphatesCyanides: Inorganic salts of HYDROGEN CYANIDE containing the -CN radical. The concept also includes isocyanides. It is distinguished from NITRILES, which denotes organic compounds containing the -CN radical.Phosphate Transport Proteins: Membrane proteins that are involved in the active transport of phosphate.Circular Dichroism: A change from planar to elliptic polarization when an initially plane-polarized light wave traverses an optically active medium. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Stereoisomerism: The phenomenon whereby compounds whose molecules have the same number and kind of atoms and the same atomic arrangement, but differ in their spatial relationships. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 5th ed)Histidine: An essential amino acid that is required for the production of HISTAMINE.Macromolecular Substances: Compounds and molecular complexes that consist of very large numbers of atoms and are generally over 500 kDa in size. In biological systems macromolecular substances usually can be visualized using ELECTRON MICROSCOPY and are distinguished from ORGANELLES by the lack of a membrane structure.Homocysteine: A thiol-containing amino acid formed by a demethylation of METHIONINE.Purinergic P2 Receptor Antagonists: Compounds that bind to and block the stimulation of PURINERGIC P2 RECEPTORS.Glucose-6-Phosphate Isomerase: An aldose-ketose isomerase that catalyzes the reversible interconversion of glucose 6-phosphate and fructose 6-phosphate. In prokaryotic and eukaryotic organisms it plays an essential role in glycolytic and gluconeogenic pathways. In mammalian systems the enzyme is found in the cytoplasm and as a secreted protein. This secreted form of glucose-6-phosphate isomerase has been referred to as autocrine motility factor or neuroleukin, and acts as a cytokine which binds to the AUTOCRINE MOTILITY FACTOR RECEPTOR. Deficiency of the enzyme in humans is an autosomal recessive trait, which results in CONGENITAL NONSPHEROCYTIC HEMOLYTIC ANEMIA.Mutation: Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.Tryptophan: An essential amino acid that is necessary for normal growth in infants and for NITROGEN balance in adults. It is a precursor of INDOLE ALKALOIDS in plants. It is a precursor of SEROTONIN (hence its use as an antidepressant and sleep aid). It can be a precursor to NIACIN, albeit inefficiently, in mammals.Ribosemonophosphates: Ribose substituted in the 1-, 3-, or 5-position by a phosphoric acid moiety.Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Alanine: A non-essential amino acid that occurs in high levels in its free state in plasma. It is produced from pyruvate by transamination. It is involved in sugar and acid metabolism, increases IMMUNITY, and provides energy for muscle tissue, BRAIN, and the CENTRAL NERVOUS SYSTEM.Recombinant Proteins: Proteins prepared by recombinant DNA technology.Sulfhydryl Reagents: Chemical agents that react with SH groups. This is a chemically diverse group that is used for a variety of purposes. Among these are enzyme inhibition, enzyme reactivation or protection, and labelling.Chromatography: Techniques used to separate mixtures of substances based on differences in the relative affinities of the substances for mobile and stationary phases. A mobile phase (fluid or gas) passes through a column containing a stationary phase of porous solid or liquid coated on a solid support. Usage is both analytical for small amounts and preparative for bulk amounts.Structure-Activity Relationship: The relationship between the chemical structure of a compound and its biological or pharmacological activity. Compounds are often classed together because they have structural characteristics in common including shape, size, stereochemical arrangement, and distribution of functional groups.Cloning, Molecular: The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.

Update on interconversions of vitamin B-6 with its coenzyme. (1/1448)

Biosynthesis of pyridoxal 5'-phosphate (PLP) depends upon the relatively specific action of two consecutive enzymes, viz. pyridoxal (pyridoxine, pyridoxamine) kinase and pyridoxine (pyridoxamine) phosphate oxidase. Less specific phosphatases catalyze hydrolyses of the 5'-phosphates of the vitamers pyridoxal, pyridoxamine, and pyridoxine. From the recognition a generation ago of these processes by which the three forms of vitamin B-6 and their 5'-phosphates are interconverted, more recent studies have provided a fairly sophisticated understanding of the molecular characteristics of the enzymes involved. The evolutionary retention of homologous portions of pyridoxal kinase in humans as well as bacteria and the most recent finding of a highly conserved region of the pyridoxine (pyridoxamine) phosphate oxidase, also from both prokaryotic and eukaryotic organisms, emphasize the importance of these catalysts in the formation of a coenzyme that is essential for most organisms. Both kinase and oxidase involved in B-6 metabolism are potential targets for pharmacologic agents.  (+info)

Reaction specificity of native and nicked 3,4-dihydroxyphenylalanine decarboxylase. (2/1448)

3,4-Dihydroxyphenylalanine (Dopa) decarboxylase is a stereospecific pyridoxal 5'-phosphate (PLP)-dependent alpha-decarboxylase that converts L-aromatic amino acids into their corresponding amines. We now report that reaction of the enzyme with D-5-hydroxytryptophan or D-Dopa results in a time-dependent inactivation and conversion of the PLP coenzyme to pyridoxamine 5'-phosphate and PLP-D-amino acid Pictet-Spengler adducts, which have been identified by high performance liquid chromatography. We also show that the reaction specificity of Dopa decarboxylase toward aromatic amines depends on the experimental conditions. Whereas oxidative deamination occurs under aerobic conditions (Bertoldi, M., Moore, P. S., Maras, B., Dominici, P., and Borri Voltattorni, C. (1996) J. Biol. Chem. 271, 23954-23959; Bertoldi, M., Dominici, P., Moore, P. S., Maras, B., and Borri Voltattorni, C. (1998) Biochemistry 37, 6552-6561), half-transamination and Pictet-Spengler reactions take place under anaerobic conditions. Moreover, we examined the reaction specificity of nicked Dopa decarboxylase, obtained by selective tryptic cleavage of the native enzyme between Lys334 and His335. Although this enzymatic species does not exhibit either decarboxylase or oxidative deamination activities, it retains a large percentage of the native transaminase activity toward D-aromatic amino acids and displays a slow transaminase activity toward aromatic amines. These transamination reactions occur concomitantly with the formation of cyclic coenzyme-substrate adducts. Together with additional data, we thus suggest that native Dopa decarboxylase can exist as an equilibrium among "open," "half-open," and "closed" forms.  (+info)

Carbon 13 NMR study of nonenzymatic reactions of pyridoxal 5'-phosphate with selected amino acids and of related reactions. (3/1448)

Carbon 13 nuclear magnetic resonance spectroscopy has been used to monitor the nonenzymatic reactions of pyridoxal 5'-phosphate with glycine, alanine, valine, serine, and with several other model compounds. Isotopically enriched amino acids were employed so that low concentrations could be utilized while still allowing relatively rapid acquisition of spectral data. The results for alanine and serine are particularly noteworthy in that alanine is deaminated to pyruvate and pyruvate is aminated to alanine, but contrary to the enzymatic reactions of various serine dehydratases wherein serine is converted to pyruvate, the nonenzymatic reaction utilizing serine results in hydroxypruvate rather than pyruvate formation. In the reverse reaction, hydroxypyruvate is aminated to serine but very inefficiently relative to the amination of pyruvate to alanine. The experimental results have been formulated into a proposed reaction mechanism for deamination of amino acids by pyridoxal-P.  (+info)

A prospective study on folate, B12, and pyridoxal 5'-phosphate (B6) and breast cancer. (4/1448)

To investigate the incidence of breast cancer and prediagnostic serum levels of folate, B12, and pyridoxal 5'-phosphate (B6), we conducted a nested case-control study using resources from the Washington County (Maryland) serum bank. In 1974, 12,450 serum specimens were donated, and in 1989, 14,625 plasma specimens were donated by female residents of Washington County. One hundred ninety-five incident breast cancer cases and 195 controls were matched by age, race, menopausal status at donation, and cohort participation as well as by date of blood donation. In both cohorts and all menopausal subgroups, median B12 concentrations were lower among cases than controls. Differences reached statistical significance only among women who were postmenopausal at donation (1974 cohort, 413 versus 482 pg/ml, P = 0.03; 1989 cohort, 406 versus 452 pg/ml, P = 0.02). Among women postmenopausal at blood donation, observed associations of B12 suggested a threshold effect with increased risk of breast cancer in the lowest one-fifth compared to the higher four-fifths of the control distribution [lowest versus highest fifth: 1974 cohort, matched odds ratio = 4.00 (95% confidence interval = 1.05-15.20); 1989 cohort, matched odds ratio = 2.25 (95% confidence interval = 0.86-5.91)]. We found no evidence for an association between folate, B6, and homocysteine and breast cancer. Findings suggested a threshold effect for serum B12 with an increased risk of breast cancer among postmenopausal women in the lowest one-fifth compared to the higher four-fifths of the control distribution. These results should stimulate further investigations of potentially modifiable risk factors, such as these B-vitamins, for prevention of breast cancer.  (+info)

Serine transhydroxymethylase from rabbit liver. Sequence of anonapeptide at the pyridoxal-5'-phosphate-binding site. (5/1448)

The amino acid sequence of the coenzyme-binding site of serine transhydroxymethylase from rabbit liver has been determined. After reduction with NaBH4 and aminoethylation, a first sample of enzyme was digested with thermolysin and a single phosphopyridoxyl peptide was isolated. A second sample of similarly treated enzyme was digested with chymotrypsin and three phosphopyridoxyl peptides clearly originating from a unique coenzyme-binding site were isolated. Sequence analysis of these peptides indicate the following structure: Val-Val-Thr-Thr-His(Pxy)-Thr-Leu. Sequence homologies of the active site of various pyridoxalphosphate enzymes are discussed in terms of a possible catalytic role and of evolution of this class of proteins.  (+info)

