A group of compounds containing the porphin structure, four pyrrole rings connected by methine bridges in a cyclic configuration to which a variety of side chains are attached. The nature of the side chain is indicated by a prefix, as uroporphyrin, hematoporphyrin, etc. The porphyrins, in combination with iron, form the heme component in biologically significant compounds such as hemoglobin and myoglobin.
Transforming proteins coded by sis oncogenes. Transformation of cells by v-sis is related to its interaction with the PDGF receptor and also its ability to alter other transcription factors.
The GENETIC TRANSLATION product from a GENE FUSION between a sequence from the tpr protein gene on the human CHROMOSOME 1 and the gene for PROTO-ONCOGENE PROTEINS C-MET.
An oncogene protein that was originally isolated from a spontaneous musculo-aponeurotic FIBROSARCOMA in CHICKEN and shown to be the transforming gene of the avian retrovirus AS42. It is a basic leucine zipper TRANSCRIPTION FACTOR and the founding member of the MAF TRANSCRIPTION FACTORS.
Transforming glycoprotein coded by the fms oncogene from the Susan McDonough strain of feline sarcoma virus (SM-FeSV). The oncogene protein v-fms lacks sequences, which, in the highly homologous proto-oncogene protein c-fms (CSF-1 receptor), normally serve to regulate its tyrosine kinase activity. The missing sequences in v-fms mimic the effect of ligand and lead to constitutive cell growth. The protein gp120(v-fms) is post-translationally modified to generate gp140(v-fms).
Transforming proteins coded by mos oncogenes. The v-mos proteins were originally isolated from the Moloney murine sarcoma virus (Mo-MSV).
Transforming protein coded by myc oncogenes. The v-myc protein has been found in several replication-defective avian retrovirus isolates which induce a broad spectrum of malignancies.
Transforming protein coded by jun oncogenes (GENES, JUN). This is a gag-onc fusion protein of about 65 kDa derived from avian sarcoma virus. v-jun lacks a negative regulatory domain that regulates transcription in c-jun.
A family of transforming proteins isolated from retroviruses such as MOUSE SARCOMA VIRUSES. They are viral-derived members of the raf-kinase family of serine-theonine kinases.
Transforming proteins coded by fos oncogenes. These proteins have been found in the Finkel-Biskis-Jinkins (FBJ-MSV) and Finkel-Biskis-Reilly (FBR-MSV) murine sarcoma viruses which induce osteogenic sarcomas in mice. The FBJ-MSV v-fos gene encodes a p55-kDa protein and the FBR-MSV v-fos gene encodes a p75-kDa fusion protein.
A signal transducing adaptor protein that is encoded by the crk ONCOGENE from TYPE C AVIAN RETROVIRUSES. It contains SRC HOMOLOGY DOMAINS and is closely related to its cellular homolog, PROTO-ONCOGENE PROTEIN C-CRK.
Transforming proteins coded by myb oncogenes. Transformation of cells by v-myb in conjunction with v-ets is seen in the avian E26 leukemia virus.
An oncoprotein from the Cas NS-1 murine retrovirus that induces pre- B-CELL LYMPHOMA and MYELOID LEUKEMIAS. v-cbl protein is a tyrosine-phosphorylated, truncated form of its cellular homologue, PROTO-ONCOGENE PROTEIN C-CBL.
Transforming proteins encoded by erbB oncogenes from the avian erythroblastosis virus. The protein is a truncated form of the EGF receptor (RECEPTOR, EPIDERMAL GROWTH FACTOR) whose kinase domain is constitutively activated by deletion of the ligand-binding domain.
Transforming proteins encoded by the abl oncogenes. Oncogenic transformation of c-abl to v-abl occurs by insertional activation that results in deletions of specific N-terminal amino acids.
Genes whose gain-of-function alterations lead to NEOPLASTIC CELL TRANSFORMATION. They include, for example, genes for activators or stimulators of CELL PROLIFERATION such as growth factors, growth factor receptors, protein kinases, signal transducers, nuclear phosphoproteins, and transcription factors. A prefix of "v-" before oncogene symbols indicates oncogenes captured and transmitted by RETROVIRUSES; the prefix "c-" before the gene symbol of an oncogene indicates it is the cellular homolog (PROTO-ONCOGENES) of a v-oncogene.
Transforming proteins coded by rel oncogenes. The v-rel protein competes with rel-related proteins and probably transforms cells by acting as a dominant negative version of c-rel. This results in the induction of a broad range of leukemias and lymphomas.
Transforming proteins encoded by erbA oncogenes from the avian erythroblastosis virus. They are truncated versions of c-erbA, the thyroid hormone receptor (RECEPTORS, THYROID HORMONE) that have retained both the DNA-binding and hormone-binding domains. Mutations in the hormone-binding domains abolish the transcriptional activation function. v-erbA acts as a dominant repressor of c-erbA, inducing transformation by disinhibiting proliferation.
Proteins coded by oncogenes. They include proteins resulting from the fusion of an oncogene and another gene (ONCOGENE PROTEINS, FUSION).
Transforming protein encoded by ras oncogenes. Point mutations in the cellular ras gene (c-ras) can also result in a mutant p21 protein that can transform mammalian cells. Oncogene protein p21(ras) has been directly implicated in human neoplasms, perhaps accounting for as much as 15-20% of all human tumors. This enzyme was formerly listed as EC 3.6.1.47.
A tyrosine-specific protein kinase encoded by the v-src oncogene of ROUS SARCOMA VIRUS. The transforming activity of pp60(v-src) depends on both the lack of a critical carboxy-terminal tyrosine phosphorylation site at position 527, and the attachment of pp60(v-src) to the plasma membrane which is accomplished by myristylation of its N-terminal glycine.
Products of viral oncogenes, most commonly retroviral oncogenes. They usually have transforming and often protein kinase activities.
The GENETIC TRANSLATION products of the fusion between an ONCOGENE and another gene. The latter may be of viral or cellular origin.
Family of retrovirus-associated DNA sequences (ras) originally isolated from Harvey (H-ras, Ha-ras, rasH) and Kirsten (K-ras, Ki-ras, rasK) murine sarcoma viruses. Ras genes are widely conserved among animal species and sequences corresponding to both H-ras and K-ras genes have been detected in human, avian, murine, and non-vertebrate genomes. The closely related N-ras gene has been detected in human neuroblastoma and sarcoma cell lines. All genes of the family have a similar exon-intron structure and each encodes a p21 protein.
A viral oncoprotein originally isolated from a murine T CELL LYMPHOMA infected with the acutely transforming retrovirus AKT8. v-akt protein is the viral homologue of PROTO-ONCOGENE PROTEINS C-AKT.
Cell changes manifested by escape from control mechanisms, increased growth potential, alterations in the cell surface, karyotypic abnormalities, morphological and biochemical deviations from the norm, and other attributes conferring the ability to invade, metastasize, and kill.
Normal cellular genes homologous to viral oncogenes. The products of proto-oncogenes are important regulators of biological processes and appear to be involved in the events that serve to maintain the ordered procession through the cell cycle. Proto-oncogenes have names of the form c-onc.
Products of proto-oncogenes. Normally they do not have oncogenic or transforming properties, but are involved in the regulation or differentiation of cell growth. They often have protein kinase activity.
Family of retrovirus-associated DNA sequences (myc) originally isolated from an avian myelocytomatosis virus. The proto-oncogene myc (c-myc) codes for a nuclear protein which is involved in nucleic acid metabolism and in mediating the cellular response to growth factors. Truncation of the first exon, which appears to regulate c-myc expression, is crucial for tumorigenicity. The human c-myc gene is located at 8q24 on the long arm of chromosome 8.
A selective increase in the number of copies of a gene coding for a specific protein without a proportional increase in other genes. It occurs naturally via the excision of a copy of the repeating sequence from the chromosome and its extrachromosomal replication in a plasmid, or via the production of an RNA transcript of the entire repeating sequence of ribosomal RNA followed by the reverse transcription of the molecule to produce an additional copy of the original DNA sequence. Laboratory techniques have been introduced for inducing disproportional replication by unequal crossing over, uptake of DNA from lysed cells, or generation of extrachromosomal sequences from rolling circle replication.
Cellular DNA-binding proteins encoded by the c-myc genes. They are normally involved in nucleic acid metabolism and in mediating the cellular response to growth factors. Elevated and deregulated (constitutive) expression of c-myc proteins can cause tumorigenesis.
Cellular proteins encoded by the H-ras, K-ras and N-ras genes. The proteins have GTPase activity and are involved in signal transduction as monomeric GTP-binding proteins. Elevated levels of p21 c-ras have been associated with neoplasia. This enzyme was formerly listed as EC 3.6.1.47.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in neoplastic tissue.
Retroviral proteins that have the ability to transform cells. They can induce sarcomas, leukemias, lymphomas, and mammary carcinomas. Not all retroviral proteins are oncogenic.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
An inheritable change in cells manifested by changes in cell division and growth and alterations in cell surface properties. It is induced by infection with a transforming virus.
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
Established cell cultures that have the potential to propagate indefinitely.
Eukaryotic cell line obtained in a quiescent or stationary phase which undergoes conversion to a state of unregulated growth in culture, resembling an in vitro tumor. It occurs spontaneously or through interaction with viruses, oncogenes, radiation, or drugs/chemicals.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A cell line derived from cultured tumor cells.
The erbB-2 gene is a proto-oncogene that codes for the erbB-2 receptor (RECEPTOR, ERBB-2), a protein with structural features similar to the epidermal growth factor receptor. Its name originates from the viral oncogene homolog (v-erbB) which is a truncated form of the chicken erbB gene found in the avian erythroblastosis virus. Overexpression and amplification of the gene is associated with a significant number of adenocarcinomas. The human c-erbB-2 gene is located at 17q21.2.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Cells grown in vitro from neoplastic tissue. If they can be established as a TUMOR CELL LINE, they can be propagated in cell culture indefinitely.
Small, monomeric GTP-binding proteins encoded by ras genes (GENES, RAS). The protooncogene-derived protein, PROTO-ONCOGENE PROTEIN P21(RAS), plays a role in normal cellular growth, differentiation and development. The oncogene-derived protein (ONCOGENE PROTEIN P21(RAS)) can play a role in aberrant cellular regulation during neoplastic cell transformation (CELL TRANSFORMATION, NEOPLASTIC). This enzyme was formerly listed as EC 3.6.1.47.
The fission of a CELL. It includes CYTOKINESIS, when the CYTOPLASM of a cell is divided, and CELL NUCLEUS DIVISION.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
The biosynthesis of RNA carried out on a template of DNA. The biosynthesis of DNA from an RNA template is called REVERSE TRANSCRIPTION.
DNA present in neoplastic tissue.
A cell surface protein-tyrosine kinase receptor that is overexpressed in a variety of ADENOCARCINOMAS. It has extensive homology to and heterodimerizes with the EGF RECEPTOR, the ERBB-3 RECEPTOR, and the ERBB-4 RECEPTOR. Activation of the erbB-2 receptor occurs through heterodimer formation with a ligand-bound erbB receptor family member.
A type of chromosome aberration characterized by CHROMOSOME BREAKAGE and transfer of the broken-off portion to another location, often to a different chromosome.
Cell lines whose original growing procedure consisted being transferred (T) every 3 days and plated at 300,000 cells per plate (J Cell Biol 17:299-313, 1963). Lines have been developed using several different strains of mice. Tissues are usually fibroblasts derived from mouse embryos but other types and sources have been developed as well. The 3T3 lines are valuable in vitro host systems for oncogenic virus transformation studies, since 3T3 cells possess a high sensitivity to CONTACT INHIBITION.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.
Mutant mice homozygous for the recessive gene "nude" which fail to develop a thymus. They are useful in tumor studies and studies on immune responses.
Proteins found in the nucleus of a cell. Do not confuse with NUCLEOPROTEINS which are proteins conjugated with nucleic acids, that are not necessarily present in the nucleus.
Endogenous substances, usually proteins, which are effective in the initiation, stimulation, or termination of the genetic transcription process.
Protein kinases that catalyze the PHOSPHORYLATION of TYROSINE residues in proteins with ATP or other nucleotides as phosphate donors.
Family of RNA viruses that infects birds and mammals and encodes the enzyme reverse transcriptase. The family contains seven genera: DELTARETROVIRUS; LENTIVIRUS; RETROVIRUSES TYPE B, MAMMALIAN; ALPHARETROVIRUS; GAMMARETROVIRUS; RETROVIRUSES TYPE D; and SPUMAVIRUS. A key feature of retrovirus biology is the synthesis of a DNA copy of the genome which is integrated into cellular DNA. After integration it is sometimes not expressed but maintained in a latent state (PROVIRUSES).
Laboratory mice that have been produced from a genetically manipulated EGG or EMBRYO, MAMMALIAN.
Proteins which bind to DNA. The family includes proteins which bind to both double- and single-stranded DNA and also includes specific DNA binding proteins in serum which can be used as markers for malignant diseases.
Nuclear phosphoprotein encoded by the p53 gene (GENES, P53) whose normal function is to control CELL PROLIFERATION and APOPTOSIS. A mutant or absent p53 protein has been found in LEUKEMIA; OSTEOSARCOMA; LUNG CANCER; and COLORECTAL CANCER.
Connective tissue cells which secrete an extracellular matrix rich in collagen and other macromolecules.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
The GENETIC RECOMBINATION of the parts of two or more GENES, including an ONCOGENE as at least one of the fusion partners. Such gene fusions are often detected in neoplastic cells and are transcribed into ONCOGENE FUSION PROTEINS.
Proteins whose abnormal expression (gain or loss) are associated with the development, growth, or progression of NEOPLASMS. Some neoplasm proteins are tumor antigens (ANTIGENS, NEOPLASM), i.e. they induce an immune reaction to their tumor. Many neoplasm proteins have been characterized and are used as tumor markers (BIOMARKERS, TUMOR) when they are detectable in cells and body fluids as monitors for the presence or growth of tumors. Abnormal expression of ONCOGENE PROTEINS is involved in neoplastic transformation, whereas the loss of expression of TUMOR SUPPRESSOR PROTEINS is involved with the loss of growth control and progression of the neoplasm.
All of the processes involved in increasing CELL NUMBER including CELL DIVISION.
Retrovirus-associated DNA sequences (src) originally isolated from the Rous sarcoma virus (RSV). The proto-oncogene src (c-src) codes for a protein that is a member of the tyrosine kinase family and was the first proto-oncogene identified in the human genome. The human c-src gene is located at 20q12-13 on the long arm of chromosome 20.
A group of replication-defective viruses, in the genus GAMMARETROVIRUS, which are capable of transforming cells, but which replicate and produce tumors only in the presence of Murine leukemia viruses (LEUKEMIA VIRUS, MURINE).
One of the mechanisms by which CELL DEATH occurs (compare with NECROSIS and AUTOPHAGOCYTOSIS). Apoptosis is the mechanism responsible for the physiological deletion of cells and appears to be intrinsically programmed. It is characterized by distinctive morphologic changes in the nucleus and cytoplasm, chromatin cleavage at regularly spaced sites, and the endonucleolytic cleavage of genomic DNA; (DNA FRAGMENTATION); at internucleosomal sites. This mode of cell death serves as a balance to mitosis in regulating the size of animal tissues and in mediating pathologic processes associated with tumor growth.
The type species of ALPHARETROVIRUS producing latent or manifest lymphoid leukosis in fowl.
DNA sequences which are recognized (directly or indirectly) and bound by a DNA-dependent RNA polymerase during the initiation of transcription. Highly conserved sequences within the promoter include the Pribnow box in bacteria and the TATA BOX in eukaryotes.
Translation products of a fusion gene derived from CHROMOSOMAL TRANSLOCATION of C-ABL GENES to the genetic locus of the breakpoint cluster region gene on chromosome 22. Several different variants of the bcr-abl fusion proteins occur depending upon the precise location of the chromosomal breakpoint. These variants can be associated with distinct subtypes of leukemias such as PRECURSOR CELL LYMPHOBLASTIC LEUKEMIA-LYMPHOMA; LEUKEMIA, MYELOGENOUS, CHRONIC, BCR-ABL POSITIVE; and NEUTROPHILIC LEUKEMIA, CHRONIC.
The phenotypic manifestation of a gene or genes by the processes of GENETIC TRANSCRIPTION and GENETIC TRANSLATION.
A replication-defective mouse sarcoma virus (SARCOMA VIRUSES, MURINE) first described by J.J. Harvey in 1964.
Proteins transcribed from the E1A genome region of ADENOVIRUSES which are involved in positive regulation of transcription of the early genes of host infection.
Polyomavirus antigens which cause infection and cellular transformation. The large T antigen is necessary for the initiation of viral DNA synthesis, repression of transcription of the early region and is responsible in conjunction with the middle T antigen for the transformation of primary cells. Small T antigen is necessary for the completion of the productive infection cycle.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.

