Estradiol Dehydrogenases: Enzymes that catalyze the oxidation of estradiol at the 17-hydroxyl group in the presence of NAD+ or NADP+ to yield estrone and NADH or NADPH. The 17-hydroxyl group can be in the alpha- or beta-configuration. EC 1.1.1.62Secosteroids: Steroids in which fission of one or more ring structures and concomitant addition of a hydrogen atom at each terminal group has occurred.Estradiol: The 17-beta-isomer of estradiol, an aromatized C18 steroid with hydroxyl group at 3-beta- and 17-beta-position. Estradiol-17-beta is the most potent form of mammalian estrogenic steroids.Retinol-Binding Proteins, Cellular: A subclass of retinol-binding proteins that take part in the intracellular storage and transport of RETINOL. They are both functionally and structurally distinct from PLASMA RETINOL-BINDING PROTEINS.L-Lactate Dehydrogenase: A tetrameric enzyme that, along with the coenzyme NAD+, catalyzes the interconversion of LACTATE and PYRUVATE. In vertebrates, genes for three different subunits (LDH-A, LDH-B and LDH-C) exist.Bone Morphogenetic Protein Receptors, Type II: A subtype of bone morphogenetic protein receptors with low affinity for BONE MORPHOGENETIC PROTEINS. They are constitutively active PROTEIN-SERINE-THREONINE KINASES that can interact with and phosphorylate TYPE I BONE MORPHOGENETIC PROTEIN RECEPTORS.Alcohol Dehydrogenase: A zinc-containing enzyme which oxidizes primary and secondary alcohols or hemiacetals in the presence of NAD. In alcoholic fermentation, it catalyzes the final step of reducing an aldehyde to an alcohol in the presence of NADH and hydrogen.Lysosomal-Associated Membrane Protein 2: An abundant lysosomal-associated membrane protein that has been found to shuttle between LYSOSOMES; ENDOSOMES; and the PLASMA MEMBRANE. Loss of expression of lysosomal-associated membrane protein 2 is associated with GLYCOGEN STORAGE DISEASE TYPE IIB.Bone Morphogenetic Protein Receptors, Type I: A subtype of bone morphogenetic protein receptors with high affinity for BONE MORPHOGENETIC PROTEINS. They can interact with and undergo PHOSPHORYLATION by BONE MORPHOGENETIC PROTEIN RECEPTORS, TYPE II. They signal primarily through RECEPTOR-REGULATED SMAD PROTEINS.Retinol-Binding Proteins: Proteins which bind with RETINOL. The retinol-binding protein found in plasma has an alpha-1 mobility on electrophoresis and a molecular weight of about 21 kDa. The retinol-protein complex (MW=80-90 kDa) circulates in plasma in the form of a protein-protein complex with prealbumin. The retinol-binding protein found in tissue has a molecular weight of 14 kDa and carries retinol as a non-covalently-bound ligand.Glyceraldehyde-3-Phosphate Dehydrogenases: Enzymes that catalyze the dehydrogenation of GLYCERALDEHYDE 3-PHOSPHATE. Several types of glyceraldehyde-3-phosphate-dehydrogenase exist including phosphorylating and non-phosphorylating varieties and ones that transfer hydrogen to NADP and ones that transfer hydrogen to NAD.Aldehyde Dehydrogenase: An enzyme that oxidizes an aldehyde in the presence of NAD+ and water to an acid and NADH. This enzyme was formerly classified as EC 1.1.1.70.Glutamate Dehydrogenase: An enzyme that catalyzes the conversion of L-glutamate and water to 2-oxoglutarate and NH3 in the presence of NAD+. (From Enzyme Nomenclature, 1992) EC 1.4.1.2.Glucosephosphate DehydrogenaseMalate Dehydrogenase: An enzyme that catalyzes the conversion of (S)-malate and NAD+ to oxaloacetate and NADH. EC 1.1.1.37.Receptors, Estradiol: Cytoplasmic proteins that bind estradiol, migrate to the nucleus, and regulate DNA transcription.Isocitrate Dehydrogenase: An enzyme of the oxidoreductase class that catalyzes the conversion of isocitrate and NAD+ to yield 2-ketoglutarate, carbon dioxide, and NADH. It occurs in cell mitochondria. The enzyme requires Mg2+, Mn2+; it is activated by ADP, citrate, and Ca2+, and inhibited by NADH, NADPH, and ATP. The reaction is the key rate-limiting step of the citric acid (tricarboxylic) cycle. (From Dorland, 27th ed) (The NADP+ enzyme is EC 1.1.1.42.) EC 1.1.1.41.Smad1 Protein: A receptor-regulated smad protein that undergoes PHOSPHORYLATION by BONE MORPHOGENETIC PROTEIN RECEPTORS. It regulates BONE MORPHOGENETIC PROTEIN signaling and plays an essential role in EMBRYONIC DEVELOPMENT.Alcohol Oxidoreductases: A subclass of enzymes which includes all dehydrogenases acting on primary and secondary alcohols as well as hemiacetals. They are further classified according to the acceptor which can be NAD+ or NADP+ (subclass 1.1.1), cytochrome (1.1.2), oxygen (1.1.3), quinone (1.1.5), or another acceptor (1.1.99).Dihydrolipoamide Dehydrogenase: A flavoprotein containing oxidoreductase that catalyzes the reduction of lipoamide by NADH to yield dihydrolipoamide and NAD+. The enzyme is a component of several MULTIENZYME COMPLEXES.Carbohydrate Dehydrogenases: Reversibly catalyze the oxidation of a hydroxyl group of carbohydrates to form a keto sugar, aldehyde or lactone. Any acceptor except molecular oxygen is permitted. Includes EC 1.1.1.; EC 1.1.2.; and 1.1.99.Succinate Dehydrogenase: A flavoprotein containing oxidoreductase that catalyzes the dehydrogenation of SUCCINATE to fumarate. In most eukaryotic organisms this enzyme is a component of mitochondrial electron transport complex II.Smad6 Protein: An inhibitory Smad protein that negatively regulates the SIGNAL TRANSDUCTION PATHWAYS from BONE MORPHOGENETIC PROTEIN RECEPTORS. Smad6 inhibits PHOSPHORYLATION of SMAD2 PROTEIN and SMAD3 PROTEIN.L-Iditol 2-Dehydrogenase: An alcohol oxidoreductase which catalyzes the oxidation of L-iditol to L-sorbose in the presence of NAD. It also acts on D-glucitol to form D-fructose. It also acts on other closely related sugar alcohols to form the corresponding sugar. EC 1.1.1.14Metabolome: The dynamic collection of metabolites which represent a cell's or organism's net metabolic response to current conditions.Metabolomics: The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.3-Hydroxyacyl CoA Dehydrogenases: Enzymes that reversibly catalyze the oxidation of a 3-hydroxyacyl CoA to 3-ketoacyl CoA in the presence of NAD. They are key enzymes in the oxidation of fatty acids and in mitochondrial fatty acid synthesis.Enoyl-CoA Hydratase: An enzyme that catalyzes reversibly the hydration of unsaturated fatty acyl-CoA to yield beta-hydroxyacyl-CoA. It plays a role in the oxidation of fatty acids and in mitochondrial fatty acid synthesis, has broad specificity, and is most active with crotonyl-CoA. EC 4.2.1.17.Long-Chain-3-Hydroxyacyl-CoA Dehydrogenase: An NAD-dependent 3-hydroxyacyl CoA dehydrogenase that has specificity for acyl chains containing 8 and 10 carbons.Mitochondrial Trifunctional Protein: A mitochondrial protein consisting of four alpha-subunits and four beta-subunits. It contains enoyl-CoA hydratase, long-chain-3-hydroxyacyl-CoA dehydrogenase, and acetyl-CoA C-acyltransferase activities and plays an important role in the metabolism of long chain FATTY ACIDS.Peroxisomal Bifunctional Enzyme: A monomeric protein found in liver peroxisomes that contains two enzymatically active domains; an enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase domain, and an (S)-3-hydroxyacyl-CoA dehydrogenase domain. The enzyme is stereospecific with regards to how cis and trans double bonds are metabolized. It is complemented by PEROXISOMAL MULTIFUNCTIONAL PROTEIN-2, which has the opposite stereospecificity.11-beta-Hydroxysteroid Dehydrogenase Type 1: A low-affinity 11 beta-hydroxysteroid dehydrogenase found in a variety of tissues, most notably in LIVER; LUNG; ADIPOSE TISSUE; vascular tissue; OVARY; and the CENTRAL NERVOUS SYSTEM. The enzyme acts reversibly and can use either NAD or NADP as cofactors.11-beta-Hydroxysteroid Dehydrogenase Type 2: An high-affinity, NAD-dependent 11-beta-hydroxysteroid dehydrogenase that acts unidirectionally to catalyze the dehydrogenation of CORTISOL to CORTISONE. It is found predominantly in mineralocorticoid target tissues such as the KIDNEY; COLON; SWEAT GLANDS; and the PLACENTA. Absence of the enzyme leads to a fatal form of childhood hypertension termed, APPARENT MINERALOCORTICOID EXCESS SYNDROME.Cathepsin D: An intracellular proteinase found in a variety of tissue. It has specificity similar to but narrower than that of pepsin A. The enzyme is involved in catabolism of cartilage and connective tissue. EC 3.4.23.5. (Formerly EC 3.4.4.23).11-beta-Hydroxysteroid Dehydrogenases: Hydroxysteroid dehydrogenases that catalyzes the reversible conversion of CORTISOL to the inactive metabolite CORTISONE. Enzymes in this class can utilize either NAD or NADP as cofactors.17-Hydroxysteroid Dehydrogenases: A class of enzymes that catalyzes the oxidation of 17-hydroxysteroids to 17-ketosteroids. EC 1.1.-.Hydroxysteroid Dehydrogenases: Enzymes of the oxidoreductase class that catalyze the dehydrogenation of hydroxysteroids. (From Enzyme Nomenclature, 1992) EC 1.1.-.Cathepsins: A group of lysosomal proteinases or endopeptidases found in aqueous extracts of a variety of animal tissues. They function optimally within an acidic pH range. The cathepsins occur as a variety of enzyme subtypes including SERINE PROTEASES; ASPARTIC PROTEINASES; and CYSTEINE PROTEASES.