Effects of vasopressin on the sympathetic contraction of rabbit ear artery during cooling. (6/1448)

In order to analyse the effects of arginine-vasopressin on the vascular contraction to sympathetic nerve stimulation during cooling, the isometric response of isolated, 2-mm segments of the rabbit central ear (cutaneous) artery to electrical field stimulation (1-8 Hz) was recorded at 37 and 30 degrees C. Electrical stimulation (37 degrees C) produced frequency-dependent arterial contraction, which was reduced at 30 degrees C and potentiated by vasopressin (10 pM, 100 pM and 1 nM). This potentiation was greater at 30 than at 37 degrees C and was abolished at both temperatures by the antagonist of vasopressin V1 receptors d(CH2)5 Tyr(Me)AVP (100 nM). Desmopressin (1 microM) did not affect the response to electrical stimulation. At 37 degrees C, the vasopressin-induced potentiation was abolished by the purinoceptor antagonist PPADS (30 microM), increased by phentolamine (1 microM) or prazosin (1 microM) and not modified by yohimbine (1 microM), whilst at 30 degrees C, the potentiation was reduced by phentolamine, yohimbine or PPADS, and was not modified by prazosin. The Ca2+-channel blockers, verapamil (10 microM) and NiCl2 (1 mM), abolished the potentiating effects of vasopressin at 37 degrees C whilst verapamil reduced and NiCl2 abolished this potentiation at 30 degrees C. The inhibitor of nitric oxide synthesis, L-NOARG (100 microM), or endothelium removal did not modify the potentiation by vasopressin at 37 and 30 degrees C. Vasopressin also increased the arterial contraction to the alpha2-adrenoceptor agonist BHT-920 (10 microM) and to ATP (2 mM) at 30 and 37 degrees C, but it did not modify the contraction to noradrenaline (1 microM) at either temperature. These results suggest that in cutaneous (ear) arteries, vasopressin potentiaties sympathetic vasoconstriction to a greater extent at 30 than at 37 degrees C by activating vasopressin V1 receptors and Ca2+ channels at both temperatures. At 37 degrees C, the potentiation appears related to activation of the purinoceptor component and, at 30 degrees C, to activation of both purinoceptor and alpha2-adrenoceptor components of the sympathetic response.  (+info)

Rat liver serine dehydratase. Bacterial expression and two folding domains as revealed by limited proteolysis. (7/1448)

A pCW vector harboring rat liver serine dehydratase cDNA was expressed in Escherichia coli. The expressed level was about 5-fold higher in E. coli BL21 than in JM109 cell extract; the former lacked two kinds of proteases. Immunoblot analysis revealed the occurrence of a derivative other than serine dehydratase in the JM109 cell extract. The recombinant enzyme was purified to homogeneity. Staphylococcus aureus V8 protease and trypsin cleaved the enzyme at Glu-206 and Lys-220, respectively, with a concomitant loss of enzyme activity. Spectrophotometrically, the nicked enzyme showed a approximately 50% reduced capacity for binding of the coenzyme pyridoxal phosphate and no spectral change of circular dichroism in the region at 300-480 nm, whereas circular dichroism spectra of both enzymes in the far-UV region were similar, suggesting that proteolysis impairs the coenzyme binding without an accompanying gross change of the secondary structure. Whereas the nicked enzyme behaved like the intact enzyme on Sephadex G-75 column chromatography, it was dissociated into two fragments on the column containing 6 M urea. Upon the removal of urea, both fragments spontaneously refolded. These results suggest that serine dehydratase consists of two folding domains connected by a region that is very susceptible to proteases.  (+info)

Chemical modification of NADP-isocitrate dehydrogenase from Cephalosporium acremonium evidence of essential histidine and lysine groups at the active site. (8/1448)

NADP-isocitrate dehydrogenase from Cephalosporium acremonium CW-19 has been inactivated by diethyl pyrocarbonate following a first-order process giving a second-order rate constant of 3.0 m-1. s-1 at pH 6.5 and 25 degrees C. The pH-inactivation rate data indicated the participation of a group with a pK value of 6.9. Quantifying the increase in absorbance at 240 nm showed that six histidine residues per subunit were modified during total inactivation, only one of which was essential for catalysis, and substrate protection analysis would seem to indicate its location at the substrate binding site. The enzyme was not inactivated by 5, 5'-dithiobis(2-nitrobenzoate), N-ethylmaleimide or iodoacetate, which would point to the absence of an essential reactive cysteine residue at the active site. Pyridoxal 5'-phosphate reversibly inactivated the enzyme at pH 7.7 and 5 degrees C, with enzyme activity declining to an equilibrium value within 15 min. The remaining activity depended on the modifier concentration up to about 2 mm. The kinetic analysis of inactivation and reactivation rate data is consistent with a reversible two-step inactivation mechanism with formation of a noncovalent enzyme-pyridoxal 5'-phosphate complex prior to Schiff base formation with a probable lysyl residue of the enzyme. The analysis of substrate protection shows the essential residue(s) to be at the active site of the enzyme and probably to be involved in catalysis.  (+info)