Stromal cells mediate retinoid-dependent functions essential for renal development. (1/24774)

The essential role of vitamin A and its metabolites, retinoids, in kidney development has been demonstrated in vitamin A deficiency and gene targeting studies. Retinoids signal via nuclear transcription factors belonging to the retinoic acid receptor (RAR) and retinoid X receptor (RXR) families. Inactivation of RARaplpha and RARbeta2 receptors together, but not singly, resulted in renal malformations, suggesting that within a given renal cell type, their concerted function is required for renal morphogenesis. At birth, RARalpha beta2(-) mutants displayed small kidneys, containing few ureteric bud branches, reduced numbers of nephrons and lacking the nephrogenic zone where new nephrons are continuously added. These observations have prompted us to investigate the role of RARalpha and RARbeta2 in renal development in detail. We have found that within the embryonic kidney, RARalpha and RARbeta2 are colocalized in stromal cells, but not in other renal cell types, suggesting that stromal cells mediate retinoid-dependent functions essential for renal development. Analysis of RARalpha beta2(-) mutant kidneys at embryonic stages revealed that nephrons were formed and revealed no changes in the intensity or distribution of molecular markers specific for different metanephric mesenchymal cell types. In contrast the development of the collecting duct system was greatly impaired in RARalpha beta2(-) mutant kidneys. Fewer ureteric bud branches were present, and ureteric bud ends were positioned abnormally, at a distance from the renal capsule. Analysis of genes important for ureteric bud morphogenesis revealed that the proto-oncogene c-ret was downregulated. Our results suggest that RARalpha and RARbeta2 are required for generating stromal cell signals that maintain c-ret expression in the embryonic kidney. Since c-ret signaling is required for ureteric bud morphogenesis, loss of c-ret expression is a likely cause of impaired ureteric bud branching in RARalpha beta2(-) mutants.  (+info)

VEGF is required for growth and survival in neonatal mice. (2/24774)

We employed two independent approaches to inactivate the angiogenic protein VEGF in newborn mice: inducible, Cre-loxP- mediated gene targeting, or administration of mFlt(1-3)-IgG, a soluble VEGF receptor chimeric protein. Partial inhibition of VEGF achieved by inducible gene targeting resulted in increased mortality, stunted body growth and impaired organ development, most notably of the liver. Administration of mFlt(1-3)-IgG, which achieves a higher degree of VEGF inhibition, resulted in nearly complete growth arrest and lethality. Ultrastructural analysis documented alterations in endothelial and other cell types. Histological and biochemical changes consistent with liver and renal failure were observed. Endothelial cells isolated from the liver of mFlt(1-3)-IgG-treated neonates demonstrated an increased apoptotic index, indicating that VEGF is required not only for proliferation but also for survival of endothelial cells. However, such treatment resulted in less significant alterations as the animal matured, and the dependence on VEGF was eventually lost some time after the fourth postnatal week. Administration of mFlt(1-3)-IgG to juvenile mice failed to induce apoptosis in liver endothelial cells. Thus, VEGF is essential for growth and survival in early postnatal life. However, in the fully developed animal, VEGF is likely to be involved primarily in active angiogenesis processes such as corpus luteum development.  (+info)

FGF8 induces formation of an ectopic isthmic organizer and isthmocerebellar development via a repressive effect on Otx2 expression. (3/24774)

Beads containing recombinant FGF8 (FGF8-beads) were implanted in the prospective caudal diencephalon or midbrain of chick embryos at stages 9-12. This induced the neuroepithelium rostral and caudal to the FGF8-bead to form two ectopic, mirror-image midbrains. Furthermore, cells in direct contact with the bead formed an outgrowth that protruded laterally from the neural tube. Tissue within such lateral outgrowths developed proximally into isthmic nuclei and distally into a cerebellum-like structure. These morphogenetic effects were apparently due to FGF8-mediated changes in gene expression in the vicinity of the bead, including a repressive effect on Otx2 and an inductive effect on En1, Fgf8 and Wnt1 expression. The ectopic Fgf8 and Wnt1 expression domains formed nearly complete concentric rings around the FGF8-bead, with the Wnt1 ring outermost. These observations suggest that FGF8 induces the formation of a ring-like ectopic signaling center (organizer) in the lateral wall of the brain, similar to the one that normally encircles the neural tube at the isthmic constriction, which is located at the boundary between the prospective midbrain and hindbrain. This ectopic isthmic organizer apparently sends long-range patterning signals both rostrally and caudally, resulting in the development of the two ectopic midbrains. Interestingly, our data suggest that these inductive signals spread readily in a caudal direction, but are inhibited from spreading rostrally across diencephalic neuromere boundaries. These results provide insights into the mechanism by which FGF8 induces an ectopic organizer and suggest that a negative feedback loop between Fgf8 and Otx2 plays a key role in patterning the midbrain and anterior hindbrain.  (+info)

A Wnt5a pathway underlies outgrowth of multiple structures in the vertebrate embryo. (4/24774)

Morphogenesis depends on the precise control of basic cellular processes such as cell proliferation and differentiation. Wnt5a may regulate these processes since it is expressed in a gradient at the caudal end of the growing embryo during gastrulation, and later in the distal-most aspect of several structures that extend from the body. A loss-of-function mutation of Wnt5a leads to an inability to extend the A-P axis due to a progressive reduction in the size of caudal structures. In the limbs, truncation of the proximal skeleton and absence of distal digits correlates with reduced proliferation of putative progenitor cells within the progress zone. However, expression of progress zone markers, and several genes implicated in distal outgrowth and patterning including Distalless, Hoxd and Fgf family members was not altered. Taken together with the outgrowth defects observed in the developing face, ears and genitals, our data indicates that Wnt5a regulates a pathway common to many structures whose development requires extension from the primary body axis. The reduced number of proliferating cells in both the progress zone and the primitive streak mesoderm suggests that one function of Wnt5a is to regulate the proliferation of progenitor cells.  (+info)

Membrane-tethered Drosophila Armadillo cannot transduce Wingless signal on its own. (5/24774)

Drosophila Armadillo and its vertebrate homolog beta-catenin are key effectors of Wingless/Wnt signaling. In the current model, Wingless/Wnt signal stabilizes Armadillo/beta-catenin, which then accumulates in nuclei and binds TCF/LEF family proteins, forming bipartite transcription factors which activate transcription of Wingless/Wnt responsive genes. This model was recently challenged. Overexpression in Xenopus of membrane-tethered beta-catenin or its paralog plakoglobin activates Wnt signaling, suggesting that nuclear localization of Armadillo/beta-catenin is not essential for signaling. Tethered plakoglobin or beta-catenin might signal on their own or might act indirectly by elevating levels of endogenous beta-catenin. We tested these hypotheses in Drosophila by removing endogenous Armadillo. We generated a series of mutant Armadillo proteins with altered intracellular localizations, and expressed these in wild-type and armadillo mutant backgrounds. We found that membrane-tethered Armadillo cannot signal on its own; however it can function in adherens junctions. We also created mutant forms of Armadillo carrying heterologous nuclear localization or nuclear export signals. Although these signals alter the subcellular localization of Arm when overexpressed in Xenopus, in Drosophila they have little effect on localization and only subtle effects on signaling. This supports a model in which Armadillo's nuclear localization is key for signaling, but in which Armadillo intracellular localization is controlled by the availability and affinity of its binding partners.  (+info)

Intracellular signalling: PDK1--a kinase at the hub of things. (6/24774)

Phosphoinositide-dependent kinase 1 (PDK1) is at the hub of many signalling pathways, activating PKB and PKC isoenzymes, as well as p70 S6 kinase and perhaps PKA. PDK1 action is determined by colocalization with substrate and by target site availability, features that may enable it to operate in both resting and stimulated cells.  (+info)

Alzheimer's disease: clues from flies and worms. (7/24774)

Presenilin mutations give rise to familial Alzheimer's disease and result in elevated production of amyloid beta peptide. Recent evidence that presenilins act in developmental signalling pathways may be the key to understanding how senile plaques, neurofibrillary tangles and apoptosis are all biochemically linked.  (+info)

Concomitant activation of pathways downstream of Grb2 and PI 3-kinase is required for MET-mediated metastasis. (8/24774)

The Met tyrosine kinase - the HGF receptor - induces cell transformation and metastasis when constitutively activated. Met signaling is mediated by phosphorylation of two carboxy-terminal tyrosines which act as docking sites for a number of SH2-containing molecules. These include Grb2 and p85 which couple the receptor, respectively, with Ras and PI 3-kinase. We previously showed that a Met mutant designed to obtain preferential coupling with Grb2 (Met2xGrb2) is permissive for motility, increases transformation, but - surprisingly - is impaired in causing invasion and metastasis. In this work we used Met mutants optimized for binding either p85 alone (Met2xPI3K) or p85 and Grb2 (MetPI3K/Grb2) to evaluate the relative importance of Ras and PI 3-kinase as downstream effectors of Met. Met2xPI3K was competent in eliciting motility, but not transformation, invasion, or metastasis. Conversely, MetP13K/Grb2 induced motility, transformation, invasion and metastasis as efficiently as wild type Met. Furthermore, the expression of constitutively active PI 3-kinase in cells transformed by the Met2xGrb2 mutant, fully rescued their ability to invade and metastasize. These data point to a central role for PI 3-kinase in Met-mediated invasiveness, and indicate that simultaneous activation of Ras and PI 3-kinase is required to unleash the Met metastatic potential.  (+info)