Pyridoxal Phosphate Ying An - Drugs.comPyridoxal Phosphate Ying An - Drugs.com
Pyridoxal Phosphate Ying An is a medicine available in a number of countries worldwide. A list of US medications equivalent to Pyridoxal Phosphate Ying An is available on the Drugs.com website.
Studies on the changes in protein fluorescence and enzymic activity of aspartate aminotransferase on binding of pyridoxal 5′...Studies on the changes in protein fluorescence and enzymic activity of aspartate aminotransferase on binding of pyridoxal 5′...
1. The α and β subforms of aspartate aminotransferase were purified from pig heart. 2. The α subform contained 2mol of pyridoxal 5′-phosphate. The apo-(α subform) could be fully reactived by combination with 2mol of cofactor. 3. The protein fluorescence of the apo-(α subform) decreased non-linearly with increase in enzyme activity and concentration of bound cofactor. 4. It is concluded that the enzyme activity/mol of bound cofactor is largely independent of the number of cofactors bound to the dimer. 5. The β subform had approximately half the specific enzyme activity of the α subform, and contained an average of one active pyridoxal 5′-phosphate molecule per molecule, which could be removed by glutamate, and another inactive cofactor which could only be removed with NaOH. 6. On recombination with pyridoxal 5′-phosphate the protein fluorescence of the apo-(β subform) decreased linearly, showing that each dimeric enzyme molecule contained one active and one inactive bound cofactor. ...
TIGR01437TIGR01437
This HMM describes a protein related to a number of pyridoxal phosphate-dependent enzymes, and in particular to selenocysteine synthase (SelA), which converts Ser to selenocysteine on its tRNA. While resembling SelA, this protein is found only in species that have a better candidate SelA or else lack the other genes (selB, selC, and selD) required for selenocysteine incorporation ...
Pyridoxal phosphate (P5P)Pyridoxal phosphate (P5P)
Low vitamin B-6 status, based on plasma concentrations of pyridoxal-5-phosphate (PLP), has been identified in inflammatory diseases, including cardiovascular disease, rheumatoid arthritis, inflammatory bowel disease, and diabetes. Our objective was to examine the association between plasma PLP and multiple markers of inflammation in a community-based cohort [n = 2229 participants (55% women, mean age 61 ± 9 y)]. We created an overall inflammation score (IS) as the sum of standardized values of 13 individual inflammatory markers. Multivariable-adjusted regression analysis was used to assess the associations between the IS and plasma PLP. Geometric mean plasma PLP concentrations were lower in the highest tertile category of IS relative to the lowest (61 vs. 80 nmol/L; P-trend , 0.0001). Similarly, the prevalence of PLP insufficiency was significantly higher for participants in the highest compared with the lowest tertiles for IS categories. These relationships persisted after accounting for ...
HOGENOMDNA: ASFUM1 6.PE19HOGENOMDNA: ASFUM1 6.PE19
ASFUM1_6.PE19 Location/Qualifiers FT CDS_pept join(84596..84927,84989..85706) FT /codon_start=1 FT /gene_family="HOG000214639" [ FAMILY / ALN / TREE ] FT /evidence="3: Inferred from homology " FT /gene_id="IGI19902575" FT /orf_name="AFUA_6G00290" FT /product="Aminotransferase, putative " FT /EC_number="2.6.1.1" FT /function="1-aminocyclopropane-1-carboxylate synthase FT activity" FT /function="L-aspartate:2-oxoglutarate aminotransferase FT activity" FT /function="pyridoxal phosphate binding" FT /protein_id="EAL84236.1" FT /db_xref="GO:0004069" FT /db_xref="GO:0016847" FT /db_xref="GO:0030170" FT /db_xref="HOGENOM:HBG416157" FT /db_xref="HOGENOM:HBG685856" FT /db_xref="InterPro:IPR001176" FT /db_xref="InterPro:IPR004838" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniParc:UPI000051E68E" FT /db_xref="UniProtKB/TrEMBL:Q4W8Y3" FT /transl_table=1 FT ...
Domain combinations for gap ,81296, gap superfamilies in Saccharomyces cerevisiae AWRI796Domain combinations for gap ,81296, gap superfamilies in Saccharomyces cerevisiae AWRI796
Domain architectures containing the following SCOP superfamilies _gap_,81296,_gap_ in Saccharomyces cerevisiae AWRI796. Domain architectures illustrate each occurrence of _gap_,81296,_gap_.
GADL1 (glutamate decarboxylase like 1) - Chinchilla Research Resource DatabaseGADL1 (glutamate decarboxylase like 1) - Chinchilla Research Resource Database
ENCODES a protein that exhibits carboxy-lyase activity (inferred); pyridoxal phosphate binding (inferred); INVOLVED IN carboxylic acid metabolic process (inferred); ASSOCIATED WITH amenorrhea (ortholog); Liver Neoplasms (ortholog)
Pyridoxal 5-phosphate | 41468-25-1Pyridoxal 5'-phosphate | 41468-25-1
Visit ChemicalBook To find more Pyridoxal 5-phosphate(41468-25-1) information like chemical properties,Structure,melting point,boiling point,density,molecular formula,molecular weight, physical properties,toxicity information,customs codes. You can also browse global suppliers,vendor,prices,Price,manufacturers of Pyridoxal 5-phosphate(41468-25-1). At last,Pyridoxal 5-phosphate(41468-25-1) safety, risk, hazard and MSDS, CAS,cas number,Use,cas no may also be you need.
Pyridoxal phosphate-dependent transferase, subdomain 2 (IPR015422) | InterPro | EMBL-EBIPyridoxal phosphate-dependent transferase, subdomain 2 (IPR015422) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Diferència entre revisions de la pàgina «Cofactor enzimàtic» - Viquipèdia, lenciclopèdia lliureDiferència entre revisions de la pàgina «Cofactor enzimàtic» - Viquipèdia, l'enciclopèdia lliure
Piridoxal fosfat]] ,ref,{{cite journal ,author=Eliot AC, Kirsch JF ,title=Pyridoxal phosphate enzymes: mechanistic, structural, and evolutionary considerations ,journal=Annu. Rev. Biochem. ,volume=73 ,issue= ,pages=383-415 ,year=2004 ,pmid=15189147 ,doi=10.1146/annurev.biochem.73.011303.074021}},/ref, ,, [[Piridoxina]] (B,sub,6,/sub,) ,, Cap ,, Grups amino i carboxil ,, [[Bacteris]], [[archaea]] i [[eucariotes ...
Sequence Similarity - 1AKA: STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING...Sequence Similarity - 1AKA: STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING...
1AKA: Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5-phosphate-binding lysine residue.
Sequence Similarity - 1AIB: STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING...Sequence Similarity - 1AIB: STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING...
1AIB: Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5-phosphate-binding lysine residue.
L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate - L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate Exporter,...L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate - L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate Exporter,...
DEWCARE CONCEPT PVT. LTD. - Exporter, Manufacturer, Distributor, Supplier, Trading Company, Wholesaler & Dealer of L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate based in Ahmedabad, India
Use of Chlorite to Improve HPLC Detection of Pyridoxal 5-phosphate by Karen L. Ericson, J. D. Mahuren et al."Use of Chlorite to Improve HPLC Detection of Pyridoxal 5'-phosphate" by Karen L. Ericson, J. D. Mahuren et al.
Karen L. Ericson, J. D. Mahuren, Yvonne Zubovic, and Stephen P. Coburn (2005). Use of Chlorite to Improve HPLC Detection of Pyridoxal 5-phosphate. Journal Of Chromatography. B, Analytical Technologies In The Biomedical And Life Sciences.823 (2), 218-220 ...
Pyridoxal-5-Phosphate (P-5-P) Reviews on 20bestsellers.co.uk - Product Reviews on 20bestsellers.co.ukPyridoxal-5-Phosphate (P-5-P) Reviews on 20bestsellers.co.uk - Product Reviews on 20bestsellers.co.uk
Latest Pyridoxal-5-Phosphate (P-5-P) reviews in the category Health & Personal Care. Take a look and find your product at our test.
Pyridoxal- 5-phosphate monohydrate | AbcamPyridoxal- 5'-phosphate monohydrate | Abcam
Buy Codecarboxylase (CAS 41468-25-1), a vitamin B6 metabolite. Join researchers using high quality Codecarboxylase from Abcam and achieve your mission, faster.
Publications | CBCBPublications | CBCB
Oberhardt MA, Zarecki R, Reshef L, Xia F, Duran-Frigola M, Schreiber R, Henry CS, Ben-Tal N, Dwyer DJ, Gophna U et al.. 2016. Systems-Wide Prediction of Enzyme Promiscuity Reveals a New Underground Alternative Route for Pyridoxal 5-Phosphate Production in E. coli.. PLoS Comput Biol. 12(1):e1004705. ...
SAUSA300 RS12860 - AureoWikiSAUSA300 RS12860 - AureoWiki
Unknown functionEnzymes of unknown specificityPPOX class probable F420-dependent enzyme, Rv3369 family (TIGR03667; EC 1.-.-.-; HMM-score: 18.3) ...
Plus itPlus it
In this case-control study nested in the MEC study, we found an inverse association between plasma PLP levels and colorectal cancer which was not explained by an association with plasma folate, seemed stronger at low levels of alcohol intake and among individuals with the MTHFR 677TT genotype, and was independent of plasma CRP levels. An inverse association with plasma folate was also observed, which seemed to be stronger among individuals with a low level of alcohol intake and was suggested among subjects with the MTHFR 677TT genotype.. Our findings for PLP are consistent with those of Wei et al. (5) who found a 52% reduction in colorectal cancer risk comparing the highest to the lowest quartile for plasma PLP (P trend = 0.07) in a nested case-control study in women. They are also consistent with those of Figueiredo et al. (6) who found an inverse association between baseline plasma PLP levels and recurrence of adenoma in a randomized trial of aspirin and folic acid supplementation. Similarly, ...