The popularity reached by the genetic manipulation of laboratory animals to create new models for studying human diseases, produced in turn, that the techniques for assisted reproduction cons
TY - JOUR. T1 - Up-regulation of soluble Axl and Mer receptor tyrosine kinases negatively correlates with Gas6 in established multiple sclerosis lesions. AU - Weinger, Jason G.. AU - Omari, Kakuri M.. AU - Marsden, Kurt. AU - Raine, Cedric S.. AU - Shafit-Zagardo, Bridget. PY - 2009/7. Y1 - 2009/7. N2 - Multiple sclerosis is a disease that is characterized by inflammation, demyelination, and axonal damage; it ultimately forms gliotic scars and lesions that severely compromise the function of the central nervous system. Evidence has shown previously that altered growth factor receptor signaling contributes to lesion formation, impedes recovery, and plays a role in disease progression. Growth arrest-specific protein 6 (Gas6), the ligand for the TAM receptor tyrosine kinase family, consisting of Tyro3, Axl, and Mer, is important for cell growth, survival, and clearance of debris. In this study, we show that levels of membrane-bound Mer (205 kd), soluble Mer (⌈150 kd), and soluble Axl (80 kd) were ...
Buy Anti-MerTK (c-MER, c-Mer Proto-oncogene Tyrosine Kinase, MER, MER Receptor Tyrosine Kinase, MERK, ME, item number: M2995-05.100 from United States Biological at Biomol!
Mer receptor tyrosine kinase (Mer) signaling plays a central role in the intrinsic inhibition of the inflammatory response to Tolllike receptor activation. Previously, we found that lung Mer protein expression decreased after lipopolysaccharide (LPS) treatment due to enhanced Mer cleavage. The purpose of the present study was to examine whether pharmacologically restored membrane-bound Mer expression upregulates the Mer signaling pathways and suppresses lung inflammatory responses. Pretreatment with the ADAM17 (a disintegrin and metalloproteinase-17) inhibitor TAPI-0 (tumor necrosis factor alpha protease inhibitor-0) reduced LPS-induced production of soluble Mer protein in bronchoalveolar lavage (BAL) fluid, restored membrane-bound Mer expression, and increased Mer activation in alveolar macrophages and lungs after LPS treatment. TAPI-0 also enhanced Mer downstream signaling, including phosphorylation of protein kinase b, focal adhesion kinase, and signal transducer and activator of ...
Although TGF-β has been shown to stimulate the growth of many fibroblast cell lines, only murine AKR-2B and NRK fibroblasts undergo anchorage-independent growth in response to TGF-β (29, 37). So far, the intracellular signaling pathway that mediates this transforming activity in the two fibroblast cell lines has not been clearly defined. Here we showed that SnoN is a critical mediator of TGF-β-induced transformation in AKR-2B and NRK fibroblast cells. TGF-β, through the action of the Smad2/Smad4 complex, induces a strong and prolonged upregulation of snoN expression in these fibroblast cells that lasts for more than 8 to 24 h. This sustained activation of snoN expression may be necessary for the anchorage-independent growth of these fibroblasts in response to TGF-β1, since reduction of snoN expression by siRNA abolished TGF-β-induced transformation of AKR-2B cells and shortening of the duration of snoN induction by a pharmacological inhibitor markedly impaired TGF-β-induced transformation ...
Cirrhosis of the liver is a condition with a high mortality and raising prevalence worldwide. Infectious complications are highly frequent and independent predictors of outcome in patients with cirrhosis - being the leading cause of decompensation, acute-on-chronic liver failure (ACLF) and death. There is no treatment option other than transplantation, applicable at early stages and to only a minority of patients. Susceptibility to infection has been documented in patients with cirrhosis and has been attributed to immuneparesis and monocyte dysfunction in the state of decompensation and liver failure. The underlying mechanisms are incompletely understood. Development of targeted immunomodulatory strategies might effectively reduce infectious complications and mortality in cirrhosis. MER receptor tyrosine kinase (MERTK), expressed on monocytes/macrophages, plays a pivotal role in dampening innate immune responses. We have recently discovered and documented the role of MERTK in innate immune ...
James W. Perfield, Yunkyoung Lee, Gerald I. Shulman, Varman T. Samuel, Michael J. Jurczak, Eugene Chang, Chen Xie, Phillip N. Tsichlis, Martin S. Obin, Andrew S. Greenberg ...
Purified Recombinant Human FYN Protein, Myc/DDK-tagged, C13 and N15-labeled from Creative Biomart. Recombinant Human FYN Protein, Myc/DDK-tagged, C13 and N15-labeled can be used for research.
tyrosine-protein kinase Fyn,FYN oncogene related to SRC, FGR, YES,c-fyn, fyn proto-oncogene,p59-Fyn,proto-oncogene c-Fyn,proto-oncogene tyrosine-protein kinase ...
Tcl script which is executed in the global scope if the show-help signal is received, which is normally the case if the user presses F1 or Ctrl-F1. Before evaluation the following percent strings are substituted: %w widget ...
Tcl1兔多克隆抗体(ab32813)可与人样本反应并经WB实验严格验证,被1篇文献引用。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
Pbx3兔多克隆抗体(ab56239)可与人样本反应并经WB, IHC实验严格验证,被1篇文献引用并得到1个独立的用户反馈。所有产品均提供质保服务,中国75%以上现货。
Sandarintojas. Didžiausias pasirinkimas, greitas pristatymas. Didmeninė ir mažmeninė prekyba Signeda - didžiausia Baltijos šalyse žibintais prekiaujanti įmonė.
Mice lacking the Axl receptor tyrosine kinase (RTK) and its family members exhibit detrimental effects on their reproductive ability. AXL is localized to Sertoli cells, which are the major nurturing cells in the seminiferous ...
Li, Xinli, Chun Liu, Blanche C. Ip, Kang-Quan Hu, Donald E. Smith, Andrew S. Greenberg, and Xiang-Dong Wang. Tumor progression locus 2 ablation suppressed hepatocellular carcinoma development by inhibiting hepatic inflammation and steatosis in mice. Journal of Experimental & Clinical Cancer Research 34, no. 1 (12, 2015): 1-8 ...
Neuronal migration is a crucial process that allows neurons to reach their correct target location to allow the nervous system to function properly. AP-2α is a transcription factor essential for neural crest cell migration and its mutation results in apoptosis within this cell population, as demonstrated by genetic models. We down-modulated AP-2α expression in GN-11 neurons by RNA interference and observe reduced neuron migration following the activation of a specific genetic programme including the Adhesion Related Kinase (Axl) gene. We prove that Axl is able to coordinate migration per se and by ChIP and promoter analysis we observe that its transcription is directly driven by AP-2α via the binding to one or more functional AP-2α binding sites present in its regulatory region. Analysis of migration in AP-2α null mouse embryo fibroblasts also reveals an essential role for AP-2α in cell movement via the activation of a distinct genetic programme. We show that AP-2α plays an essential role in cell
The KOMP Repository Collection is located at the MMRRC at the University of California, Davis and Childrens Hospital Oakland Research Institute. Question? Comments? For Mice, Cells, and germplasm please contact us at [email protected], US 1-888-KOMP-MICE or International +1-530-752-KOMP, or for vectors [email protected] or +1-510-450-7917 ...
TY - JOUR. T1 - Expression of c-cbl proto-oncogene is modulated during differentiation but not during induction of proliferation. AU - Mushinski, J.F.. AU - Goodnight, J.. AU - Rudikoff, E.. AU - Morse Iii, H.C.. AU - Langdon, Wallace. PY - 1994. Y1 - 1994. M3 - Article. VL - 9. SP - 2489. EP - 2497. JO - Oncogene. JF - Oncogene. SN - 0950-9232. ER - ...
HEADER TRANSFERASE 31-JAN-08 3C5L TITLE POLO-LIKE KINASE 1 POLO BOX DOMAIN IN COMPLEX WITH PPHSPT TITLE 2 PEPTIDE COMPND MOL_ID: 1; COMPND 2 MOLECULE: SERINE/THREONINE-PROTEIN KINASE PLK1; COMPND 3 CHAIN: A; COMPND 4 FRAGMENT: POLO BOX 1, POLO BOX 2, UNP RESIDUES 373-593; COMPND 5 SYNONYM: POLO-LIKE KINASE 1, PLK-1, SERINE/THREONINE- COMPND 6 PROTEIN KINASE 13, STPK13; COMPND 7 EC: 2.7.11.21; COMPND 8 ENGINEERED: YES; COMPND 9 MOL_ID: 2; COMPND 10 MOLECULE: PEPTIDE; COMPND 11 CHAIN: B; COMPND 12 ENGINEERED: YES SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: HOMO SAPIENS; SOURCE 3 ORGANISM_COMMON: HUMAN; SOURCE 4 ORGANISM_TAXID: 9606; SOURCE 5 GENE: PLK1, PLK; SOURCE 6 EXPRESSION_SYSTEM: ESCHERICHIA COLI; SOURCE 7 EXPRESSION_SYSTEM_TAXID: 562; SOURCE 8 EXPRESSION_SYSTEM_STRAIN: ROSETTA 2; SOURCE 9 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID; SOURCE 10 EXPRESSION_SYSTEM_PLASMID: PET28A; SOURCE 11 MOL_ID: 2; SOURCE 12 SYNTHETIC: YES KEYWDS PLK1, POLO-LIKE KINASE 1, POLO BOX DOMAIN, PHOSPHOPEPTIDE, ...
This graph shows the total number of publications written about Proto-Oncogene Proteins c-pim-1 by people in this website by year, and whether Proto-Oncogene Proteins c-pim-1 was a major or minor topic of these publications ...
This is an example page. Its different from a blog post because it will stay in one place and will show up in your site navigation (in most themes). Most people start with an About page that introduces them to potential site visitors. It might say something like this:. ...
pep:known chromosome:VEGA66:10:93247414:93311135:-1 gene:OTTMUSG00000033471 transcript:OTTMUST00000084101 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Elk3 description:ELK3, member of ETS oncogene family ...
You may already have read the hundreds of media articles today titled brain training doesnt work and similar, based on the BBC Brain Test Britain
Well its that time of year again and Springwatch wouldnt be Springwatch without you, the audience. So heres how you can get involved...
അമേരിക്കയിൽ കണ്ടു വരുന്ന, മാർജ്ജാരവർഗ്ഗത്തിൽപ്പെടുന്ന ഒരു വലിയ ജീവിയാണ്‌ പൂമ.(പുമ)[3] ഇംഗ്ലീഷ്:Puma. ഏറ്റവും അധികം പേരുകളുള്ള മൃഗം എന്ന ഗിന്നസ് റെക്കോഡുണ്ട് ഇതിന്. കൂഗർ, പാന്തർ, പ്യൂമ, മൗണ്ടൻ ലയൺ, മൗണ്ടൻ ക്യാറ്റ് തുടങ്ങി നാൽപ്പതോളം പേരുകളിൽ അറിയപ്പെടുന്നു. കടുവ, സിംഹം, ജാഗ്വർ എന്നിവക്ക് പിന്നിലായി പുലിക്കൊപ്പം പൂച്ച കുടുംബത്തിലെ ഏറ്റവും വലിയ നാലാമത്തെ ജീവിയാണ് പൂമ. എങ്കിലും ...
Looking for online definition of AXL receptor tyrosine kinase in the Medical Dictionary? AXL receptor tyrosine kinase explanation free. What is AXL receptor tyrosine kinase? Meaning of AXL receptor tyrosine kinase medical term. What does AXL receptor tyrosine kinase mean?
Diagnosis of acute kidney injury (AKI) relies on a late marker, namely serum creatinine (SCr). New biomarkers are considered for early and sensitive detection of CIN. In particular, uNGAL has been used for early detection of AKI in the emergency department, after cardiopulmonary bypass or following CM administration.. This study will be conducted to assess the possible value of urinary Neutrophil Gelatinase-Associated Lipocalin (uNGAL) as an early detector of contrast-induced nephropathy (CIN) in a large sized cohort of patients undergoing percutaneous coronary procedures (PCP) and whether or not uNGAL correlates with the volume of contrast medium (CM) used. ...
Different molecular forms of urinary neutrophil gelatinase-associated lipocalin (NGAL) have recently been discovered. We aimed to explore the nature, source and discriminatory value of urinary NGAL in
Acute kidney injury (AKI) is a devastating potential consequence of renal ischaemia and reperfusion (I-R) subsequent to severe intra-operative hypotension and fluid resuscitation. Acute tubular epithelial damage is a common early histological abnormality in this syndrome. The high mortality rate associated with AKI in dogs is attributed in part to the limitations of current diagnostic techniques that can only detect AKI in the late stages when damage is irreversible. Early detection of renal tubular injury could improve outcome and might be possible by measuring urinary neutrophil gelatinase-associated lipocalin concentration (uNGAL) in at-risk dogs.. The objectives of this study were to establish a clinically relevant canine model of renal I-R injury, and use this model to determine changes in uNGAL within three hours of initiation of injury.. A pilot study was performed to establish the severity and duration of hypotension caused by haemorrhage, and duration of reperfusion, that produced ...
TY - JOUR. T1 - Neutrophil gelatinase-associated lipocalin regulates gut microbiota of mice. AU - Mori, Katsuya. AU - Suzuki, Takeshi. AU - Minamishima, Shizuka. AU - Igarashi, Toru. AU - Inoue, Kei. AU - Nishimura, Daisuke. AU - Seki, Hiroyuki. AU - Yamada, Takashige. AU - Kosugi, Shizuko. AU - Katori, Nobuyuki. AU - Hashiguchi, Saori. AU - Morisaki, Hiroshi. PY - 2016/1/1. Y1 - 2016/1/1. N2 - Background and Aim: Because neutrophil gelatinase-associated lipocalin (NGAL) is known to provide significant bacteriostatic effects during infectious conditions, we tested the hypothesis that this protein is up-regulated and secreted into the intraluminal cavity of the gut under critically ill conditions and is thus responsible for the regulation of bacterial overgrowth. Methods: With our institutional approval, male C57BL/6J mouse (6-7weeks) were enrolled and applied for lipopolysaccharide or peritonitis model compared with naïve control. We assessed NGAL protein concentrations in intestinal lumen and ...
Neutrophil gelatinase-associated lipocalin (NGAL) is a small 25-kDa protein released from kidney tubular cells after harmful stimuli. It represents one of the most promising future biomarkers in the diagnostic field of acute kidney injury (AKI), as the increase in NGAL levels is a good predictor of a brief-term onset of AKI, notably anticipating the resulting increase in serum creatinine. However, recent studies also suggest a possible role for NGAL in chronic kidney disease (CKD). For this reason we evaluated serum (sNGAL) and urinary NGAL (uNGAL) in a cohort of CKD patients in order to verify the relationship with the severity of renal impairment. In CKD patients sNGAL, uNGAL and the fractional excretion of this protein were notably increased as compared to controls. Furthermore both sNGAL and uNGAL were correlated with serum creatinine and, inversely, with residual glomerular filtration rate (GFR): this last relationship was found to be even closer than that found between GFR and serum ...
Lipocalin-2, human recombinant protein, Neutrophil gelatinase-associated lipocalin, NGAL, p25, 25 kDa alpha-2-microglobulin-related subunit validated in (PBV10492r-10), Abgent
Neutrophil gelatinase-associated lipocalin has been used for the diagnosis, prognosis and severity assessment of AKI and has been validated in paediatric populations (where comorbidity is low) and in conditions where the timing of the insult is clear (that is cardiac surgery and so on) [20-24]. Its role in an adult ICU population has not been well validated due to the heterogeneity and uncertainty of the timing of the insult. The pathophysiology and causes of AKI in the ICU could be indigenous [25] and may differ from pre-ICU causes (low-volume state, inotropes, contrast injury and so on). This has led to problems in the design and interpretation of studies in the general adult ICU patient cohort. In this study, we sought to overcome these problems by excluding patients with pre-existing chronic kidney disease (CKD) and/or AKI and by looking at the predictive value of both urinary and plasma NGAL at different time points following admission.. We found the incidence of AKI was 30.4% (n = 59) with ...