PEGylated d-serine dehydratase as a d-serine reducing agent<...PEGylated d-serine dehydratase as a d-serine reducing agent<...
TY - JOUR. T1 - PEGylated d-serine dehydratase as a d-serine reducing agent. AU - Ito, Tomokazu. AU - Takada, Hiroe. AU - Isobe, Keiko. AU - Suzuki, Masataka. AU - Kitaura, Yasuyuki. AU - Hemmi, Hisashi. AU - Matsuda, Tsukasa. AU - Sasabe, Jumpei. AU - Yoshimura, Tohru. PY - 2014/10/9. Y1 - 2014/10/9. N2 - D-Serine is an endogenous coagonist for N-methyl-. d-aspartate (NMDA) receptors and is involved in excitatory neurotransmission. Excessive receptor activation causes excitotoxicity, leading to various acute and chronic neurological disorders. Decrease in d-serine content may provide a therapeutic strategy for the treatment of the neurological disorders in which overstimulation of NMDA receptors plays a pathological role. Saccharomyces cerevisiae d-serine dehydratase (Dsd1p), which acts dominantly on d-serine, may be a useful d-serine reducing agent. We conjugated a linear 5-kDa polyethylene glycol (PEG) to Dsd1p (PEG-Dsd1p) and examined the effects of PEG-conjugation on its biochemical and ...
PubMed Kidney Transplant | Transplant Professional PortalPubMed Kidney Transplant | Transplant Professional Portal
Background: Low plasma concentrations of pyridoxal 5-phosphate (PLP) are common in renal transplant recipients (RTRs) and confer increased risk of long-term mortality. To our knowledge, it is not known whether low plasma PLP concentrations have functional (i.e., intracellular) consequences and, if so, whether such consequences are associated with increased risk of mortality.Objectives: We assessed the association of plasma PLP with functional vitamin B-6 status and explored the potential association of functional vitamin B-6 status with long-term mortality in RTRs.Design: In a longitudinal cohort of 678 stable RTRs with a median follow-up of 5.3 y (IQR: 4.8-6.1 y) and 297 healthy controls, PLP, plasma 3-hydroxykynurenine (3-HK), and xanthurenic acid (XA) were analyzed via validated assays. PLP was used as direct biomarker for vitamin B-6 status, and the 3-HK:XA ratio was used as functional biomarker of vitamin B-6 status with a higher ratio reflecting worse functional vitamin B-6 ...
Wu, F<...Wu, F<...
Wu, F; Christen, P; Gehring, H (2011). A novel approach to inhibit intracellular vitamin B6-dependent enzymes: proof of principle with human and plasmodium ornithine decarboxylase and human histidine decarboxylase. FASEB Journal, 25(7):2109-2122.. Wu, F; Saleem, M A; Kampik, N B; Satchwell, T J; Williamson, R C; Blattner, S M; Ni, L; Toth, T; White, G; Young, M T; Parker, M D; Alper, S L; Wagner, C A; Toye, A M (2010). Anion exchanger 1 interacts with nephrin in podocytes. Journal of the American Society of Nephrology (JASN), 21(9):1456-1467.. Müller, I B; Wu, F; Bergmann, B; Knöckel, J; Walter, R D; Gehring, H; Wrenger, C (2009). Poisoning pyridoxal 5-phosphate-dependent enzymes: a new strategy to target the malaria parasite Plasmodium falciparum. PLoS ONE, 4(2):e4406.. Wu, F; Gehring, H (2009). Structural requirements for novel coenzyme-substrate derivatives to inhibit intracellular ornithine decarboxylase and cell proliferation. FASEB Journal, 23(2):565-574.. Wu, F; Yu, J; Gehring, H ...
Plus itPlus it
In this prospective, nested case-control study, we found that men with higher plasma PLP levels (above the median level) at baseline had a significantly lower risk of developing future colorectal cancer. The association was independent of conventional risk factors and plasma levels of biomarkers involved in one-carbon metabolism or inflammatory processes. The inverse association remained statistically significant after exclusion of cancer cases diagnosed during the first 4 years of follow-up, suggesting that the protective effect of PLP was unlikely to be influenced by preclinical disease or by change of diet.. We found a significant 51% lower risk of colorectal cancer among men in the highest quartiles than in the lowest quartiles of plasma PLP levels. Our findings in men are consistent with the previous findings in women (5), which observed a significant 52% reduction in colorectal cancer risk comparing the highest with the lowest quartiles (Ptrend = 0.07). A recent nested case-control study ...
Kemija vitamina B6 i sinteza novih analoga vitamina B6 | Repozitorij Odjela za kemiju, OsijekKemija vitamina B6 i sinteza novih analoga vitamina B6 | Repozitorij Odjela za kemiju, Osijek
Vitamin B6 exists in three basic chemical forms: pyridoxine (an alcohol), pyridoxal (an aldehyde) and pyridoxamine (a primary amine). The three major forms can be phosphorylated at the 5-hydroxymethyl group. The first total synthesis of vitamin B6 was obtained by the condensation of acetylacetone and cyanacetamide. All living beings need vitamin B6 for their existence. However, only microorganisms and plants are able to synthesize it de novo. The role of vitamin B6 is related to a number of metabolic processes , and also plays a role like a cofactor in certain enzyme-catalyzed reactions. Vitamin B6 is essential for more than 100 enzymes involved in protein metabolism. The most studied coenzymic activity is one of the pytidoxal-5-phosfate (PLP), PLP-dependent enzymes are involved in important steps of amino acid metabolism, processes of decarboxylation and racemization, hemoglobin formation and chlorophyll biosynthesis. Vitamin B6 could have a role in preventing oxidative stress of the cells. A ...
FoodScience of Vermont Pyridoxal 5-Phosphate - 60 VCapsules Customer Reviews - eVitamins AustraliaFoodScience of Vermont Pyridoxal 5-Phosphate - 60 VCapsules Customer Reviews - eVitamins Australia
Read the latest Pyridoxal 5-Phosphate by FoodScience of Vermont reviews and find the latest results, side effects and user experiences from eVitamins. Have you taken Pyridoxal 5-Phosphate by FoodScience of Vermont? Submit your own Pyridoxal 5-Phosphate review and let the world know what you think. Australia
Pyridoxal hydrochloride, 99%, ACROS Organics™ 100g; Glass bottle Pyridoxal hydrochloride, 99%, ACROS Organics™ | Fisher...Pyridoxal hydrochloride, 99%, ACROS Organics™ 100g; Glass bottle Pyridoxal hydrochloride, 99%, ACROS Organics™ | Fisher...
Shop a large selection of Pyridoxal hydrochloride, 99%, ACROS Organics™ products and learn more about Pyridoxal hydrochloride, 99%, ACROS Organics™ 100g; Glass
Criteria of supply of vitamins B1, B2, and B6 in children with insulin-dependent diabetes mellitusCriteria of supply of vitamins B1, B2, and B6 in children with insulin-dependent diabetes mellitus
Abstract: By mathematically analysing the curves of urinary excretion of vitamins, their plasma and erythrocytic concentrations or of TDP-effect, by constructing and mathematically interpreting the variation curves of distribution of a given plasma concentration of riboflavin and pyridoxal phosphate for 10-14-old-year children suffering from insulin-dependent diabetes mellitus after supplementation of vitamin, as a criterion of normal requirement for vitamin B2, the authors are prone to recommend the concentration of riboflavin over 10 micrograms/ml in plasma and over 96 micrograms/ml in erythrocytes, the hourly excretion of more than 27 micrograms. It has been ascertained that the criteria for the optimal bodys requirements for vitamins in diabetes mellitus children do not differ from those in healthy age-matched children. Thus, the value of TDP-effect is less than 1.25, the concentration of pyridoxal phosphate is over 8.4 micrograms/ml plasma, the excretion values of thiamine and 4-pyridoxic ...
Pyridoxal phosphate as coenzyme of diamine oxidase | Biochemical JournalPyridoxal phosphate as coenzyme of diamine oxidase | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
pdxS - Pyridoxal 5-phosphate synthase subunit PdxS - Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) - pdxS gene &...pdxS - Pyridoxal 5'-phosphate synthase subunit PdxS - Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) - pdxS gene &...
Catalyzes the formation of pyridoxal 5-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT subunit. Can also use ribulose 5-phosphate and dihydroxyacetone phosphate as substrates, resulting from enzyme-catalyzed isomerization of RBP and G3P, respectively.
pdxT - Pyridoxal 5-phosphate synthase subunit PdxT - Thermotoga sp. (strain RQ2) - pdxT gene & proteinpdxT - Pyridoxal 5'-phosphate synthase subunit PdxT - Thermotoga sp. (strain RQ2) - pdxT gene & protein
Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5-phosphate. The resulting ammonia molecule is channeled to the active site of PdxS.
Pyridoxal - DrugBankPyridoxal - DrugBank
The 4-carboxyaldehyde form of vitamin B 6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid. [PubChem]
TIGR04434TIGR04434
Members of this family are radical SAM domain (PF04055) enzymes with an N-terminal B12-binding domain (PF02310), as is fairly common for radical SAM enzymes with lipid substrates. However, both domains as found in this family seem to be long-branch and mostly score below the cutoffs for their respective HMMs. The function is unknown, but all cases a PLP-dependent enzyme (a cysteine desulfurase homolog) is found nearby ...
Plasma pyridoxal 5-phosphate [active co-enzyme form of vitamin B-6] in the US population: The National Health and Nutrition...Plasma pyridoxal 5'-phosphate [active co-enzyme form of vitamin B-6] in the US population: The National Health and Nutrition...
Particularly for substantial proportions of smokers, the elderly, non-Hispanic blacks, and current and former oral contraceptive users, the U.S. RDA f
Proteins matched: Pyridoxal 5-phosphate synthase subunit PdxT/SNO (IPR002161) | InterPro | EMBL-EBIProteins matched: Pyridoxal 5'-phosphate synthase subunit PdxT/SNO (IPR002161) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
ChemIDplus - 1053-73-2 - WHTCPDAXWFLDIH-KQYNXXCUSA-N - Adenosine 3-phosphate-5-phosphate - Similar structures search,...ChemIDplus - 1053-73-2 - WHTCPDAXWFLDIH-KQYNXXCUSA-N - Adenosine 3'-phosphate-5'-phosphate - Similar structures search,...
1053-73-2 - WHTCPDAXWFLDIH-KQYNXXCUSA-N - Adenosine 3-phosphate-5-phosphate - Similar structures search, synonyms, formulas, resource links, and other chemical information.
Pyridoxal-5-Phosphate - 90 TabletsPyridoxal-5-Phosphate - 90 Tablets
Pyridoxal-5-Phosphate from Nutri West is a vitamin B6 supplement that may promote the healthy function of numerous parts of the body-SHIPPING IS FREE!
Pyridoxal 5 Phosphate Caps 60 vcaps by Life ExtensionPyridoxal 5 Phosphate Caps 60 vcaps by Life Extension
Product Description Dietary Supplement Advanced Formula of Vitamin B6Product BenefitsIngredientsSuggestionsTake one (1) capsule daily with food, or as recommended by a healthcare practitioner.Extra InfoSpecial NoteWarningsKeep out of reach of children. Do not exceed recommended dose. Do not purchase if outer seal is br
Sequence Similarity Search - BLASTSequence Similarity Search - BLAST
eck:EC55989_3962 K01580 glutamate decarboxylase [EC:4.1.1.15] , (GenBank) gadA; glutamate decarboxylase A, PLP-dependent (A) MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT ...
Source Naturals - 4AllVitaminsSource Naturals - 4AllVitamins
In order for vitamins to be utilized by the body, they must first be converted into their active coenzyme forms. This Coenzymated B-6 goes directly into your bloodstream in its active form and ready to go to work immediately. Pyridoxal-5-Phosphate (PLP or P-5-P) is the main metabolically active coenzyme form of vitamin B-6. It is primarily in the liver that P-5-P is synthesized from pyrid... [Read More ...
Serine Hydroxymethyltransferase from Mung Bean (Vigna radiata) Is Not a Pyridoxal-5-Phosphate- Dependent Enzyme ePrints@IIScSerine Hydroxymethyltransferase from Mung Bean (Vigna radiata) Is Not a Pyridoxal-5'-Phosphate- Dependent Enzyme [email protected]
Serine hydroxymethyltransferase from mammalian and bacterial sources is a pyridoxal-5-phosphate-containing enzyme, but the requirement of pyridoxal-5-phosphate for the activity of the enzyme from plant sources is not clear. The specific activity of serine hydroxymethyltransferase isolated from mung bean (Vigna radiata) seedlings in the presence and absence of pyridoxal-5-phosphate was comparable at every step of the purification procedure. The mung bean enzyme did not show the characteristic visible absorbance spectrum of pyridoxal-5-phosphate protein. Unlike the enzymes from sheep, monkey, and human liver, which were converted to the apoenzyme upon treatment with L-cysteine and dialysis, the mung bean enzyme similarly treated was fully active. Additional evidence in support of the suggestion that pyridoxal-5-phosphate may not be required for the mung bean enzyme was the observation that pencillamine, a well-known inhibitor of pyridoxal-5-phosphate enzymes, did not perturb the enzyme ...
Pyridoxal phosphate induced association reactions of adrenodoxin and adrenodoxin-reductase - MDC RepositoryPyridoxal phosphate induced association reactions of adrenodoxin and adrenodoxin-reductase - MDC Repository
Adrenodoxin, Ferredoxin-NADP Reductase, Hydrogen Bonding, Kinetics, Molecular Weight, Protein Conformation, Pyridoxal Phosphate, Ultracentrifugation, ...
EC 2.6.1.52EC 2.6.1.52
2) 4-phosphonooxy-L-threonine + 2-oxoglutarate = (3R)-3-hydroxy-2-oxo-4-phosphonooxybutanoate + L-glutamate. For diagram, click here or here or here for mechanism click here.. Other name(s): PSAT; phosphoserine aminotransferase; 3-phosphoserine aminotransferase; hydroxypyruvic phosphate-glutamic transaminase; L-phosphoserine aminotransferase; phosphohydroxypyruvate transaminase; phosphohydroxypyruvic-glutamic transaminase; phosphoserine aminotransferase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Systematic name: O-phospho-L-serine:2-oxoglutarate aminotransferase. Comments: A pyridoxal-phosphate protein. This enzyme catalyses the second step in the phosphorylated pathway of serine biosynthesis in Escherichia coli [2,3]. It also catalyses the third step in the biosynthesis of the coenzyme pyridoxal 5-phosphate in Escherichia coli (using Reaction 2 above) [3]. In Escherichia coli, pyridoxal 5-phosphate is synthesized de novo by a pathway that involves EC ...
Uridine-5-diphospho-α-D-galactose disodium salt (CAS 137868-52-1) Market Research Report 2018Uridine-5'-diphospho-α-D-galactose disodium salt (CAS 137868-52-1) Market Research Report 2018
Uridine-5-diphospho-α-D-galactose disodium salt (CAS 137868-52-1) Market Research Report 2018 aims at providing comprehensive data on uridine-5-diphospho-α-d-galactose
PHARMA CAP: VIZYLAC CAPSULEPHARMA CAP: VIZYLAC CAPSULE
Vitamin B6 is the collective term for a group of three related compounds, pyridoxine (PN), pyridoxal (PL) and pyridoxamine (PM), and their phosphorylated derivatives, pyridoxine 5-phosphate (PNP), pyridoxal 5-phosphate (PLP) and pyridoxamine 5-phosphate (PMP). Although all six of these compounds should technically be referred to as vitamin B6, the term vitamin B6 is commonly used interchangeably with just one of them, pyridoxine. Vitamin B6, principally in its biologically active coenzyme form pyridoxal 5-phosphate, is involved in a wide range of biochemical reactions, including the metabolism of amino acids and glycogen, the synthesis of nucleic acids, hemogloblin, sphingomyelin and other sphingolipids, and the synthesis of the neurotransmitters serotonin, dopamine, norepinephrine and gamma-aminobutyric acid (GABA ...
Pyridoxine Hydrochloride Dangers | Livestrong.comPyridoxine Hydrochloride Dangers | Livestrong.com
Pyridoxine hydrochloride, or vitamin B6, is a member of the B complex family. This vitamin is found in high quantities in foods such as bananas, sardines, chicken spinach and avocados, according to the website dietbites.com. Pyridoxine hydrochloride is necessary for proper nerve function and for metabolizing nutrients.
JCI - WelcomeJCI - Welcome
Background. The majority of patients receiving the platinum-based chemotherapy drug oxaliplatin develop peripheral neurotoxicity. Because this neurotoxicity involves ROS production, we investigated the efficacy of mangafodipir, a molecule that has antioxidant properties and is approved for use as an MRI contrast enhancer.. Methods. The effects of mangafodipir were examined in mice following treatment with oxaliplatin. Neurotoxicity, axon myelination, and advanced oxidized protein products (AOPPs) were monitored. In addition, we enrolled 23 cancer patients with grade ≥2 oxaliplatin-induced neuropathy in a phase II study, with 22 patients receiving i.v. mangafodipir following oxaliplatin. Neuropathic effects were monitored for up to 8 cycles of oxaliplatin and mangafodipir.. Results. Mangafodipir prevented motor and sensory dysfunction and demyelinating lesion formation. In mice, serum AOPPs decreased after 4 weeks of mangafodipir treatment. In 77% of patients treated with oxaliplatin and ...
Pyridoxine 5-phosphate synthase superfamilyPyridoxine 5'-phosphate synthase superfamily
The SCOP classification for the Pyridoxine 5-phosphate synthase superfamily including the families contained in it. Additional information provided includes InterPro annotation (if available), Functional annotation, and SUPERFAMILY links to genome assignments, alignments, domain combinations, taxonomic visualisation and hidden Markov model information.
PYRIDOXINE HYDROCHLORIDE (VITAMIN B6 HYDROCHLORIDE)PYRIDOXINE HYDROCHLORIDE (VITAMIN B6 HYDROCHLORIDE)
Pyridoxine is a vitamin of the B group. It is used as a vitamin supplement and to prevent the nerve damage. It acts as coenzyme and Cofactor in carbohydrate (stored as energy in the liver and muscles), amino acid and fat metabolism. Pyridoxine is also necessary for the for the conversion of tryptophan to vitamin B3, niacin. It acts for the production of blood cells and antibodies.. Molecular compounds of Pyridoxine. ...
Pyridoxal 5′ phosphate Archives - Nootropic SourcePyridoxal 5′ phosphate Archives - Nootropic Source