McLean , M H , Thomson , A J , Murray , G I , Fyfe , N , Hold , G L & El-Omar , E M 2013 , Expression of neutrophil gelatinase-associated lipocalin in colorectal neoplastic progression : a marker of malignant potential? , British Journal of Cancer , vol. 108 , no. 12 , pp. 2537-2541 . https://doi.org/10.1038/bjc. ...
Abstract Elderly is the main age group affected by acute kidney injury (AKI). There are no studies that investigated the predictive properties of urinary (u) NGAL as an AKI marker in septic elderly population. This study aimed to evaluate the efficacy of uNGAL as predictor of AKI diagnosis and prognosis in elderly septic patients admitted to ICUs. We prospectively studied elderly patients with sepsis admitted to ICUs from October 2014 to November 2015. Assessment of renal function was performed daily by serum creatinine and urine output. The level of uNGAL was performed within the first 48 hours of the diagnosis of sepsis (NGAL1) and between 48 and 96 hours (NGAL2). The results were presented using descriptive statistics and area under the receiver operating characteristic curve (AUC-ROC) and p value was 5%. Seventy-five patients were included, 47 (62.7%) developed AKI. At logistic regression, chronic kidney disease and low mean blood pressure at admission were identified as factors associated ...
One-hundred and eighty-one patients (66.1%) were men; mean age was 68.2 ± 12.2 years. Valve replacement was performed in 123, coronary artery bypass graft (CABG) in 81, valve surgery + CABG in 48, cardiac transplant in five, aorta aneurism surgery in nine, and other procedures in eight patients. ICU and hospital stays were 6.7 ± 8.1 and 15.7 ± 13.9 days, respectively. Renal replacement therapy (RRT) was required in 16 patients (5.8%) within 48 hours of ICU stay and in 28 patients (10.2%) within 43weeks. Mortality at 28 days was 2.9%. Eighty-six patients (31.4%) were diagnosed with AKI within 48 hours of surgery. Area under the ROC curve of POST uNGAL for AKI diagnosis was 0.72 (0.66 to 0.79) (P 0.0001) at an optimal cutoff value of 1803 μg/l, with 78.7% specificity, 64% sensitivity and 74.1% accuracy. uNGAL advanced diagnosis of AKI in 44 patients (51.2%), whereas diagnosis was achieved at the same time as AKI criteria in 11 patients; AKI criteria outperformed uNGAL in only 36% of cases. ...
Looking for online definition of RAB41, member RAS oncogene family in the Medical Dictionary? RAB41, member RAS oncogene family explanation free. What is RAB41, member RAS oncogene family? Meaning of RAB41, member RAS oncogene family medical term. What does RAB41, member RAS oncogene family mean?
Semantic Scholar extracted view of Neutrophil gelatinase-associated lipocalin as an early indicator for postoperative renal failure by CD Van der Marel et al.
Alt. Names/Synonyms: c-met-related tyrosine kinase; CD136; CDw136; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); Macrophage-stimulating protein receptor; Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain; MSP receptor; MST1R; p185-Ron; Protein-tyrosine kinase 8; PTK8; PTK8 protein tyrosine kinase 8; RON; soluble RON variant 1; soluble RON variant 2; soluble RON variant 3; soluble RON variant 4 ...
Macrophage stimulating 1 receptor (c-met-related tyrosine kinase), encoded by the MST1R gene, is a cell-surface receptor that binds macrophage-stimulating protein (MSP). It was previously known as RON. The precursor protein is cleaved to generate the mature form, a heterodimer of disulfide-linked alpha and beta subunits. The beta subunit of MST1R/RON is phosphorylated at tyrosine residues upon activation by MSP. MST1R/RON signaling activates the wound healing response by promoting epithelial cell migration, proliferation, and survival at the wound site. MST1R/RON is also known as CDw136, protein-tyrosine kinase 8 (PTK8), c-met-related tyrosine kinase, macrophage-stimulating protein receptor, MSP receptor, p185-Ron, CD136, MST1R variant RON30, MST1R variant RON62, and RON variant E2E3.. ...
Macrophage stimulating 1 receptor (c-met-related tyrosine kinase), encoded by the MST1R gene, is a cell-surface receptor that binds macrophage-stimulating protein (MSP). It was previously known as RON. The precursor protein is cleaved to generate the mature form, a heterodimer of disulfide-linked alpha and beta subunits. The beta subunit of MST1R/RON is phosphorylated at tyrosine residues upon activation by MSP. MST1R/RON signaling activates the wound healing response by promoting epithelial cell migration, proliferation, and survival at the wound site. MST1R/RON is also known as CDw136, protein-tyrosine kinase 8 (PTK8), c-met-related tyrosine kinase, macrophage-stimulating protein receptor, MSP receptor, p185-Ron, CD136, MST1R variant RON30, MST1R variant RON62, and RON variant E2E3.. ...
Subramanian Senthilkumaran, Ponniah Thirumalaikolundusubramanian, Namasivayam Elangovan Journal of Emergencies, Trauma, and Shock 2019 12(4):260-262 Backgrou
The RON receptor tyrosine kinase regulates epithelial cell homeostasis and tumorigenesis by transducing multiple signals through its functional domains. The present study was to determine the significance of the entire C-terminus in RON or its variant RON160-mediated activities related to cell motility and tumorigenesis. Analysis of protein phosphorylation revealed that elimination of the entire C-terminus significantly impairs the ligand-dependent or independent RON or RON160 phosphorylation and dimerization. Phosphorylation of downstream signaling proteins such as Erk1/2, AKT, and p38 MAP kinase was also diminished in cells expressing the C-terminus-free RON or RON160. These dysfunctional activities were accompanied with the inability of truncated RON or RON160 to mediate cytoplasmic β-catenin accumulation. Functional analysis further demonstrated that truncation of the C-terminus significantly impairs RON or RON160-mediated cell proliferation, morphological changes, and cellular migration.
SnoN is a negative regulator of TGF-β signaling and also an activator of the tumor suppressor p53 in response to cellular stress. Its role in human cancer is complex and controversial with both pro-oncogenic and anti-oncogenic activities reported. To clarify its role in human cancer and provide clinical relevance to its signaling activities, we examined SnoN expression in normal and cancerous human esophageal, ovarian, pancreatic and breast tissues. In normal tissues, SnoN is expressed in both the epithelium and the surrounding stroma at a moderate level and is predominantly cytoplasmic. SnoN levels in all tumor epithelia examined are lower than or similar to that in the matched normal samples, consistent with its anti-tumorigenic activity in epithelial cells. In contrast, SnoN expression in the stroma is highly upregulated in the infiltrating inflammatory cells in high-grade esophageal and ovarian tumor samples, suggesting that SnoN may potentially promote malignant progression through ...
TY - JOUR. T1 - The protooncogene product, PEBP2β/CBFβ, is mainly located in the cytoplasm and has an affinity with cytoskeletal structures. AU - Tanaka, Yuta. AU - Watanabe, Toshio. AU - Chiba, Natsuko. AU - Niki, Masaru. AU - Kuroiwa, Yasuyuki. AU - Nishihira, Tetsuro. AU - Satomi, Susumu. AU - Ito, Yoshiaki. AU - Satake, Masanobu. N1 - Funding Information: We thank Ms I Imamura for secretarial assistance. This investigation was supported in part by research grants from the Ministry of Education, Science and Culture of Japan, Proposal-Based Advanced Industrial Technology R&D Program, Takeda Science Foundation, The Ryoichi Naito Foundation for Medical Research, The Mochida Memorial Foundation for Medical and Pharmaceutical Research, Uehara Memorial Foundation and The Naito Foundation.. PY - 1997. Y1 - 1997. N2 - The Pebpb2/Cbfb gene encodes the non-DNA binding β subunit of the heterodimeric transcription factor, PEBP2/CBF, and has been implicated in a subtype of human acute myeloid leukemia, ...
Fingerprint Dive into the research topics of Ly-6A is required for T cell receptor expression and protein tyrosine kinase fyn activity. Together they form a unique fingerprint. ...
555 The Macrophage-Stimulating Protein receptor aka. MSP-R or RON belongs to the c-MET family of receptor tyrosine kinases. The ligand for c-MET - Hepatocyte Growth Factor (HGF) as well as RONs ligand, MSP are members of the kringle-domain plasminogen-related protein family. As its name implies, MSP was originally found to stimulate macrophages by a variety of means. For example, addition of MSP to certain RON-expressing macrophages induced shape changes, chemotaxis, macropinocytosis and phagocytosis. RON was also found to be expressed in epithelial cells such as keratinocytes where MSP was shown to phosphorylate RON and activate a number of signaling pathways that elicited cell adhesion/motility, anti-apoptotic and proliferative responses. Within the last few years, however, over-expression of RON has been observed in several epithelial tumors and cell lines (ex. colon, breast and lung). In addition, the oncogenic potential of RON was recently demonstrated following its overexpression in ...
FUNCTION: This gene encodes a precursor protein that is proteolytically cleaved to yield an alpha chain and a beta chain which form a membrane-spanning heterodimer. The encoded protein belongs to a family of cell-surface receptor tyrosine kinases involved in signaling from the cell surface to the intracellular environment. The binding of the encoded protein to its ligand, macrophage-stimulating protein, mediates several biological activities including wound healing, tumor immunity, macrophage activation and hematopoiesis as well as cell growth, motility, survival and adhesion. The protein encoded by this gene also functions in early development and the macrophage-mediated inflammatory response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013 ...
Proto-Oncogene Proteins c-ret definition. define Proto-Oncogene Proteins c-ret. Explain Proto-Oncogene Proteins c-ret. What is Proto-Oncogene Proteins c-ret? Proto-Oncogene Proteins c-ret FAQ.
ROS1 (ROS proto-oncogene 1 , receptor tyrosine kinase), Authors: Samuel J Klempner, Sai-Hong Ou. Published in: Atlas Genet Cytogenet Oncol Haematol.
The serine/threonine kinase Akt, also known as protein kinase B (PKB), is a central node in cell signaling downstream of growth factors, cytokines, and other cellular stimuli. Aberrant loss or gain of Akt activation underlies the pathophysiological properties of a variety of complex diseases, includ …
BMS-777607是一种Met相关的抑制剂,作用于c-Met,Axl,Ron和Tyro3,在无细胞试验中IC50分别为3.9 nM,1.1 nM,1.8 nM和4.3 nM,作用于Met相关靶点比作用于Lck, VEGFR-2,和TrkA/B选择性高40倍,比作用于其他受体和非受体激酶选择性高500多倍。Phase 1/2。. ...
TransAM Elk-1 is a DNA-binding ELISA that quantifies the activated transcription factor using a method that is faster and more sensitive than gelshift, without radioactivity and gels.
Results: Of the 66 pts, 41 (62%) pts had wild-type (WT) KRAS and 25 (38%) pts harbored a KRAS mutation (codon 12 & 13). In the mutant KRAS group, 6 pts had SD (24%) and 19 pts had PD (76%) as their best OR; there were no responses. In the WT KRAS population, the PR rate was 12% (95% CI: 2 to 22), the SD rate was 54% (95% CI: 38 to 69), and the PD rate was 34% (95% CI: 20 to 49). The association between KRAS mutation status and lack of response to panitumumab was statistically significant (Fishers exact test, p = 0.003). From a Cox PH model, the hazard ratio for WT:mutant KRAS was 0.6 (95% CI: 0.34 to 0.95) for PFS and 0.5 (95% CI: 0.29 to 0.91) for OS. ...
Tumor protein 53 (p53) is a critical regulator of cell cycle and apoptosis that is frequently disabled in human tumors. In many tumor types, p53 is deleted or mutated, but in others p53 is inactivated by overexpression or amplification of its negative regulator mouse double minute 2 (MDM2). A high-t …
GtkWidget *dialog; dialog = gtk_recent_chooser_dialog_new (Recent Documents, parent_window, GTK_STOCK_CANCEL, GTK_RESPONSE_CANCEL, GTK_STOCK_OPEN, GTK_RESPONSE_ACCEPT, NULL); if (gtk_dialog_run (GTK_DIALOG (dialog)) == GTK_RESPONSE_ACCEPT) { GtkRecentInfo *info; info = gtk_recent_chooser_get_current_item (GTK_RECENT_CHOOSER (dialog)); open_file (gtk_recent_info_get_uri (info)); gtk_recent_info_unref (info); } gtk_widget_destroy (dialog ...
A meeting place of worldwide BIM managers and BIM professionals to gather information regarding BIM, BIM software, BIM classes, BIM conference, BIM...
pep:known chromosome:VEGA66:5:115631908:115647736:1 gene:OTTMUSG00000014704 transcript:OTTMUST00000034877 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rab35 description:RAB35 member RAS oncogene family ...
The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural…
A recent study from the Department of Cell Biology, University of Texas Southwestern Medical Center, Texas 75390, USA shows that XPO1 can be pharmacologically targeted in KRAS-mutant lung cancer. This study was... ...
Plasmid pDONR223-MERTK from Dr. William Hahns lab contains the insert MERTK and is published in Nature. 2010 Nov 24. ():. This plasmid is available through Addgene.
In Extremis we find out a few unknown biological facts about the Doctor and Time Lords in general. We discover they have (or can...
... proto-oncogene protein also known as N-Myc or basic helix-loop-helix protein 37 (bHLHe37), is a protein that in humans is ... Ramsay G, Stanton L, Schwab M, Bishop JM (1987). "Human proto-oncogene N-myc encodes nuclear proteins that bind DNA". Mol. Cell ... This protein is located in the cell nucleus and must dimerize with another bHLH protein in order to bind DNA. N-Myc is highly ... "Identification and characterization of the protein encoded by the human N-myc oncogene". Science. 232 (4751): 768-72. Bibcode: ...
Alexiadis V, Waldmann T, Andersen J, Mann M, Knippers R, Gruss C (2000). "The protein encoded by the proto-oncogene DEK changes ... Kappes F, Burger K, Baack M, Fackelmayer FO, Gruss C (2001). "Subcellular localization of the human proto-oncogene protein DEK ... The human DEK gene encodes the DEK protein. This gene encodes a protein with one SAP domain. The protein binds to cruciform and ... PDBe-KB provides an overview of all the structure information available in the PDB for Human Protein DEK v t e. ...
Proto-oncogene tyrosine-protein kinase Fyn (p59-FYN, Slk, Syn, MGC45350, Gene ID 2534) is an enzyme that in humans is encoded ... By definition as a proto-oncogene, Fyn codes for proteins that help regulate cell growth. Changes in its DNA sequence transform ... SH3 domain-mediated protein-protein interaction blocking drug". Oncogene. 21 (13): 2037-50. doi:10.1038/sj.onc.1205271. PMID ... Fyn is a member of the Src-family of kinases (SFK), the first proto-oncogene to be identified. The discovery of the Src-family ...
Proto-oncogene tyrosine-protein kinase Src Parsons SJ, Parsons JT (October 2004). "Src family kinases, key regulators of signal ... Src family kinases interact with many cellular cytosolic, nuclear and membrane proteins, modifying these proteins by ... transduction". Oncogene. 23 (48): 7906-9. doi:10.1038/sj.onc.1208160. PMID 15489908. Amanchy R, Zhong J, Hong R, Kim JH, Gucek ...
The DBL proto-oncogene is a protein that in humans is encoded by the MCF2 gene. The commonly-used name DBL is derived from " ... Nishida K, Kaziro Y, Satoh T (October 1999). "Association of the proto-oncogene product dbl with G protein betagamma subunits ... Ron D, Tronick SR, Aaronson SA, Eva A (August 1988). "Molecular cloning and characterization of the human dbl proto-oncogene: ... July 2000). "Human dbl proto-oncogene in 85 kb of xq26, and determination of the transcription initiation site". Gene. 253 (1 ...
Gupta K, Chevrette M, Gray DA (1994). "The Unp proto-oncogene encodes a nuclear protein". Oncogene. 9 (6): 1729-31. PMID ... 1995). "Elevated expression of Unph, a proto-oncogene at 3p21.3, in human lung tumors". Oncogene. 10 (11): 2179-83. PMID ... "Entrez Gene: USP4 ubiquitin specific peptidase 4 (proto-oncogene)". Gilchrist CA, Gray DA, Baker RT (December 1997). "A ... 2001). "The de-ubiquitinating enzyme Unp interacts with the retinoblastoma protein". Oncogene. 20 (39): 5538-5542. doi:10.1038/ ...
"Association of the vav proto-oncogene product with poly(rC)-specific RNA-binding proteins". Molecular and Cellular Biology. 15 ... RNA binding protein domains in other proteins that are similar to the RNA binding domain of protein K are called K-homology or ... Both proteins bind to single-stranded DNA as well as to RNA and can stimulate the activity of RNA polymerase II, the protein ... The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the ...
Wnt1 is a proto-oncogene protein (Wingless-type MMTV integration site family, member 1). This gene was originally thought to ... Fgf8 is also known as Fibroblast Growth Factor 8. It is a protein that is widely thought to be the most important organizing ...
"Effects of antibiotics and a proto-oncogene homolog on destruction of protein translocator SecY". Science. 325 (5941): 753-6. ... the YccA protein of Escherichia coli and the YetJ protein of Bacillus subtilis. These proteins are about 200-250 residues in ... These proteins are distantly related to the ionotropic glutamate-binding protein of the N-methyl D-aspartate (NMDA) receptor of ... Two others are the rat neural membrane protein 35 and the Arabidopsis thaliana Bax inhibitor-1 (BI-1) protein capable of ...
Myb proto-oncogene protein is a member of the MYB (myeloblastosis) family of transcription factors. The protein contains three ... In humans, it includes Myb proto-oncogene like 1 and Myb-related protein B in addition to MYB proper. Members of the extended ... Jacobs SM, Gorse KM, Westin EH (1994). "Identification of a second promoter in the human c-myb proto-oncogene". Oncogene. 9 (1 ... MYB+protein,+human at the US National Library of Medicine Medical Subject Headings (MeSH) Drosophila Myb oncogene-like - The ...
Proto-oncogene vav is a protein that in humans is encoded by the VAV1 gene. The protein encoded by this proto-oncogene is a ... Shigematsu H, Iwasaki H, Otsuka T, Ohno Y, Arima F, Niho Y (May 1997). "Role of the vav proto-oncogene product (Vav) in ... Adams JM, Houston H, Allen J, Lints T, Harvey R (1992). "The hematopoietically expressed vav proto-oncogene shares homology ... Bustelo XR, Barbacid M (1992). "Tyrosine phosphorylation of the vav proto-oncogene product in activated B cells". Science. 256 ...
... is a proto-oncogene, meaning that mutations of this protein can lead to cancer. Mutations of the FLT3 receptor can lead ... Overview of all the structural information available in the PDB for UniProt: P36888 (Receptor-type tyrosine-protein kinase FLT3 ... Cluster of differentiation antigen 135 (CD135) also known as fms like tyrosine kinase 3 (FLT-3), receptor-type tyrosine-protein ... Cluster of differentiation cytokine receptor receptor tyrosine kinase tyrosine kinase oncogene hematopoiesis Lymphopoiesis# ...
Proto-oncogene FRAT1 is a protein that in humans is encoded by the FRAT1 gene. The protein encoded by this gene belongs to the ... Jonkers J, Korswagen HC, Acton D, Breuer M, Berns A (Mar 1997). "Activation of a novel proto-oncogene, Frat1, contributes to ... Saitoh T, Mine T, Katoh M (2002). "Molecular cloning and expression of proto-oncogene FRAT1 in human cancer". Int. J. Oncol. 20 ... 2007). "FRAT1, a substrate-specific regulator of glycogen synthase kinase-3 activity, is a cellular substrate of protein kinase ...
... also known as proto-oncogene c-Crk is a protein that in humans is encoded by the CRK gene. The CRK protein ... Crk Info with links in the Cell Migration Gateway Proto-Oncogene+Proteins+c-crk at the US National Library of Medicine Medical ... Koval AP, Karas M, Zick Y, LeRoith D (1998). "Interplay of the proto-oncogene proteins CrkL and CrkII in insulin-like growth ... 1993). "CRK proto-oncogene maps to human chromosome band 17p13". Oncogene. 8 (10): 2853-5. PMID 8378094. Smit L, van der Horst ...
Koval, A P; Karas M; Zick Y; LeRoith D (Jun 1998). "Interplay of the proto-oncogene proteins CrkL and CrkII in insulin-like ... Koval AP, Karas M, Zick Y, LeRoith D (1998). "Interplay of the proto-oncogene proteins CrkL and CrkII in insulin-like growth ... The IRS4 protein is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation. IRS4 has been shown to ... Tyrosine-phosphorylated IRS4 protein has been shown to associate with cytoplasmic signalling molecules that contain SH2 domains ...
Raf is a proto-oncogene because mutations in this protein have been found in many cancers. The Rho GTPase Vav1, which can be ... GEFs are multi-domain proteins and interact with other proteins inside the cell through these domains. Adaptor proteins can ... G protein-coupled receptors are trans-membrane receptors that act as GEFs for their cognate G proteins upon binding of a ligand ... This 200 amino acid region is homologous to the yeast Sec7p protein. GEFs are often recruited by adaptor proteins in response ...
"SH3 domain-dependent interaction of the proto-oncogene product Vav with the focal contact protein zyxin". Oncogene. 12 (7): ... Degenhardt YY, Silverstein S (2001). "Interaction of Zyxin, a Focal Adhesion Protein, with the E6 Protein from Human ... SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein ... and characterization of a zyxin-related protein that binds the focal adhesion and microfilament protein VASP (vasodilator- ...
... "p130CAS forms a signaling complex with the adapter protein CRKL in hematopoietic cells transformed by the BCR/ABL oncogene". ... "Factor independence of human myeloid leukemia cell lines is associated with increased phosphorylation of the proto-oncogene Raf ... "p210BCR/ABL induces formation of complexes containing focal adhesion proteins and the protooncogene product p120c-Cbl". ... He was the first to fully clone the focal adhesion protein paxillin (human and chicken) and demonstrate its role in oncogenic ...
"The SH2-containing adapter protein GRB10 interacts with BCR-ABL". Oncogene. 17 (8): 941-8. doi:10.1038/sj.onc.1202024. PMID ... "p210BCR/ABL induces formation of complexes containing focal adhesion proteins and the protooncogene product p120c-Cbl". Exp. ... This gene encodes a protein that belongs to the pi3/pi4-kinase family of proteins. The gene product is an enzyme that ... In addition to its role in promoting assembly of adherens junctions, the protein is thought to play a pivotal role in the ...
... "p210BCR/ABL induces formation of complexes containing focal adhesion proteins and the protooncogene product p120c-Cbl". Exp. ... "Regulation of Bcr-Abl-induced SAP kinase activity and transformation by the SHPTP1 protein tyrosine phosphatase". Oncogene. 17 ... The breakpoint cluster region protein (BCR) also known as renal carcinoma antigen NY-REN-26 is a protein that in humans is ... The BCR protein has been shown to interact with: Abl gene, CD117, CRKL FES, Grb2, GRB10, HCK, MLLT4, PXN, PIK3CG, PTPN6, PTPRT( ...
... "p130CAS forms a signaling complex with the adapter protein CRKL in hematopoietic cells transformed by the BCR/ABL oncogene". ... "p210BCR/ABL induces formation of complexes containing focal adhesion proteins and the protooncogene product p120c-Cbl". ... The N-terminal region of paxillin is rich in protein-protein interaction sites. The proteins that bind to paxillin are diverse ... "Protein sequence of human PXN (Uniprot ID: P49023)". Cardiac Organellar Protein Atlas Knowledgebase (COPaKB). Archived from the ...
"The v-rel oncogene product is complexed with cellular proteins including its proto-oncogene product and heat shock protein 70 ... Heat shock 70 kDa protein 8 also known as heat shock cognate 71 kDa protein or Hsc70 or Hsp73 is a heat shock protein that in ... This protein binds to nascent polypeptides to facilitate correct protein folding. In order to properly fold non-native proteins ... This gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 (Hsp70) family. As a Hsp70 protein ...
The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. The c-Rel protein is a member of the NF-κB ... "The v-rel oncogene product is complexed with cellular proteins including its proto-oncogene product and heat shock protein 70 ... "A human rel proto-oncogene cDNA containing an Alu fragment as a potential coding exon". Oncogene. 4 (7): 935-42. PMID 2666912. ... Kochel T, Rice NR (1992). "v-rel- and c-rel-protein complexes bind to the NF-kappa B site in vitro". Oncogene. 7 (3): 567-72. ...
1996). "SH3 domain-dependent interaction of the proto-oncogene product Vav with the focal contact protein zyxin". Oncogene. 12 ... "A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling". Nat. Biotechnol. 21 (3): ... Guanine nucleotide exchange factor VAV3 is a protein that in humans is encoded by the VAV3 gene. This gene is a member of the ... The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin ...
Proto-oncogene protein Wnt-3 is a protein that in humans is encoded by the WNT3 gene. The WNT gene family consists of ... It encodes a protein showing 98% amino acid identity to mouse Wnt3 protein, and 84% to human WNT3A protein, another WNT gene ... These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate ... Smolich BD, McMahon JA, McMahon AP, Papkoff J (1994). "Wnt family proteins are secreted and associated with the cell surface". ...
Proto-oncogene tyrosine-protein kinase Yes is a non-receptor tyrosine kinase that in humans is encoded by the YES1 gene. This ... Zhao YH, Krueger JG, Sudol M (1991). "Expression of cellular-yes protein in mammalian tissues". Oncogene. 5 (11): 1629-35. PMID ... regulates proto-oncogene c-yes". J. Biol. Chem. 277 (39): 36489-98. doi:10.1074/jbc.M201859200. ISSN 0021-9258. PMID 12138090. ... The encoded protein has tyrosine kinase activity and belongs to the src family. This gene lies in close proximity to ...
Proto-oncogene tyrosine-protein kinase FER is an enzyme that in humans is encoded by the FER gene. Fer protein is a member of ... Kim, L; Wong T W (Sep 1998). "Growth factor-dependent phosphorylation of the actin-binding protein cortactin is mediated by the ... 1990). "The FER gene is evolutionarily conserved and encodes a widely expressed member of the FPS/FES protein-tyrosine kinase ... Lee ST, Strunk KM, Spritz RA (1993). "A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes". ...
Proto-oncogene tyrosine-protein kinase ROS is an enzyme that in humans is encoded by the ROS1 gene. This proto-oncogene, highly ... The protein encoded by this gene is a type I integral membrane protein with tyrosine kinase activity. The protein may function ... protein; it is encoded by the c-ros oncogene and was first identified in 1986. The exact role of the ROS1 protein in normal ... Rabin M, Birnbaum D, Young D, Birchmeier C, Wigler M, Ruddle FH (July 1987). "Human ros1 and mas1 oncogenes located in regions ...
Proto-oncogene tyrosine-protein kinase MER is an enzyme that in humans is encoded by the MERTK gene. This gene is a member of ... "Entrez Gene: MERTK c-mer proto-oncogene tyrosine kinase". Iwase T, Tanaka M, Suzuki M, Naito Y, Sugimura H, Kino I (July 1993 ... "Ectopic expression of the proto-oncogene Mer in pediatric T-cell acute lymphoblastic leukemia". Clinical Cancer Research. 12 (9 ... Weier HU, Fung J, Lersch RA (Jun 1999). "Assignment of protooncogene MERTK (a.k.a. c-mer) to human chromosome 2q14.1 by in situ ...
L-myc-1 proto-oncogene protein is a protein that in humans is encoded by the MYCL1 gene. MYCL1 is a bHLH (basic helix-loop- ... Atchley WR, Fitch WM (1995). "Myc and Max: molecular evolution of a family of proto-oncogene products and their dimerization ... "Amplification and overexpression of the L-MYC proto-oncogene in ovarian carcinomas". Am. J. Pathol. 162 (5): 1603-10. doi: ... "Towards a proteome-scale map of the human protein-protein interaction network". Nature. 437 (7062): 1173-1178. Bibcode: ...
MN1, MGCR, MGCR1, MGCR1-PEN, dJ353E16.2, meningioma (disrupted in balanced translocation) 1, MN1 proto-oncogene, ...
... analyses of c-Jun and DJ-1 proto-oncogenes". Cytogenetic and Genome Research. 127 (2-4): 79-93. doi:10.1159/000297715. PMID ... The albumin (9) further protects the embryo and serves as a reservoir for water and protein. The allantois (8) is a sac that ... The earliest known proto-reptiles originated around 312 million years ago during the Carboniferous period, having evolved from ... Tegu lizards are known to possess a proto-diaphragm, which separates the pulmonary cavity from the visceral cavity. While not ...
... an evolutionarily conserved nuclear protein that interacts with BRCA2". Oncogene. 20 (3): 336-45. doi:10.1038/sj.onc.1204098. ... "Specific activation of microRNA-127 with downregulation of the proto-oncogene BCL6 by chromatin-modifying drugs in human cancer ... protein C-terminus binding. • protein binding. • four-way junction DNA binding. • identical protein binding. • ... This protein can interact with the ssDNA-binding protein RPA, BRCA2, PALB2[10] and RAD52. ...
Nontransforming viruses can randomly insert their DNA into proto-oncogenes, disrupting the expression of proteins that regulate ... Proteins: consisting of gag proteins, protease (PR), pol proteins, and env proteins. *Group-specific antigen (gag) proteins are ... by proto-oncogenes that were mistakenly incorporated into proviral DNA or by the disruption of cellular proto-oncogenes. Rous ... Env proteins play a role in association and entry of virions into the host cell.[5] Possessing a functional copy of an env gene ...
Jacob F; Monod J (June 1961). "Genetic regulatory mechanisms in the synthesis of proteins". J Mol Biol. 3 (3): 318-56. doi: ... Braig M, Schmitt CA (March 2006). "Oncogene-induced senescence: putting the brakes on tumor development". Cancer Research 66 (6 ... "Proto-genes and de novo gene birth.". Nature 487 (7407): 370-4. Bibcode:2012Natur.487..370C. doi:10.1038/nature11184. PMID ... Wu, DD; Irwin, DM; Zhang, YP (November 2011). "De novo origin of human protein-coding genes.". PLOS Genetics 7 (11): e1002379. ...
"The proto-oncogene c-myc in hematopoietic development and leukemogenesis". Oncogene 21 (21): 3414-21. PMID 12032779. doi: ... Bernstein PL, Herrick DJ, Prokipcak RD, Ross J (1992). "Control of c-myc mRNA half-life in vitro by a protein capable of ... Nilsson JA, Cleveland JL (2004). "Myc pathways provoking cell suicide and cancer". Oncogene 22 (56): 9007-21. PMID 14663479. ... Guilhot S, Petridou B, Syed-Hussain S, Galibert F (1989). "Nucleotide sequence 3' to the human c-myc oncogene; presence of a ...
... as well as a number of proto-oncogenes (Raf, Myc, Myb, Rel, Src, Mos, Abl). The UPS is also involved in the regulation of ... The protein degradation processEdit. Ribbon diagram of ubiquitin, the highly conserved protein that serves as a molecular tag ... Proteasomes are protein complexes which degrade unneeded or damaged proteins by proteolysis, a chemical reaction that breaks ... Proteins are tagged for degradation with a small protein called ubiquitin. The tagging reaction is catalyzed by enzymes called ...