What is P-5-P Powder (Vitamin b6) Pyridoxal 5′ phosphate (PLP), otherwise known as P5P, can be found in supplement form as an alternative to taking B6 (pyridoxine). In a healthy…. ...
How Pyridoxine hydrochloride (Vitamin B6) works for bodybuildersHow Pyridoxine hydrochloride (Vitamin B6) works for bodybuilders
Pyridoxal Hydrochloride(65-22-5),also called vitamin B6 is a water-soluble vitamin commonly found in foods. It is usually taken by injection, orally or in food supplements.
PDXDC1 (pyridoxal dependent decarboxylase domain containing 1)PDXDC1 (pyridoxal dependent decarboxylase domain containing 1)
... , Authors: Dessen P. Published in: Atlas Genet Cytogenet Oncol Haematol.
August 2017 - Small-Molecule Inhibitors of Protein InteractionsAugust 2017 - Small-Molecule Inhibitors of Protein Interactions
Glutamate-1-semialdehyde-2,1-aminomutase (GSAM) catalyzes the isomerization of glutamate-1-semialdehyde (GSA) to 5-aminolevulinate (ALA) and is distributed in archaea, most bacteria and plants. of DAVA (Fig. 1 ?, step 2 2). The intermediate DAVA is definitely then produced accompanied by the formation of an internal aldimine between PLP and the active-site lysine part chain (Fig. 1 ?, step… Read more Glutamate-1-semialdehyde-2,1-aminomutase (GSAM) catalyzes the isomerization of glutamate-1-semialdehyde (GSA) to 5-aminolevulinate (ALA). ...
HPLC Methods for analysis of Pyridoxal - HELIX ChromatographyHPLC Methods for analysis of Pyridoxal - HELIX Chromatography
HELIX Chromatography is pioneering HPLC with new mixed-mode columns. Buy HPLC Columns from the manufacturer in Chicago. HPLC Methods for analysis of Pyridoxal
Pyridoxine - DrugBankPyridoxine - DrugBank
Pyridoxine is the 4-methanol form of vitamin B6, an important water-soluble vitamin that is naturally present in many foods. As its classification as a vitamin implies, Vitamin B6 (and pyridoxine) are essential nutrients required for normal functioning of many biological systems within the body. While many plants and microorganisms are able to synthesize pyridoxine through endogenous biological processes, animals must obtain it through their diet. More specifically, pyridoxine is converted to pyridoxal 5-phosphate in the body, which is an important coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, and aminolevulinic acid. Its important to note that Vitamin B6 is the collective term for a group of three related compounds, pyridoxine, pyridoxal, and pyridoxamine, and their phosphorylated derivatives, pyridoxine 5-phosphate, pyridoxal 5-phosphate and pyridoxamine 5-phosphate. Although all six of these compounds should technically be referred to as
Paula L Roeschs Research on D-serine dehydratase | CureHunterPaula L Roesch's Research on D-serine dehydratase | CureHunter
Take advantage of free CureHunter research engine access to explore the best drug and treatment options for any disease. Find out why thousands of doctors, pharma researchers and patient activists around the world use CureHunter every day ...
Douglas Labs Pyridoxal-5-Phosphate 50mg 100 CapsDouglas Labs Pyridoxal-5-Phosphate 50mg 100 Caps
Douglas Labs, Pyridoxal-5-Phosphate 50mg, P5P, Vitamin B6, neurotransmitters, emotional response, pain perception, and anxiety, cardiovascular health, vitamin b
iHerb.com - Customer Reviews -Thorne Research, Pyridoxal 5-Phosphate, 180 Vegetarian CapsulesiHerb.com - Customer Reviews -Thorne Research, Pyridoxal 5'-Phosphate, 180 Vegetarian Capsules
I love Thorne products and P-5-P is an activated form of B6 and highly absorbable. I used to take a ionic P-5-P prescribed by my doctor as I have a condition which depletes my body in zinc and B6. This ionic vitamin had to be refrigerated and since I spend a good portion of my time traveling I was keen to find a stable source of good quality. This is it! I love Thorne products and this products really works for me. B6 is necessary for the synthesis of serotonin and dopamine (feel good hormones) as well as triptophan. Also highly important for digestion and so on. I highly recommend this product! ...
Vitamin B6 | Doctors HospitalVitamin B6 | Doctors Hospital
Learn more about Vitamin B6 at Doctors Hospital of Augusta Supplement Forms/Alternate Names Pyridoxine Pyridoxine Hydrochloride Pyridoxal-5-Phosphate Uses Principal...
Vitamin B6 | Doctors HospitalVitamin B6 | Doctors Hospital
Learn more about Vitamin B6 at Doctors Hospital of Augusta Supplement Forms/Alternate Names Pyridoxine Pyridoxine Hydrochloride Pyridoxal-5-Phosphate Uses Principal...
Vitamin B6 | Memorial HospitalVitamin B6 | Memorial Hospital
Learn more about Vitamin B6 at Memorial Hospital Supplement Forms/Alternate Names Pyridoxine Pyridoxine Hydrochloride Pyridoxal-5-Phosphate Uses Principal...
Source Naturals Coenzymated Sublinguals - Source Naturals - Coenzymated B-6 Sublingual 25mg - 60 tabsSource Naturals Coenzymated Sublinguals - Source Naturals - Coenzymated B-6 Sublingual 25mg - 60 tabs
Coenzymated B-6 Pyridoxal-5-Phosphate Tablets In order for vitamins to be utilized by the body, they must first be converted into their active coenzyme forms. This more potent Coenzymated B-6 is in its active form and ready to go to work immediately. Pyridoxal-5-Phosphate (PLP or P-5-P) is the main metabolically active coenzyme form of vitamin B-6. It is primarily in the liver that P-5-P is synthesized from pyridoxine, with the help of enzymes that require B-2, zinc and magnesium for their activity. P-5-P activates over 100 enzymes, many of which are involved in the conversion of amino acids into the neurotransmitters dopamine, norepinephrine and serotonin. P-5-P is also required for the synthesis of the hemoglobin molecule and plays an important role in regulating homocysteine levels. The Benefits of Coenzymated Sublingual Vitamins Coenzymated sublingual B-6 goes directly into your bloodstream in its active form. This avoids the loss that may occur not only during digestion, but during
Pharmaceutical Composition Free From Dexpanthenol, Calcium Ions, and Phosphate and Use of Calcium Chelating Agent and...Pharmaceutical Composition Free From Dexpanthenol, Calcium Ions, and Phosphate and Use of Calcium Chelating Agent and...
TABLE-US-00006 TABLE 1 Result of calcification and healing Severity of the Calcification Run Cornea Type of calci- occurred Healing no. no. exposure fication (≧1) [%] 1 HH1 medium 1 yes 49.7 1 HH2 phosphate- 0 no 89.8 free 1 HH3 phosphate- 4 yes 22 containing 2 HH7 medium 4 yes 97.8 2 HH8 phosphate- 0 no 100 free 2 HH9 phosphate- 3 yes 92 containing 3 HH13 medium 3 yes n.d. 3 HH16 phosphate- 4 yes n.d. free 3 HH17 phosphate- 0 no 94.8 containing Explanation of the table: 1 n.d.: not determined. 2 The details of the healing in % indicates the size of the healed area relative to the original area of the corneal injury. 3 The strength of the calcification was indicated by means of the value numbers 1 to 5, the assessment taking place with the naked eye and the value numbers standing for the following assessments: 0: no sclerotic phenomena 1: first scleroses are discernible with the naked eye 2: slight sclerosis 3: medium severe sclerosis 4: severe sclerosis 5: complete sclerosis ...
SWISS-MODEL Repository | A0RTP4SWISS-MODEL Repository | A0RTP4
SWISS-MODEL Repository entry for A0RTP4 (PDXT_CENSY), Pyridoxal 5-phosphate synthase subunit PdxT. Cenarchaeum symbiosum (strain A)
Anti-inosine 5-phosphate dehydrogenase 2 Antibody Products from Novus Biologicals | BiocompareAnti-inosine 5'-phosphate dehydrogenase 2 Antibody Products from Novus Biologicals | Biocompare
Compare Anti-inosine 5-phosphate dehydrogenase 2 Antibody Products from Novus Biologicals from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
O-Phosphoséryl-ARNt:sélénocystéinyl-ARNt synthase - WikipédiaO-Phosphoséryl-ARNt:sélénocystéinyl-ARNt synthase - Wikipédia
Cette enzyme utilise le phosphate de pyridoxal comme cofacteur[2]. Chez les archées et les eucaryotes, la formation du sélénocystéinyl-ARNtSec se déroule en effet en deux étapes[3],[4],[5] : la O-phosphoséryl-ARNtSec kinase catalyse tout dabord la phosphorylation dun L-séryl-ARNtSec en O-phosphoL-séryl-ARNtSec, lequel est ensuite converti en L-sélénocystéinyl-ARNtSec par la O-phosphoséryl-ARNt:sélénocystéinyl-ARNt synthase. ...
INT267091 - wiki-painINT267091 - wiki-pain
Enhanced migration into the cortex induced by P2X receptor blockade during OGD was also suggested by cell spreading observed by DCX immunofluorescence 24 hours after PPADS/OGD treatment (Figure 3A ...
组氨酸脱羧酶 - 维基百科，自由的百科全书组氨酸脱羧酶 - 维基百科，自由的百科全书
在人体中，组氨酸脱羧酶由HDC基因编码。[4][5]. 生物胺组织胺在许多生理过程中有重要的调节作用，包括神经传递、胃酸分泌、平滑肌舒张。从组氨酸到组织胺的生物合成由L-组氨酸脱羧酶催化。这个同源二聚体酶是一个依赖磷酸吡哆醛（PLP）的脱羧酶，并对其底物组氨酸有高度特异性。[4]. ...
ZwitterionZwitterion
Branched-chain amino acid aminotransferaseBranched-chain amino acid aminotransferase
List of micronutrientsList of micronutrients
Cys/Met metabolism PLP-dependent enzyme familyCys/Met metabolism PLP-dependent enzyme family
Histidine decarboxylaseHistidine decarboxylase
Cystathionine beta-lyaseCystathionine beta-lyase
Acetylornithine transaminaseAcetylornithine transaminase
Beta-alanine-pyruvate transaminaseBeta-alanine-pyruvate transaminase
Asparagine-oxo-acid transaminaseAsparagine-oxo-acid transaminase
Adenosylmethionine-8-amino-7-oxononanoate transaminaseAdenosylmethionine-8-amino-7-oxononanoate transaminase