a b Proto-Oncogene+Proteins+c-sis at the US National Library of Medicine Medical Subject Headings (MeSH) ... McClintock JT, Chan IJ, Thaker SR, Katial A, Taub FE, Aotaki-Keen AE, Hjelmeland LM (1992). "Detection of c-sis proto-oncogene ... Binding proteins: IGFBP (1, 2, 3, 4, 5, 6, 7). *Cleavage products/derivatives with unknown target: Glypromate (GPE, (1-3)IGF-1) ... The "c-Sis" oncogene is derived from PDGF.[26][32] Age related downregulation of the PDGF receptor on islet beta cells has been ...
Their discovery triggered the identification of many other cellular proto-oncogenes-progenitors of viral oncogenes and targets ... discovery of ribosomal frameshifting to make retroviral proteins (with Tyler Jacks[16]); isolation of a cellular receptor for ... discovery of the Wnt-1 proto-oncogene with Roel Nusse;[13][14] elucidation of aspects of the replication cycle of hepatitis B ... "Harold E. Varmus - Nobel Lecture: Retroviruses and Oncogenes I". nobelprize.org.. *^ The Lasker Foundation - 1982 Basic Medical ...
... has been shown to interact with the protein product of the c-Met oncogene, identified as the HGF ... "Identification of the hepatocyte growth factor receptor as the c-met proto-oncogene product". Science. 251 (4995): 802-4. ... protein binding. • identical protein binding. • chemoattractant activity. • protein heterodimerization activity. • growth ... positive regulation of protein kinase B signaling. • positive regulation of protein phosphorylation. • cytokine-mediated ...
Neoplasm: Tumor suppressor genes/proteins and Oncogenes/Proto-oncogenes. Ligand. Growth factors. ... protein binding. • cyclin-dependent protein serine/threonine kinase inhibitor activity. • ubiquitin protein ligase binding. • ... cyclin-dependent protein serine/threonine kinase activity. • protein kinase inhibitor activity. • protein kinase binding. • ... This article is about the p21Cip1 protein. For the p21/ras protein, see Ras (protein). For other uses, see P21 (disambiguation) ...
... a proto-oncogene expressed in neurons in response to stimulation by hormones and neurotransmitters.[17] Expression of c-Fos in ... 1988). "Expression of c-fos protein in brain: metabolic mapping at the cellular level". Science. 240 (4857): 1328-1332. Bibcode ...
... and the scaffold protein FIP200. Class III PI3K complex, containing hVps34, Beclin-1, p150 and Atg14-like protein or ... The BCR-ABL oncogene has been found to be involved in the development of cancer in humans. c-Myc is involved in the regulation ... which began to invade their proto-eukaryotic hosts. This process is still evident today, between human white blood cells and ... It has also been shown that in mice null for the proapoptotic factor Bax (Bcl-2-associated X protein) a larger percentage of ...
EN) MeSH Myc proto-oncogene proteins. *. (EN) JoVE: Generating iPS Cells from MEFS through Forced Expression of Sox-2, Oct-4, c ... The proto-oncogene c-myc in hematopoietic development and leukemogenesis (PDF), in Oncogene, vol. 21, nº 21, 13 maggio 2002, pp ... Rob M Ewing, Chu Peter, Elisma Fred, Li Hongyan, Taylor Paul, et al., Large-scale mapping of human protein-protein interactions ... Interactions of the DNA mismatch repair proteins MLH1 and MSH2 with c-MYC and MAX (PDF), in Oncogene, vol. 22, nº 6, febbraio ...
Franke TF, Kaplan DR, Cantley LC, Toker A (January 1997). "Direct regulation of the Akt proto-oncogene product by ... October 2004). "A rapid method for determining protein kinase phosphorylation specificity". Nat. Methods. 1 (1): 27-9. doi: ... Use of Oriented Peptide Libraries to determine phosphopeptide binding specificity and protein kinase substrate specificity[edit ... 2.2 Use of Oriented Peptide Libraries to determine phosphopeptide binding specificity and protein kinase substrate specificity ...
Neoplasm: Tumor suppressor genes/proteins and Oncogenes/Proto-oncogenes. Ligand. Growth factors. ... SH3 domain-mediated protein-protein interaction blocking drug". Oncogene. 21 (13): 2037-50. doi:10.1038/sj.onc.1205271. PMID ... protein binding. • ankyrin binding. • gamma-catenin binding. • beta-catenin binding. • GTPase activating protein binding. • ... Several proteins such as SNAI1/SNAIL,[58][59] ZFHX1B/SIP1,[60] SNAI2/SLUG,[61][62] TWIST1[63] and DeltaEF1[64] have been found ...
Nishida K, Kaziro Y, Satoh T (1999). "Association of the proto-oncogene product dbl with G protein betagamma subunits". FEBS ... protein complex binding. • signal transducer activity. • protein binding. • GTPase activity. • GTPase binding. • G-protein ... protein heterotrimerization. • Wnt signaling pathway, calcium modulating pathway. • protein folding. • G-protein coupled ... Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 is a protein that in humans is encoded by the GNB1 gene.[5] ...
... analyses of c-Jun and DJ-1 proto-oncogenes". Cytogenetic and Genome Research 127 (2-4): 79-93. doi:10.1159/000297715. PMID ... "Sister group relationship of turtles to the bird-crocodilian clade revealed by nuclear DNA-coded proteins". Molecular Biology ...
... proto-oncogene activation and inhibition of tumour suppressor genes. SCLC may originate from neuroendocrine cells located in ... The DNA contains the information on how the cell function; in practice, it contains the recipes for protein synthesis. If the ...
Mutations in the K-ras proto-oncogene are responsible for 10-30% of lung adenocarcinomas.[56][57] About 4% of non-small-cell ... Other immunotherapy treatments interfere with the binding of programmed cell death 1 (PD-1) protein with its ligand PD-1 ligand ... Similar to many other cancers, lung cancer is initiated by activation of oncogenes or inactivation of tumor suppressor genes.[ ... implicated stem cells include club cells and neuroepithelial cells that express club cell secretory protein. Small-cell lung ...
Some genes are oncogenes: they are overexpressed in colorectal cancer. For example, genes encoding the proteins KRAS, RAF, and ... and activates the transcription of proto-oncogenes. These genes are normally important for stem cell renewal and ... which produces the APC protein. The APC protein prevents the accumulation of β-catenin protein. Without APC, β-catenin ... The p53 protein, produced by the TP53 gene, normally monitors cell division and kills cells if they have Wnt pathway defects. ...
Myb proto-oncogene protein also known as transcriptional activator Myb is a protein that in humans is encoded by the MYB gene.[ ... Myb proto-oncogene protein is a member of the MYB (myeloblastosis) family of transcription factors. The protein contains three ... Jacobs SM, Gorse KM, Westin EH (1994). "Identification of a second promoter in the human c-myb proto-oncogene". Oncogene. 9 (1 ... Favier D, Gonda TJ (1994). "Detection of proteins that bind to the leucine zipper motif of c-Myb". Oncogene. 9 (1): 305-11. ...
ret+Proto-Oncogene+Proteins at the US National Library of Medicine Medical Subject Headings (MeSH) ... protein kinase activity. • kinase activity. • protein binding. • protein tyrosine kinase activity. • ATP binding. • Ras guanyl- ... "Characterization of the ret proto-oncogene products expressed in mouse L cells". Oncogene. 8 (11): 2925-2929. PMID 8414495.. ... "Characterization of RET proto-oncogene 3' splicing variants and polyadenylation sites: a novel C-terminus for RET". Oncogene. ...
Proto-oncogene tyrosine-protein kinase ROS is an enzyme that in humans is encoded by the ROS1 gene.[5][6] ... protein; it is encoded by the c-ros oncogene and was first identified in 1986.[7][8][9][10] The exact role of the ROS1 protein ... The protein encoded by this gene is a type I integral membrane protein with tyrosine kinase activity. The protein may function ... protein kinase activity. • kinase activity. • GO:0001948 protein binding. • transmembrane receptor protein tyrosine kinase ...
Li J, Witte DP, Van Dyke T, Askew DS (April 1997). "Expression of the putative proto-oncogene His-1 in normal and neoplastic ... The protein SPAR has been found to be encoded by a lncRNA in mice and humans, and in vivo has biologically significant function ... In the broad sense, this mechanism allows the cell to harness RNA-binding proteins, which make up one of the largest classes ... However, very recent research has shown that some lncRNAs have been misannotated and do in fact encode proteins. A recent study ...
... is specific for the TK domain in abl (the Abelson proto-oncogene), c-kit and PDGF-R (platelet-derived growth factor ... Binding proteins: IGFBP (1, 2, 3, 4, 5, 6, 7). *Cleavage products/derivatives with unknown target: Glypromate (GPE, (1-3)IGF-1) ... In chronic myelogenous leukemia, the Philadelphia chromosome leads to a fusion protein of abl with bcr (breakpoint cluster ... Medical experience with imatinib overdose is limited.[23] Treatment is supportive.[23] Imatinib is highly plasma protein-bound: ...
Patricia F. Dimond, Getting Around "Undruggable" Proto-Oncogenes, Genetic Engineering & Biotechnology News ... DNA to produce proteins that can be used for their medical properties.[13] In 2013 Verdine also founded the Gloucester Marine ... Verdine received a research grants to study cell-penetrating mini-proteins in order to target cancer cells.[3] His work has led ...
Mutations in tumour suppressor genes or proto-oncogenes can predispose an individual to developing tumours.[15] It is estimated ... This editing system induces a double stranded break in the DNA, using a guide RNA and effector protein Cas9 to break the DNA ... 16] These mutations make a person susceptible to tumour development if the other copy of the oncogene is randomly mutated. ... protein, then their children have a 25% of inheriting the disease.[23] If a child has 1 mutated copy of CFTR, they will not ...
The proto-oncogene c-myc in hematopoietic development and leukemogenesis". Oncogene. 21 (21): 3414-21. PMID 12032779. doi: ... 1986). „Immunochemical detection of proteins related to the human c-myc exon 1". EMBO J. 5 (9): 2241-50. PMC 1167107 . PMID ... Bernstein PL, Herrick DJ, Prokipcak RD, Ross J (1992). „Control of c-myc mRNA half-life in vitro by a protein capable of ... Showe LC, Moore RC, Erikson J, Croce CM (1987). „MYC oncogene involved in a t(8;22) chromosome translocation is not altered in ...
Recent evidence also indicates that several genes (including the proto-oncogene c-myc) have G-quadruplex motifs as potential ... Chaperone proteins are three times more likely, and mitochondrial genes are more than twice as likely. Many basic housekeeping ... Identifying a Protein Binding Sites on DNA molecule YouTube tutorial video. *Pleiades Promoter Project - a research project ... In the case of a transcription factor binding site, there may be a single sequence that binds the protein most strongly under ...
We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their ... InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites ... GO:0004672 protein kinase activity GO:0004713 protein tyrosine kinase activity GO:0004714 transmembrane receptor protein ... GO:0006468 protein phosphorylation GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway ...
Proto-oncogene tyrosine-protein kinase Src, also known as proto-oncogene c-Src, or simply c-Src (cellular Src; pronounced "sarc ... Proto-oncogene tyrosine-protein kinase Src) at the PDBe-KB. Biology portal. ... This proto-oncogene may play a role in the regulation of embryonic development and cell growth. When src is activated, it ... Eventually this normal gene mutated into an abnormally functioning oncogene within the Rous sarcoma virus. Once the oncogene is ...
... and ProteinsProteinsIntracellular Signaling Peptides and ProteinsMAP Kinase Kinase Kinasesraf KinasesProto-Oncogene Proteins A- ... Proto-Oncogene Proteins A-raf. A raf kinase subclass expressed primarily in non-neuronal tissues such as SKELETAL MUSCLE. The A ... Proto-Oncogene Proteins c-raf (1989-2004). All MeSH CategoriesChemicals and Drugs CategoryAmino Acids, Peptides, ... Proteins A-raf, Proto-Oncogene. *Proto Oncogene Proteins A raf. *A-raf Protein Kinase ...
... and ProteinsProteinsNeoplasm ProteinsOncogene ProteinsProto-Oncogene ProteinsProto-Oncogene Proteins c-bcl-6 ... and ProteinsProteinsDNA-Binding ProteinsProto-Oncogene Proteins c-bcl-6 ... and ProteinsProteinsTranscription FactorsProto-Oncogene Proteins c-bcl-6 ... Proto-Oncogene Proteins c-bcl-6. A DNA-binding protein that contains an N-terminal BTB (POZ) DOMAIN and C-terminal CYS2-HIS2 ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... This protein in other organisms (by gene name): P01106 - Homo sapiens 10 * A8WFE7 - Homo sapiens no matching PDB entries ... Protein disorder predictions are based on JRONN (Troshin, P. and Barton, G. J. unpublished), a Java implementation of RONN * ... The Protein Feature View requires a browser that supports SVG (Scalable Vector Graphics). Mouse over tracks and labels for more ...
Myc proto-oncogene protein. Details. Name. Myc proto-oncogene protein. Kind. protein. Organism. Humans. Polypeptides. Name. ... Myc proto-oncogene protein. P01106. Details. Drug Relations. Drug Relations. DrugBank ID. Name. Drug group. Pharmacological ...
Genomes and Genes about proto oncogene proteins c myc ... proteins , dna binding proteins , proto oncogene proteins c myc ... proto oncogene proteins c myc. Summary. Summary: Cellular DNA-binding proteins encoded by the c-myc genes. They are normally ... proto oncogene proteins c bcl 2*cell cycle*cultured tumor cells*genetic transcription*neoplastic cell transformation*gene ... cell cycle proteins*nuclear proteins*reverse transcriptase polymerase chain reaction*biological tumor markers*transfection*gene ...
Proto-oncogene vavAdd BLAST. 845. Amino acid modifications. Feature key. Position(s). DescriptionActions. Graphical view. ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ... Proto-oncogene. ,p>This section describes post-translational modifications (PTMs) and/or processing events.,p>,a href=/help/ ... Pfam protein domain database. More...Pfami. View protein in Pfam. PF00130, C1_1, 1 hit. PF11971, CAMSAP_CH, 1 hit. PF00169 ...
Myc proto-oncogene protein. Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39, bHLHe39) (Proto-oncogene c- ... Myc proto-oncogene protein (V-myc myelocytomatosis viral oncogene homolog (Avian), isoform CRA_b) ... Myc proto-oncogene proteinImported. ,p>Information which has been imported from another database using automatic procedures.,/p ... tr,Q14899,Q14899_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1 ...
A Cell Number Counting Factor Regulates Akt/Protein Kinase B To Regulate Dictyostelium discoideum Group Size Tong Gao, David ...
Products of proto-oncogenes. Normally they do not have oncogenic or transforming properties, but are involved in the regulation ... Proto Oncogene Proteins; Proto-Oncogene Proteins, Cellular; c onc Proteins; Cellular Proto-Oncogene Proteins; c-onc Proteins ... Proto Oncogene Proteins, Cellular; Proto-Oncogene Products, Cellular; Cellular Proto Oncogene Proteins; Cellular Proto-Oncogene ... Proto-Oncogene Proteins. Subscribe to New Research on Proto-Oncogene Proteins Products of proto-oncogenes. Normally they do not ...
The Hepatitis C Virus Core Protein Contains a BH3 Domain That Regulates Apoptosis through Specific Interaction with Human Mcl-1 ... Induces the Nucleolar Targeting of the Kaposis Sarcoma-Associated Herpesvirus KS-Bcl-2 Protein Inna Kalt, Tatyana Borodianskiy ...
Proto-oncogene tyrosine-protein kinase Src, also known as proto-oncogene c-Src or simply c-Src , is a non-receptor tyrosine ... This proto-oncogene may play a role in the regulation of embryonic development and cell growth. ... This proto-oncogene may play a role in the regulation of embryonic development and cell growth. ... This protein phosphorylates specific tyrosine residues in other proteins. c-Src stands for "cellular Src kinase" and should not ...
"Proto-Oncogene Proteins c-myc" by people in Harvard Catalyst Profiles by year, and whether "Proto-Oncogene Proteins c-myc" was ... "Proto-Oncogene Proteins c-myc" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH ( ... Proto-Oncogene Proteins c-myc*Proto-Oncogene Proteins c-myc. *Proto Oncogene Proteins c myc ... Below are the most recent publications written about "Proto-Oncogene Proteins c-myc" by people in Profiles. ...
Up-regulation of the angiotensin II type 1 receptor by the MAS proto-oncogene is due to constitutive activation of Gq/G11 by ... The MAS proto-oncogene is not imprinted in humans. Riesewijk, A.M., Schepens, M.T., Mariman, E.M., Ropers, H.H., Kalscheuer, V. ... Cell type-specific expression of the Mas proto-oncogene in testis. Alenina, N., Baranova, T., Smirnow, E., Bader, M., Lippoldt ... The mammalian proto-oncogene MAS has been identified as a novel neuronal angiotensin receptor, which responds preferentially to ...
Proto-Oncogene Protein c-fli-1*Proto-Oncogene Protein c-fli-1 ... Proto-Oncogene Protein c-ets-2. *Proto-Oncogene Protein c-fli-1 ... "Proto-Oncogene Protein c-fli-1" by people in Harvard Catalyst Profiles by year, and whether "Proto-Oncogene Protein c-fli-1" ... "Proto-Oncogene Protein c-fli-1" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH ( ... Below are the most recent publications written about "Proto-Oncogene Protein c-fli-1" by people in Profiles. ...
Ras-related protein Ral-B, RALB.. Introduction. Ras-related protein Ral-B (RALB) is a member of a subfamily of Ras-related ... For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).. Avoid multiple freeze-thaw cycles. ... RALB is activated by a unique nucleotide exchange factor, Ral GDS, and deactivated by a distinct GTPase-activating protein. ...
E3 ubiquitin protein ligase L homeolog Antibody Products from leading suppliers on Biocompare. View specifications, prices, ... Anti-Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase L homeolog Antibody Products. Clear ... Anti-Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase L homeolog Antibody Products. ... Anti-Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase L homeolog Antibody Products. ...
Proto-oncogene tyrosine-protein kinase MER. A, B, C, D. 313. Homo sapiens. Mutation(s): 0 Gene Names: MERTK, MER. EC: 2.7.10.1 ... Crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor C52. *DOI: ... Although Mer adaptor proteins and signaling pathways have been identified, it remains unclear how Mer initiates phagocytosis. ... The mammalian ortholog of the retroviral oncogene v-Eyk, and a receptor tyrosine kinase upstream of antiapoptotic and ...
Browsing by Subject "Proto-Oncogene Proteins c-kit". 0-9. A. B. C. D. E. F. G. H. I. J. K. L. M. N. O. P. Q. R. S. T. U. V. W. ...
The serine/threonine protein kinase encoded by the Akt proto-oncogene is catalytically inactive in serum-starved primary and ... The protein kinase encoded by the Akt proto-oncogene is a target of the PDGF-activated phosphatidylinositol 3-kinase Cell. 1995 ... The serine/threonine protein kinase encoded by the Akt proto-oncogene is catalytically inactive in serum-starved primary and ... Proto-Oncogene Proteins / drug effects * Proto-Oncogene Proteins / metabolism* * Proto-Oncogene Proteins c-akt ...
Showing Protein Proto-oncogene tyrosine-protein kinase Yes (HMDBP01230). IdentificationBiological propertiesGene properties ... Protein Sequence. ,Proto-oncogene tyrosine-protein kinase Yes MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT ... Involved in protein kinase activity. Specific Function. Promotes infectivity of Neisseria gonorrhoeae in epithelial cells by ... Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by ...
Showing Protein Proto-oncogene tyrosine-protein kinase Src (HMDBP01147). IdentificationBiological propertiesGene properties ... Protein Sequence. ,Proto-oncogene tyrosine-protein kinase Src MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE ... Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by ... Franco M, Furstoss O, Simon V, Benistant C, Hong WJ, Roche S: The adaptor protein Tom1L1 is a negative regulator of Src ...
Proto Oncogene Tyrosine Protein Kinase ROS {Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros ... Proto Oncogene Tyrosine Protein Kinase ROS (Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros ... Proto Oncogene Tyrosine Protein Kinase ROS (Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros ... 872037-proto-oncogene-tyrosine-protein-kinase-ros-proto-oncogene-c-ros-1-or-receptor-tyrosine-kinase-c-ros-oncogene-1-or-c-ros- ...
Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68. Maria Paola Paronetto, ... Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68 ... Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68 ... Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68 ...
In this report, the global RAF Proto Oncogene Serine/Threonine... ... 108 Pages Report] Check for Discount on Global RAF Proto ... Oncogene Serine/Threonine Protein Kinase Market Research Report 2018 report by QYResearch Group. ... Figure Picture of RAF Proto Oncogene Serine/Threonine Protein Kinase. Figure Global RAF Proto Oncogene Serine/Threonine Protein ... of RAF Proto Oncogene Serine/Threonine Protein Kinase (2013-2025). 1.5.1 Global RAF Proto Oncogene Serine/Threonine Protein ...
"Proto-Oncogene Proteins c-rel" by people in this website by year, and whether "Proto-Oncogene Proteins c-rel" was a major or ... "Proto-Oncogene Proteins c-rel" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH ( ... Proto-Oncogene Proteins c-rel*Proto-Oncogene Proteins c-rel. *Proto Oncogene Proteins c rel ... Below are the most recent publications written about "Proto-Oncogene Proteins c-rel" by people in Profiles. ...
Myc Proto Oncogene Protein Transcription Factor p64 or Class E Basic Helix Loop Helix Protein 39 or MYC Pipeline Review, H1 ... According to the recently published report Myc Proto Oncogene Protein Pipeline Review, H1 2018; Myc Proto Oncogene Protein ... Myc Proto Oncogene Protein Pipeline Review, H1 2018 outlays comprehensive information on the Myc Proto Oncogene Protein ... Serine/Threonine Protein Kinase A Raf Proto Oncogene A Raf or Proto Oncogene Pks or ARAF or EC 2.7.11.1 Pipeline Review, H2 ...
What is B-Raf proto-oncogene serine/threonine-protein kinase? Meaning of B-Raf proto-oncogene serine/threonine-protein kinase ... What does B-Raf proto-oncogene serine/threonine-protein kinase mean? ... B-Raf proto-oncogene serine/threonine-protein kinase explanation free. ... Looking for online definition of B-Raf proto-oncogene serine/threonine-protein kinase in the Medical Dictionary? ...
Proto Oncogene Syn or Proto Oncogene c Fyn or Src Like Kinase or p59 Fyn or FYN or EC 2.7.10.2) - Pipeline Review, H1 2018 ... Tyrosine Protein Kinase Fyn (Proto Oncogene Syn or Proto Oncogene c Fyn or Src Like Kinase or p59 Fyn or FYN or EC 2.7.10.2) - ... Proto Oncogene Syn or Proto Oncogene c Fyn or Src Like Kinase or p59 Fyn or FYN or EC 2.7.10.2) - Proto-oncogene tyrosine- ... Tyrosine Protein Kinase Fyn (Proto Oncogene Syn or Proto Oncogene c Fyn or Src Like Kinase or p59 Fyn or FYN or EC 2.7.10.2) - ...
  • c-Src can be activated by many transmembrane proteins that include: adhesion receptors, receptor tyrosine kinases, G-protein coupled receptors and cytokine receptors. (wikipedia.org)
  • adhesion receptors , receptor tyrosine kinases , G-protein coupled receptors and cytokine receptors . (wikidoc.org)
  • Gab2 is tyrosine-phosphorylated upon activation of a variety of growth factor, hormone, antigen, cytokine and cell matrix receptors, leading to the recruitment of specific src homology (SH)2 domain-containing effectors, which include the p85 subunit of phosphatidylinositol (PI)3-kinase and the protein tyrosine phosphatase Shp2. (biomedcentral.com)
  • One critical event in Gab2 signalling is its interaction with the adaptor protein Grb2, which promotes its association with specific receptors and thereby sustains its tyrosine phosphorylation dependent recruitment of the aforementioned effectors. (biomedcentral.com)
  • At the top of the diagram are the receptors and messengers to the three RAS proteins. (cancer.gov)
  • The homolog of the Evi-1 oncogene, egl-43, is necessary for basement membrane destruction and anchor cell invasion. (biomedsearch.com)
  • A gene on chromsome 7q34 that encodes a protein of the raf/mil family of serine/threonine protein kinases, which plays a role in regulating the MAP kinase/ERKs-signalling pathway, affecting cell division, differentiation and secretion. (thefreedictionary.com)
  • The c-src proto-oncogene encodes a protein tyrosine kinase. (proteopedia.org)
  • This gene encodes a protein with one SAP domain. (wikipedia.org)
  • Cellular DNA-binding proteins encoded by the c-myc genes. (labome.org)
  • Myc protein is a transcription factor that activates expression of many genes through binding enhancer box sequences and recruiting histone acetyltransferases. (bioportfolio.com)
  • c-fos combines with c-jun (PROTO-ONCOGENE PROTEINS C-JUN) to form a c-fos/c-jun heterodimer (TRANSCRIPTION FACTOR AP-1) that binds to the TRE (TPA-responsive element) in promoters of certain genes. (childrensmercy.org)
  • The MYCN protein regulates the activity of other genes by attaching (binding) to specific regions of DNA and controlling the first step of protein production (transcription). (medlineplus.gov)
  • The MYCN gene belongs to a class of genes known as oncogenes. (medlineplus.gov)
  • As a result, only half the normal amount of this protein is available to control the activity of specific genes during development. (medlineplus.gov)
  • WNT genes provide instructions for making proteins that participate in chemical signaling pathways in the body. (medlineplus.gov)
  • PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. (cancerindex.org)
  • GH-stimulated activation of signal transducers and activators of transcription (STATs), mitogen activated protein kinase (MAPK) and phosphatidylinositol 3' kinase (PI3K) cascades have been shown to regulate the transcription of GH-responsive genes. (biomedsearch.com)
  • Although Mer adaptor proteins and signaling pathways have been identified, it remains unclear how Mer initiates phagocytosis. (rcsb.org)
  • The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. (genecards.org)
  • Anne Goriely ( [email protected]) suggested adding the MRAS (RRAS3) -SHOC2.PPP1CA pathways that activate RAF kinase and ERF, an ETS-family protein that inhibits ERK1 (aka MAPK3) and 2 (MAPK1). (cancer.gov)
  • What pathways are this gene/protein implicaed in? (cancerindex.org)
  • Myc Proto Oncogene Protein Transcription Factor p64 or Class E Basic Helix Loop Helix Protein 39 or MYC pipeline Target constitutes close to 13 molecules. (bioportfolio.com)
  • Myc Proto Oncogene Protein Transcription Factor p64 or Class E Basic Helix Loop Helix Protein 39 or MYC Myc cMyc protein encoded by Myc gene, a regulator gene that code for a transcription factor. (bioportfolio.com)
  • It also reviews key players involved in Myc Proto Oncogene Protein Transcription Factor p64 or Class E Basic Helix Loop Helix Protein 39 or MYC targeted therapeutics development with respective active and dormant or discontinued projects. (bioportfolio.com)
  • The encoded protein forms a heterodimer with the related transcription factor MAX. (nih.gov)
  • On the basis of this action, this protein is called a transcription factor. (medlineplus.gov)
  • The C1orf173 protein in humans is 1,530 amino acids (aa) in length and contains two domains of unknown function, DUF4590 and DUF4543. (wikipedia.org)
  • Previous studies have reported that proteins with a high content of glutamate (E) and/or aspartate (D), amino acids with acidic side chains, can display higher apparent MW values during Western blot analysis than would be predicted. (wikipedia.org)
  • They often have protein kinase activity. (curehunter.com)
  • phospho-TYR416 then alters the conformation of this loop, resulting in a dramatic increase in protein kinase activity. (proteopedia.org)
  • p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence. (uniprot.org)
  • Myc Proto-Oncogene Protein 2018 Market Research Report was a professional and depth research report on Myc Proto-Oncogene Protein that you would know the world's major regional market conditions of Myc Proto-Oncogene Protein main region including North American, Europe and Asia etc, and the main country including USA, EU, China, South East Asia, India, Japan and etc. (theinnovativereport.com)
  • PP2 is a ATP-competitive inhibitor of the Src family of protein tyrosine kinases. (csnpharm.com)
  • p>This section provides any useful information about the protein, mostly biological knowledge. (uniprot.org)
  • MBS077112 is a ready-to-use microwell, strip plate Sandwich (Quantitative) ELISA (enzyme-linked immunosorbent assay) Kit for analyzing the presence of the C-Raf Proto Oncogene Serine/Threonine Protein Kinase (CRAF) ELISA Kit target analytes in biological samples. (mybiosource.com)
  • Each article introduces a different protein, exploring its biological function as it relates to other members of the protein family, examining common domain architectures and their biological distribution, and tying it in to a broader perspective on how the protein impacts today's medicine and the environment. (ebi.ac.uk)
  • The articles also serve as an introduction to the use of the InterPro database, exploring the relevant InterPro entries for each featured protein in detail, and relating them to the biological information discussed in the article. (ebi.ac.uk)
  • This study investigates whether or not an interrelationship exists between the expression of resistance-related proteins (P-glycoprotein, glutathione S-transferase, topoisomerase II) and proto-oncogene products (c-fos, c-myc, c-K-ras, epidermal growth factor receptor [EGF-R], and c-neu proteins. (curehunter.com)
  • p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later. (uniprot.org)
  • Serine/Threonine Protein Kinase A Raf (Proto Oncogene A Raf or Proto Oncogene Pks or ARAF or EC 2.7.11.1) pipeline Target constitutes close to 5 molecules. (marketresearch.com)
  • Serine/Threonine Protein Kinase A Raf (Proto Oncogene A Raf or Proto Oncogene Pks or ARAF or EC 2.7.11.1) - Serine/threonine-protein kinase A-Raf is an enzyme that in humans is encoded by the ARAF gene. (marketresearch.com)
  • It also reviews key players involved in Serine/Threonine Protein Kinase A Raf (Proto Oncogene A Raf or Proto Oncogene Pks or ARAF or EC 2.7.11.1) targeted therapeutics development with respective active and dormant or discontinued projects. (marketresearch.com)
  • Global Markets Direct's, 'Serine/Threonine-Protein Kinase A-Raf (A-Raf Kinase or Proto-Oncogene A-Raf or Proto-Oncogene Pks or EC 2.7.11.1) - Pipeline Review, H1 2016', provides in depth analysis on Serine/Threonine-Protein Kinase A-Raf (A-Raf Kinase or Proto-Oncogene A-Raf or Proto-Oncogene Pks or EC 2.7.11.1) targeted pipeline therapeutics. (gosreports.com)
  • Additionally, the report provides an overview of key players involved in Serine/Threonine-Protein Kinase A-Raf (A-Raf Kinase or Proto-Oncogene A-Raf or Proto-Oncogene Pks or EC 2.7.11.1) targeted therapeutics development and features dormant and discontinued projects. (gosreports.com)
  • pronounced "sarc", as it is short for sarcoma), is a non-receptor tyrosine kinase protein that in humans is encoded by the SRC gene. (wikipedia.org)