L-seryl-tRNASec selenium transferaseL-seryl-tRNASec selenium transferase
Threonine aldolaseThreonine aldolase
5-aminovalerate transaminase5-aminovalerate transaminase
Selenocysteine lyaseSelenocysteine lyase
D-amino-acid transaminaseD-amino-acid transaminase
Aminobenzoate decarboxylaseAminobenzoate decarboxylase
Succinyldiaminopimelate transaminaseSuccinyldiaminopimelate transaminase
3-chloro-D-alanine dehydrochlorinase3-chloro-D-alanine dehydrochlorinase
Serine C-palmitoyltransferaseSerine C-palmitoyltransferase
Phenylalanine decarboxylasePhenylalanine decarboxylase
Arginine racemaseArginine racemase
DTDP-4-amino-4,6-dideoxy-D-glucose transaminaseDTDP-4-amino-4,6-dideoxy-D-glucose transaminase
Glutamine-scyllo-inositol transaminaseGlutamine-scyllo-inositol transaminase
Vitamin B6Vitamin B6
Glutamate-1-semialdehyde 2,1-aminomutaseGlutamate-1-semialdehyde 2,1-aminomutase
Aminolevulinate transaminaseAminolevulinate transaminase
Amino-acid racemaseAmino-acid racemase
Glycine C-acetyltransferaseGlycine C-acetyltransferase
Taurine-2-oxoglutarate transaminaseTaurine-2-oxoglutarate transaminase
Tyrosine phenol-lyaseTyrosine phenol-lyase
டோம்பரிடோன் - தமிழ் விக்கிப்பீடியாடோம்பரிடோன் - தமிழ் விக்கிப்பீடியா
Glycogen phosphorylaseGlycogen phosphorylase
Vitamin CVitamin C
AKR1B1AKR1B1
RiboflavinRiboflavin
Diferència entre revisions de la pàgina «Cofactor enzimàtic» - Viquipèdia, lenciclopèdia lliureDiferència entre revisions de la pàgina «Cofactor enzimàtic» - Viquipèdia, l'enciclopèdia lliure
TheanineTheanine
Fitamine B6 - WikipedyFitamine B6 - Wikipedy
FolateFolate
OxidoreductaseOxidoreductase
টেমপ্লেট:ভিটামিন - উইকিপিডিয়াটেমপ্লেট:ভিটামিন - উইকিপিডিয়া
Glutamate decarboxylaseGlutamate decarboxylase
5,10-Methylenetetrahydrofolate5,10-Methylenetetrahydrofolate
TorcetrapibTorcetrapib
MelatoninMelatonin
gamma-Tocopherolgamma-Tocopherol
B vitaminsB vitamins
CholecalciferolCholecalciferol
Dehydroascorbic acidDehydroascorbic acid
साँचा:Serotonergics - विकिपीडियासाँचा:Serotonergics - विकिपीडिया
Citric acid cycleCitric acid cycle
Natural productNatural product
GlycineGlycine
Bitamina C, ang malayang ensiklopedyaBitamina C, ang malayang ensiklopedya
CiclosporinCiclosporin
ATC code C10ATC code C10
KynureninaseKynureninase
SerineSerine
AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsTechnology, Industry, AgricultureInformation Science
Pyridoxal PhosphatePyridoxalPyridoxal KinasePyridoxinePyridoxaminePhosphatesVitamin B 6 DeficiencyBorohydridesTransaminasesTryptophan SynthaseAspartate AminotransferasesApoenzymesPyridoxaminephosphate OxidaseVitamin B 6LyasesKineticsGlycine HydroxymethyltransferaseSchiff BasesPhosphorylasesD-Alanine TransaminasePyridoxic AcidL-Serine DehydrataseTyrosine Phenol-LyaseSpectrophotometryCarboxy-LyasesOrnithine-Oxo-Acid TransaminaseBinding SitesSemicarbazidesIminesEscherichia coliCalcium PhosphatesSpectrophotometry, UltravioletTyrosine DecarboxylaseHydrogen-Ion ConcentrationGlucose-6-PhosphateGlyceraldehyde-3-Phosphate DehydrogenasesAldehydesSugar PhosphatesHemoglobin C DiseaseTryptophanaseLysinePhosphorylase bPimelic AcidsCysteine SynthaseCystathionine beta-SynthaseSubstrate Specificity5-Aminolevulinate SynthetasePlants, EdibleAmino Acid SequenceAmino AcidsMolecular Sequence DataCoenzymesAnemia, SideroblasticSkin CreamErythrocytesDimercaprol4-Aminobutyrate TransaminaseDialysisAminooxyacetic AcidCatalysisProtein BindingTyrosine TransaminaseChemistryBoratesChemical PhenomenaPQQ CofactorGlyceraldehyde 3-PhosphateThreonine DehydrataseInositol PhosphatesHydroxylaminesLiverMagnetic Resonance SpectroscopyTransferasesMolecular WeightProtein ConformationAlanine TransaminaseAdenosine TriphosphateSerineSpectrometry, FluorescenceChromatography, High Pressure LiquidGlucosephosphate DehydrogenaseSwineSickle Cell TraitSpectrum AnalysisPentose Phosphate PathwayCysteineOrnithineAdenosine MonophosphateCytosine NucleotidesPicolinesOrnithine DecarboxylaseGlycineModels, MolecularDihydroxyacetone PhosphateVitamin B ComplexElectrophoresis, Polyacrylamide GelGlucosephosphatesCyanidesPhosphate Transport ProteinsCircular DichroismStereoisomerismHistidineMacromolecular SubstancesHomocysteinePurinergic P2 Receptor AntagonistsGlucose-6-Phosphate IsomeraseMutationTryptophanRibosemonophosphatesBase SequenceAlanineRecombinant ProteinsSulfhydryl ReagentsChromatographyStructure-Activity RelationshipCloning, Molecular
Pyridoxal Phosphate Ying An - Drugs.comPyridoxal Phosphate Ying An - Drugs.com
Pyridoxal- 5-phosphate monohydrate | AbcamPyridoxal- 5'-phosphate monohydrate | Abcam
Pyridoxal 5-phosphate | 41468-25-1Pyridoxal 5'-phosphate | 41468-25-1
Studies on the changes in protein fluorescence and enzymic activity of aspartate aminotransferase on binding of pyridoxal 5′...Studies on the changes in protein fluorescence and enzymic activity of aspartate aminotransferase on binding of pyridoxal 5′...
Pyridoxal phosphate (P5P)Pyridoxal phosphate (P5P)
L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate - L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate Exporter,...L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate - L-methylfolate+Methylcobalamin+Pyridoxal 5-phosphate Exporter,...
Use of Chlorite to Improve HPLC Detection of Pyridoxal 5-phosphate by Karen L. Ericson, J. D. Mahuren et al."Use of Chlorite to Improve HPLC Detection of Pyridoxal 5'-phosphate" by Karen L. Ericson, J. D. Mahuren et al.
TIGR01437TIGR01437
Diferència entre revisions de la pàgina «Cofactor enzimàtic» - Viquipèdia, lenciclopèdia lliureDiferència entre revisions de la pàgina «Cofactor enzimàtic» - Viquipèdia, l'enciclopèdia lliure
Publications | CBCBPublications | CBCB
GADL1 (glutamate decarboxylase like 1) - Chinchilla Research Resource DatabaseGADL1 (glutamate decarboxylase like 1) - Chinchilla Research Resource Database
Pyridoxal phosphate - WikipediaPyridoxal phosphate - Wikipedia
Magnesium pyridoxal 5-phosphate glutamate - WikipediaMagnesium pyridoxal 5-phosphate glutamate - Wikipedia
Pyridoxal 5-phosphate-dependent epilepsy: MedlinePlus GeneticsPyridoxal 5'-phosphate-dependent epilepsy: MedlinePlus Genetics
Pyridoxal phosphate-dependent decarboxylase (IPR002129) | InterPro | EMBL-EBIPyridoxal phosphate-dependent decarboxylase (IPR002129) | InterPro | EMBL-EBI
Alanine racemase, pyridoxal-phosphate attachment site (IPR020622) | InterPro | EMBL-EBIAlanine racemase, pyridoxal-phosphate attachment site (IPR020622) | InterPro | EMBL-EBI
Melatonin-Pyridoxal Phosphate Sublingual : Uses, Side Effects, Interactions, Pictures, Warnings & Dosing - WebMDMelatonin-Pyridoxal Phosphate Sublingual : Uses, Side Effects, Interactions, Pictures, Warnings & Dosing - WebMD
Pyridoxal-5 Phosphate Oral : Uses, Side Effects, Interactions, Pictures, Warnings & Dosing - WebMDPyridoxal-5 Phosphate Oral : Uses, Side Effects, Interactions, Pictures, Warnings & Dosing - WebMD
RCSB PDB - 2OYC: Crystal structure of human pyridoxal phosphate phosphataseRCSB PDB - 2OYC: Crystal structure of human pyridoxal phosphate phosphatase
Pyridoxal 5-(dihydrogen phosphate) - Substance Information - ECHAPyridoxal 5'-(dihydrogen phosphate) - Substance Information - ECHA
Pyridoxal Phosphate | Harvard Catalyst Profiles | Harvard CatalystPyridoxal Phosphate | Harvard Catalyst Profiles | Harvard Catalyst
iHerb.com - Customer Reviews -Thorne Research, Pyridoxal 5-Phosphate, 180 Vegetarian CapsulesiHerb.com - Customer Reviews -Thorne Research, Pyridoxal 5'-Phosphate, 180 Vegetarian Capsules
Pyridoxal-5-Phosphate - 90 TabletsPyridoxal-5-Phosphate - 90 Tablets
Ralphs - Vitacost Synergy P-5-P Pyridoxal-5-Phosphate, 50 mg - 100 TabletsRalphs - Vitacost Synergy P-5-P Pyridoxal-5-Phosphate, 50 mg - 100 Tablets
Pyridoxal-5-Phosphate from Nutri | WWSMPyridoxal-5-Phosphate from Nutri | WWSM
Douglas Labs Pyridoxal-5-Phosphate 60cDouglas Labs Pyridoxal-5-Phosphate 60c
Country Life, P-5-P (Pyridoxal 5 Phosphate), 50 mg, 100 Tablets - iHerb.comCountry Life, P-5-P (Pyridoxal 5' Phosphate), 50 mg, 100 Tablets - iHerb.com
pdxT - Pyridoxal 5-phosphate synthase subunit PdxT - Staphylococcus carnosus (strain TM300) - pdxT gene & proteinpdxT - Pyridoxal 5'-phosphate synthase subunit PdxT - Staphylococcus carnosus (strain TM300) - pdxT gene & protein
Pyridoxal-5-Phosphate 60c by Douglas LaboratoriesPyridoxal-5-Phosphate 60c by Douglas Laboratories
BioCoenzymated™ Pyridoxal 5- phosphate B6 | Natural FactorsBioCoenzymated™ Pyridoxal 5'- phosphate B6 | Natural Factors
BioCoenzymated™ Pyridoxal 5-phosphate | Natural Factors USABioCoenzymated™ Pyridoxal 5'-phosphate | Natural Factors USA
RCSB PDB - 1GEW: CRYSTAL STRUCTURE OF HISTIDINOL-PHOSPHATE AMINOTRANSFERASE COMPLEXED WITH PYRIDOXAL 5-PHOSPHATE...RCSB PDB - 1GEW: CRYSTAL STRUCTURE OF HISTIDINOL-PHOSPHATE AMINOTRANSFERASE COMPLEXED WITH PYRIDOXAL 5'-PHOSPHATE...
Pyridoxal Phosphate - Pyridoxal 5 Phosphate Summary Report | CureHunterPyridoxal Phosphate - Pyridoxal 5 Phosphate Summary Report | CureHunter
Trial on Treatment of Patients With Primary Hyperoxaluria Type I With Pyridoxal-phosphate - Full Text View - ClinicalTrials.govTrial on Treatment of Patients With Primary Hyperoxaluria Type I With Pyridoxal-phosphate - Full Text View - ClinicalTrials.gov
pdxS - Pyridoxal 5-phosphate synthase subunit PdxS - Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) - pdxS gene &...pdxS - Pyridoxal 5'-phosphate synthase subunit PdxS - Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) - pdxS gene &...
Pyridoxine or pyridoxal-5′-phosphate for neonatal epilepsy | NeurologyPyridoxine or pyridoxal-5′-phosphate for neonatal epilepsy | Neurology
FoodScience of Vermont Pyridoxal 5-Phosphate - 60 VCapsules Customer Reviews - eVitamins IndiaFoodScience of Vermont Pyridoxal 5-Phosphate - 60 VCapsules Customer Reviews - eVitamins India
Prostaplex (Selenium (Selenium HVP Chelate); Vitamin B6 (Pyridoxal-5-Phosphate)...) Douglas LaboratoriesProstaplex (Selenium (Selenium HVP Chelate); Vitamin B6 (Pyridoxal-5-Phosphate)...) Douglas Laboratories
Plasma pyridoxal 5-phosphate in the US population: the National Health and Nutrition Examination Survey, 2003-2004Plasma pyridoxal 5'-phosphate in the US population: the National Health and Nutrition Examination Survey, 2003-2004
Human Metabolome Database: Showing metabocard for Pyridoxal 5-phosphate (HMDB0001491)Human Metabolome Database: Showing metabocard for Pyridoxal 5'-phosphate (HMDB0001491)
AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsTechnology, Industry, AgricultureInformation Science
Pyridoxal PhosphatePyridoxalPyridoxal KinasePyridoxinePyridoxaminePhosphatesVitamin B 6 DeficiencyBorohydridesTransaminasesTryptophan SynthaseAspartate AminotransferasesApoenzymesPyridoxaminephosphate OxidaseVitamin B 6LyasesKineticsGlycine HydroxymethyltransferaseSchiff BasesPhosphorylasesD-Alanine TransaminasePyridoxic AcidL-Serine DehydrataseTyrosine Phenol-LyaseSpectrophotometryCarboxy-LyasesOrnithine-Oxo-Acid TransaminaseBinding SitesSemicarbazidesIminesEscherichia coliCalcium PhosphatesSpectrophotometry, UltravioletTyrosine DecarboxylaseHydrogen-Ion ConcentrationGlucose-6-PhosphateGlyceraldehyde-3-Phosphate DehydrogenasesAldehydesSugar PhosphatesHemoglobin C DiseaseTryptophanaseLysinePhosphorylase bPimelic AcidsCysteine SynthaseCystathionine beta-SynthaseSubstrate Specificity5-Aminolevulinate SynthetasePlants, EdibleAmino Acid SequenceAmino AcidsMolecular Sequence DataCoenzymesAnemia, SideroblasticSkin CreamErythrocytesDimercaprol4-Aminobutyrate TransaminaseDialysisAminooxyacetic AcidCatalysisProtein BindingTyrosine TransaminaseChemistryBoratesChemical PhenomenaPQQ CofactorGlyceraldehyde 3-PhosphateThreonine DehydrataseInositol PhosphatesHydroxylaminesLiverMagnetic Resonance SpectroscopyTransferasesMolecular WeightProtein ConformationAlanine TransaminaseAdenosine TriphosphateSerineSpectrometry, FluorescenceChromatography, High Pressure LiquidGlucosephosphate DehydrogenaseSwineSickle Cell TraitSpectrum AnalysisPentose Phosphate PathwayCysteineOrnithineAdenosine MonophosphateCytosine NucleotidesPicolinesOrnithine DecarboxylaseGlycineModels, MolecularDihydroxyacetone PhosphateVitamin B ComplexElectrophoresis, Polyacrylamide GelGlucosephosphatesCyanidesPhosphate Transport ProteinsCircular DichroismStereoisomerismHistidineMacromolecular SubstancesHomocysteinePurinergic P2 Receptor AntagonistsGlucose-6-Phosphate IsomeraseMutationTryptophanRibosemonophosphatesBase SequenceAlanineRecombinant ProteinsSulfhydryl ReagentsChromatographyStructure-Activity RelationshipCloning, Molecular
TabletsLevels of pyridoxal phosphateBiologically active formSeizuresEpilepsyMagnesiumOxidaseAbstractComparison of pyridoxalDerivativesPlasma pyridoxalIntracellularRibose 5-phosphaFormDouglas LabsDependentVcapsDrugsNutriSerine25mgIngredientsGenesMetabolicAminoAssay
Tablets3
Levels of pyridoxal phosphate1
Biologically active form2
Seizures4
Epilepsy5
Magnesium5
Oxidase6
Abstract1
Comparison of pyridoxal1
Derivatives6
Plasma pyridoxal2
Intracellular4
Ribose 5-phospha3
Form12
Douglas Labs1
Dependent7
  • Pyridoxal phosphate-dependent neonatal epileptic encephalopathy. (medlineplus.gov)
  • A number of pyridoxal-dependent decarboxylases share regions of sequence similarity, particularly in the vicinity of a conserved lysine residue, which provides the attachment site for the pyridoxal-phosphate (PLP) group [ PMID: 8181483 , PMID: 2124279 ]. (ebi.ac.uk)
  • Multiple evolutionary origin of pyridoxal-5'-phosphate-dependent amino acid decarboxylases. (ebi.ac.uk)
  • Prokaryotic and eukaryotic pyridoxal-dependent decarboxylases are homologous. (ebi.ac.uk)
  • Alanine racemase catalyses the pyridoxal-dependent conversion of L-alanine into D-alanine, a key component of bacterial peptidoglycan [ PMID: 2197992 ]. (ebi.ac.uk)
  • Stereochemical studies of three pyridoxal phosphate dependent decarboxylases and serine hydroxymethyltransferase have allowed the dispositions of conjugate acids that operate at the C α and C-4'positions of intermediate quinoids to be determined. (royalsocietypublishing.org)
  • This model for the active site of a pyridoxal dependent decarboxylase was consistent with all available stereochemical and mechanistic data. (royalsocietypublishing.org)
Vcaps2
Drugs1
  • This seizure-like swimming pattern was alleviated by the addition of either pyridoxal-5'-phosphate (PLP) or GABA and responded quickly to the anti-convulsing activity of gabapentin and phenytoin, two commonly prescribed anti-epileptic drugs (AEDs). (biologists.org)
Nutri2
Serine1
25mg1
Ingredients1
Genes1
  • In this study, we describe the discovery of three serendipitous pathways that allow synthesis of pyridoxal‐5′‐phosphate (PLP) in a strain of E. coli that lacks 4‐phosphoerythronate (4PE) dehydrogenase (PdxB) when one of seven different genes is overexpressed. (embopress.org)
Metabolic1
Amino2
Assay1
Pyridoxal phosphate (P5P)
Pyridoxal phosphate (P5P) (flipper.diff.org)
GADL1 (glutamate decarboxylase like 1) - Chinchilla Research Resource Database
GADL1 (glutamate decarboxylase like 1) - Chinchilla Research Resource Database (crrd.mcw.edu)
PNPO gene: MedlinePlus Genetics
PNPO gene: MedlinePlus Genetics (medlineplus.gov)
Pyridoxal 5'-(dihydrogen phosphate) - Substance Information - ECHA
Pyridoxal 5'-(dihydrogen phosphate) - Substance Information - ECHA (echa.europa.eu)
IUCr) Acta Crystallographica Section B Volume 25, Part 4, April 1969
IUCr) Acta Crystallographica Section B Volume 25, Part 4, April 1969 (journals.iucr.org)
Autocatalytic sets in E. coli metabolism | SpringerLink
Autocatalytic sets in E. coli metabolism | SpringerLink (link.springer.com)
Vitamin B12 (Dibencozide) | Health Benefits and Uses of Vitamin B12
Vitamin B12 (Dibencozide) | Health Benefits and Uses of Vitamin B12 (xtend-life.com)
Structural and functional characterization of aspartate racemase from the acidothermophilic archaeon Picrophilus torridus |...
Structural and functional characterization of aspartate racemase from the acidothermophilic archaeon Picrophilus torridus |... (link.springer.com)
Alkaline Phosphatases | SpringerLink
Alkaline Phosphatases | SpringerLink (link.springer.com)
Vitamin B6 Deficiency Symptoms: Natural Uses for Vitamain B6 in Humans | Natural Remedies.org
Vitamin B6 Deficiency Symptoms: Natural Uses for Vitamain B6 in Humans | Natural Remedies.org (naturalremedies.org)
BioCoenzymated™ Pyridoxal 5'-phosphate | Natural Factors USA
BioCoenzymated™ Pyridoxal 5'-phosphate | Natural Factors USA (naturalfactors.com)
Epilepsies in infancy | Archives of Disease in Childhood
Epilepsies in infancy | Archives of Disease in Childhood (adc.bmj.com)
Gyrate Atrophy of the Choroid and Retina - Full Text View - ClinicalTrials.gov
Gyrate Atrophy of the Choroid and Retina - Full Text View - ClinicalTrials.gov (clinicaltrials.gov)
BioCoenzymated™ Pyridoxal 5'- phosphate B6 | Natural Factors
BioCoenzymated™ Pyridoxal 5'- phosphate B6 | Natural Factors (naturalfactors.com)
RCSB PDB - 4ZLV: Crystal structure of the ornithine aminotransferase from Toxoplasma gondii ME49 in a complex with the Schiff...
RCSB PDB - 4ZLV: Crystal structure of the ornithine aminotransferase from Toxoplasma gondii ME49 in a complex with the Schiff... (rcsb.org)
Federal Register :: Pharmacy Compounding Advisory Committee; Notice of Meeting; Establishment of a Public Docket;...
Federal Register :: Pharmacy Compounding Advisory Committee; Notice of Meeting; Establishment of a Public Docket;... (federalregister.gov)
Diclegis (Doxylamine Succinate and Pyridoxine Hydrochloride Delayed-release Tablets): Side Effects, Interactions, Warning,...
Diclegis (Doxylamine Succinate and Pyridoxine Hydrochloride Delayed-release Tablets): Side Effects, Interactions, Warning,... (rxlist.com)
Nutritional Programs for Pre- and Postsurgery (and Injuries) - Healthy.net
Nutritional Programs for Pre- and Postsurgery (and Injuries) - Healthy.net (healthy.net)
Jasainfusmedan - Instagram photos and videos | WEBSTAGRAM
Jasainfusmedan - Instagram photos and videos | WEBSTAGRAM (web.stagram.com)
Biochemical properties of a Pseudomonas aminotransferase involved in caprolactam metabolism - Research database - University of...
Biochemical properties of a Pseudomonas aminotransferase involved in caprolactam metabolism - Research database - University of... (rug.nl)
Appendix C: Abbreviations | Emerging Technologies for Nutrition Research: Potential for Assessing Military Performance...
Appendix C: Abbreviations | Emerging Technologies for Nutrition Research: Potential for Assessing Military Performance... (nap.edu)