  • Eventually this normal gene mutated into an abnormally functioning oncogene within the Rous sarcoma virus. (wikipedia.org)
  • Similarly, c-Src should not be mistaken for v-Src , a viral (hence the prefix v- ) gene that shares similarity with c-Src and is also an oncogene, which can be found in Rous sarcoma virus . (wikidoc.org)
  • Src (pronounced "sarc" as it is short for sarcoma ) is a proto-oncogene encoding a tyrosine kinase originally discovered by J. Michael Bishop and Harold E. Varmus , for which they were awarded the 1989 Nobel Prize in Physiology or Medicine . (wn.com)
  • The v-src oncogene of the Rous sarcoma virus encodes a mutated, activated form of this enzyme. (proteopedia.org)
  • Following activation by PKA, the protein subsequently associates with PTK2/FAK1, allowing PTK2/FAK1 phosphorylation, activation and targeting to focal adhesions. (researchandmarkets.com)
  • A protein-serine-threonine kinase that is activated by PHOSPHORYLATION in response to GROWTH FACTORS or INSULIN. (rush.edu)
  • Furthermore, we demonstrate that growth factor-induced and PI3K-dependent phosphorylation of Gab2 on two of these novel residues, S210 and T391, leads to recruitment of 14-3-3 proteins. (biomedcentral.com)
  • In this regard, the phosphorylation of TYR527 by another protein kinase (CSK) results in the inactivation of C-SRC. (proteopedia.org)
  • The serine/threonine protein kinase encoded by the Akt proto-oncogene is catalytically inactive in serum-starved primary and immortalized fibroblasts. (nih.gov)
  • In this report, the global RAF Proto Oncogene Serine/Threonine Protein Kinase market is valued at USD XX million in 2017 and is expected to reach USD XX million by the end of 2025, growing at a CAGR of XX% between 2017 and 2025. (reportsnreports.com)
  • Your search returned 72 B-Raf proto-oncogene, serine/threonine kinase ELISA ELISA Kit across 10 suppliers. (biocompare.com)
  • The name derives from viral oncogene-derived protein oncogene protein v-ets of the AVIAN ERYTHROBLASTOSIS VIRUS. (uchicago.edu)
  • CRK (CRK Proto-Oncogene, Adaptor Protein) is a Protein Coding gene. (genecards.org)
  • A new independent 61 page research with title 'Proto Oncogene Tyrosine Protein Kinase ROS {Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros Receptor Tyrosine Kinase or ROS1 or EC 2.7.10.1} - Pipeline Review, H2 2017' guarantees you will remain better informed than your competition. (medgadget.com)
  • The latest report Proto Oncogene Tyrosine Protein Kinase ROS - Pipeline Review, H2 2017, outlays comprehensive information on the Proto Oncogene Tyrosine Protein Kinase ROS (Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros Receptor Tyrosine Kinase or ROS1 or EC 2.7.10.1) targeted therapeutics, complete with analysis by indications, stage of development, mechanism of action (MoA), route of administration (RoA) and molecule type. (medgadget.com)
  • In this study we show that the product of the human trk proto-oncogene (gp140trk) binds NGF with high affinity. (nih.gov)
  • This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. (genecards.org)
  • domain of C-SRC binds to the SH2 domain of C-SRC, thereby helping to stabilize the conformation of the entire protein. (proteopedia.org)
  • The protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA. (wikipedia.org)
  • Cancer cells are resistant to apoptosis but "primed for death" by elevated BCL-2, which binds to pro-apoptotic proteins and holds them in check. (nih.gov)
  • Proto-oncogene tyrosine-protein kinase Src , also known as proto-oncogene c-Src or simply c-Src , is a non-receptor tyrosine kinase protein that in humans is encoded by the SRC gene . (wikidoc.org)
  • Proto Oncogene Tyrosine Protein Kinase ROS (Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros Receptor Tyrosine Kinase or ROS1 or EC 2.7.10.1) - Proto-oncogene tyrosine-protein kinase ROS is an enzyme that in humans is encoded by the ROS1 gene. (medgadget.com)
  • The nuclear receptor coactivator 2 also known as NCoA-2 is a protein that in humans is encoded by the NCOA2 gene . (wn.com)
  • There are currently three known isoforms of the C1orf173 protein in humans, Q5RHP9-1 (canonical), Q5RHP9-2 and Q5RHP9-3. (wikipedia.org)
  • Gene Ontology (GO) annotations related to this gene include G protein-coupled receptor activity and peptide hormone binding . (genecards.org)
  • NCoA-2 is also frequently called glucocorticoid receptor-interacting protein 1 ( GRIP1 ), steroid receptor coactivator-2 ( SRC-2 ), or transcriptional mediators/intermediary factor 2 ( TIF2 ). (wn.com)
  • NCoA-2 is a transcriptional coregulatory protein that contains several nuclear receptor interacting domains and an intrinsic histone acetyltransferase activity. (wn.com)
  • YUHSpace: Eukaryotic translation initiator protein 1A isoform, CCS-3, enhances the transcriptional repression of p21CIP1 by proto-oncogene FBI-1 (Pokemon/ZBTB7A). (yonsei.ac.kr)
  • Elevated and deregulated (constitutive) expression of c-myc proteins can cause tumorigenesis. (labome.org)
  • Thirty-eight human renal cell carcinomas of previously untreated patients were analyzed for expression of P-glycoprotein (P-170), glutathione S-transferase-pi (GST-pi), topoisomerase II (Topo II) and proto-oncogene proteins by means of immunohistochemistry. (curehunter.com)
  • In this study, we report that Sam68, an RNA-binding protein frequently overexpressed in prostate cancer cells, enhances splicing of cyclin D1b and supports its expression in prostate cancer cells. (aacrjournals.org)
  • This study sought to examine the effects of c-H- ras and c- myc expression in the steady-state myocardium on hypertrophic changes and to evaluate the possible interaction between β-MHC mutation and proto-oncogene expression in HCM. (ahajournals.org)
  • The proto-oncogene expression did not affect clinical findings, myocardial fibrosis, or disarray. (ahajournals.org)
  • It is possible that β-MHC gene mutation has some effect on the regulation of proto-oncogene expression in HCM. (ahajournals.org)
  • 7 Various kinds of hypertrophic stimuli and mechanical stretch have been shown to induce cardiomyocyte hypertrophy and gene expression via the intracellular signaling pathway, including Ras-dependent mitogen-activated protein kinase cascade. (ahajournals.org)
  • 12 14 15 Although immunoreactivity for Myc was found in the myocardium in some of the HCM patients, 16 little is known about the pathogenetic significance of the expression of these proto-oncogenes in the myocardium of HCM patients. (ahajournals.org)
  • Furthermore, it is possible that the mutations of the sarcomeric proteins have some effect on the expression of the proto-oncogenes, which might contribute to the development of cardiac hypertrophy in HCM. (ahajournals.org)
  • The aims of the present study were (1) to examine whether c-H- ras and c- myc are expressed at the mRNA levels in the steady-state myocardium of HCM patients, (2) to determine whether the proto-oncogene expression has some effects on the phenotypic expression of HCM, and (3) to evaluate the possible interaction between the sarcomeric protein mutation and the proto-oncogene expression. (ahajournals.org)
  • Analysis of proto-oncogene and heat-shock protein gene expression in human derived cell-lines exposed in vitro to an intermittent 1.9 GHz pulse-modulated radiofrequency field. (emf-portal.org)
  • Genetic mutations that disrupt the expression of PROTO-ONCOGENE PROTEINS C-KIT are associated with PIEBALDISM, while overexpression or constitutive activation of the c-kit protein-tyrosine kinase is associated with tumorigenesis. (childrensmercy.org)
  • However, neither protein kinase A inhibitor H89 nor calmodulin-dependent protein kinase II inhibitor KN93 attenuated MA-induced alterations in phospho-PKCδ expression and phospho-ERK 1/2 expression. (springer.com)
  • Osteofibrous dysplasia and adamantinoma: correlation of proto-oncogene product and matrix protein expression. (ox.ac.uk)
  • To investigate the relationship between osteofibrous dysplasia (OFD) and adamantinoma, we analyzed the expression of several proto-oncogene products and extracellular matrix proteins by immunohistochemistry and correlated our results with histological and ultrastructural findings. (ox.ac.uk)
  • The results show common expression of a number of oncoproteins and bone matrix proteins in adamantinoma and OFD, some of which are associated with mesenchymal-to-epithelial cell transformation. (ox.ac.uk)
  • Differential expression of a number of bone matrix protein in adamantinoma may also be of diagnostic use in distinguishing these 2 lesions immunohistochemically. (ox.ac.uk)
  • Specifically, the effects of unilateral lesions of nigrostriatal DA neurons on oral dyskinesia and Fos protein expression induced by the non-selective 5-HT(2C) agonist 1-(m-chlorophenyl)piperazine (m-CPP) were examined. (mendeley.com)
  • Scope includes mutations and abnormal protein expression. (cancerindex.org)
  • Chromosomal aberrations involving this region increased expression of this gene and the presence of antibodies against this protein are all associated with various diseases. (wikipedia.org)
  • Nucleotide sequence analysis of cDNA clones showed that the c-syn gene could encode a protein-tyrosine kinase that is very similar in primary structure to the v-yes and human c-src proteins. (elsevier.com)
  • Additionally, the effects of mutations in the human WNT3 gene suggest that the protein may be involved in the normal formation of the facial features, head, heart, lungs, nervous system, skeleton, and genitalia. (medlineplus.gov)
  • The human DEK gene encodes the DEK protein. (wikipedia.org)
  • Myc Proto Oncogene Protein Pipeline Insights, 2021" report by DelveInsight outlays comprehensive insights of present clinical development scenario and growth prospects across the Myc Proto Oncogene Protein market. (haryanadaily.in)
  • Global Myc Proto-Oncogene Protein Market Report 2019 - Market Size, Share, Price, Trend and Forecast is a professional and in-depth study on the current state of the global Myc Proto-Oncogene Protein industry. (theinnovativereport.com)
  • 5.The report estimates 2019-2024 market development trends of Myc Proto-Oncogene Protein industry. (theinnovativereport.com)
  • The protein plays a role in cell cycle progression, apoptosis and cellular transformation. (bioportfolio.com)
  • This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. (nih.gov)
  • RNA modifications impact numerous cellular processes such as pre-mRNA splicing and protein synthesis. (mendeley.com)
  • Since in recent years molecular and cellular en- docrinology has provided particularly important contributions to our knowledge, the European Workshops on Molecular and Celluar Endo- crinology of the Testis, held regularly during even years since 1980, have become a prominent forum for researchers in the field to discuss recent findings and exchange new ideas. (springer.com)
  • This proto-oncogene may play a role in the regulation of embryonic development and cell growth. (wikipedia.org)
  • Regulation of anchor cell invasion and uterine cell fates by the egl-43 Evi-1 proto-oncogene in Caenorhabditis elegans. (biomedsearch.com)
  • Positive regulation of AGTR1 levels occurs through activation of the G-proteins GNA11 and GNAQ, and stimulation of the protein kinase C signaling cascade. (genecards.org)
  • This mutation, which occurs in both copies of the WNT3 gene in each cell, replaces one protein building block (amino acid) with a premature stop signal in the instructions for making the WNT3 protein. (medlineplus.gov)
  • Researchers believe that the Gln83Ter mutation results in the production of an abnormally short, nonfunctional version of the WNT3 protein. (medlineplus.gov)
  • Protein S-K196E mutation (Pros1E/E) is a race-specific genetic risk factor for venous thromboembolism. (bireme.br)
  • Efficient DNA binding requires dimerization with another bHLH protein. (rcsb.org)
  • Src contains at least three flexible protein domains, which, in conjunction with myristoylation, can mediate attachment to membranes and determine subcellular localization. (wikipedia.org)
  • The Myc Proto Oncogene Protein report provides an overview of therapeutic pipeline activity and therapeutic assessment of the products by development stage, product type, route of administration, molecule type, and MOA type for Myc Proto Oncogene Protein across the complete product development cycle, including all clinical and nonclinical stages. (haryanadaily.in)
  • This protein phosphorylates specific tyrosine residues in other protein s. (wikidoc.org)
  • Receptor Tyrosine Protein Kinase ERBB 3 (Proto Oncogene Like Protein c ErbB 3 or Tyrosine Kinase Type Cell Surface Receptor HER3 or HER3 or ERBB3 or EC 2.7.10.1) pipeline Target constitutes close to 25 molecules. (marketresearch.com)
  • Receptor Tyrosine Protein Kinase ERBB 3 (Proto Oncogene Like Protein c ErbB 3 or Tyrosine Kinase Type Cell Surface Receptor HER3 or HER3 or ERBB3 or EC 2.7.10.1) - Receptor tyrosine-protein kinase erbB-3 or HER3 is a membrane bound protein encoded by the ERBB3 gene. (marketresearch.com)
  • It also reviews key players involved in Receptor Tyrosine Protein Kinase ERBB 3 (Proto Oncogene Like Protein c ErbB 3 or Tyrosine Kinase Type Cell Surface Receptor HER3 or HER3 or ERBB3 or EC 2.7.10.1) targeted therapeutics development with respective active and dormant or discontinued projects. (marketresearch.com)
  • Additionally, the report provides an overview of key players involved in Receptor Tyrosine Protein Kinase ERBB 4 (Tyrosine Kinase Type Cell Surface Receptor HER4 or Proto Oncogene Like Protein c ErbB 4 or p180erbB4 or HER4 or ERBB4 or EC 2.7.10.1) targeted therapeutics development and features dormant and discontinued projects. (reportsnreports.com)
  • The report analyses the pipeline products across relevant therapy areas under development targeting Receptor Tyrosine Protein Kinase ERBB 3 (Proto Oncogene Like Protein c ErbB 3 or Tyrosine Kinase Type Cell Surface Receptor HER3 or HER3 or ERBB3 or EC 2.7.10.1). (globalmarketsdirect.com)
  • Receptor Tyrosine Protein Kinase ERBB 4 (Tyrosine Kinase Type Cell Surface Receptor HER4 or Proto Oncogene Like Protein c ErbB 4 or p180erbB4 or HER4 or ERBB4 or EC 2.7.10.1) pipeline guide helps in identifying and tracking emerging players in the market and their portfolios, enhances decision making capabilities and helps to create effective counter strategies to gain competitive advantage. (tallahasseescene.com)
  • The pipeline guide reviews pipeline therapeutics for Receptor Tyrosine Protein Kinase ERBB 4 (Tyrosine Kinase Type Cell Surface Receptor HER4 or Proto Oncogene Like Protein c ErbB 4 or p180erbB4 or HER4 or ERBB4 or EC 2.7.10.1)by companies and universities/research institutes based on information derived from company and industry-specific sources. (tallahasseescene.com)
  • This graph shows the total number of publications written about "Proto-Oncogene Proteins c-myc" by people in Harvard Catalyst Profiles by year, and whether "Proto-Oncogene Proteins c-myc" was a major or minor topic of these publication. (harvard.edu)
  • Below are the most recent publications written about "Proto-Oncogene Proteins c-myc" by people in Profiles. (harvard.edu)
  • Below are the most recent publications written about "Proto-Oncogene Proteins c-akt" by people in Profiles. (rush.edu)
  • This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. (cancerindex.org)