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Antibody Specificity: The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.Antibodies, Monoclonal: Antibodies produced by a single clone of cells.Recombinant Proteins: Proteins prepared by recombinant DNA technology.3-Hydroxysteroid Dehydrogenases: Catalyze the oxidation of 3-hydroxysteroids to 3-ketosteroids.Androstenediol: An intermediate in TESTOSTERONE biosynthesis, found in the TESTIS or the ADRENAL GLANDS. Androstenediol, derived from DEHYDROEPIANDROSTERONE by the reduction of the 17-keto group (17-HYDROXYSTEROID DEHYDROGENASES), is converted to TESTOSTERONE by the oxidation of the 3-beta hydroxyl group to a 3-keto group (3-HYDROXYSTEROID DEHYDROGENASES).Encyclopedias as Topic: Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)Estranes: A group of compounds forming the nucleus of the estrogenic steroid family.Hydroxyestrones: Estrone derivatives substituted with one or more hydroxyl groups in any position. They are important metabolites of estrone and other estrogens.Estriol: A hydroxylated metabolite of ESTRADIOL or ESTRONE that has a hydroxyl group at C3, 16-alpha, and 17-beta position. Estriol is a major urinary estrogen. During PREGNANCY, a large amount of estriol is produced by the PLACENTA. Isomers with inversion of the hydroxyl group or groups are called epiestriol.Dendrobium: A plant genus of the family ORCHIDACEAE that contains dihydroayapin (COUMARINS) and phenanthraquinones.Aurora Kinases: A family of highly conserved serine-threonine kinases that are involved in the regulation of MITOSIS. They are involved in many aspects of cell division, including centrosome duplication, SPINDLE APPARATUS formation, chromosome alignment, attachment to the spindle, checkpoint activation, and CYTOKINESIS.Abstracting and Indexing as Topic: Activities performed to identify concepts and aspects of published information and research reports.Data Mining: Use of sophisticated analysis tools to sort through, organize, examine, and combine large sets of information.Aurora Kinase B: An aurora kinase that is a component of the chromosomal passenger protein complex and is involved in the regulation of MITOSIS. It mediates proper CHROMOSOME SEGREGATION and contractile ring function during CYTOKINESIS.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.
... as well as 17β-hydroxysteroid dehydrogenase type IV (17β-HSD type IV) is a protein that in humans is encoded by the HSD17B4 ... It was first identified as a 17-beta-estradiol dehydrogenase (Leenders et al., 1996; van Grunsven et al., 1998). Peroxisomal ... 1999). "17Beta-hydroxysteroid dehydrogenase type 1, 2, 3, and 4 expression and enzyme activity in human anterior pituitary ... D-bifunctional protein (DBP), also known as peroxisomal multifunctional enzyme type 2 (MFP-2), ...
Oestradiol) Dihydrolipoyl transacetylase, the second element of the multienzyme pyruvate dehydrogenase complex Acireductone ... E2, e2, E02, E.II, e² or E-2 may refer to: Ubiquitin-conjugating enzyme, a protein component of proteasome-mediated protein ... a type of visa which allows an individual to enter and work in the United States based on an investment he or she will be ... a type of organic reaction Honda E2, one of the predecessors of Honda's ASIMO robot Motorola ROKR E2, a smartphone Tungsten E2 ...
Then, 16α-OH-DHEA is converted by 3β-hydroxysteroid dehydrogenase type I (3β-HSD1) into 16α-hydroxyandrostenedione (16α-OH-A4) ... Estrone and estradiol are also produced in the placenta during pregnancy. However, in the case of estrone and estradiol, DHEA-S ... Estriol is poorly bound to sex hormone-binding globulin (SHBG), with much lower binding affinity for this protein, relative to ... Then, placental 17β-hydroxysteroid dehydrogenase interconverts estrone and estradiol and the two hormones are secreted into the ...
... dehydrogenase type 1 stimulates breast cancer by dihydrotestosterone inactivation in addition to estradiol production". ... "17β-Hydroxysteroid dehydrogenases (17β-HSDs) as therapeutic targets: protein structures, functions, and recent progress in ... Soubhye J, Alard IC, van Antwerpen P, Dufrasne F (2015). "Type 2 17-β hydroxysteroid dehydrogenase as a novel target for the ... Yang SY, He XY, Isaacs C, Dobkin C, Miller D, Philipp M (2014). "Roles of 17β-hydroxysteroid dehydrogenase type 10 in ...
... estradiols having inhibitory effect on human placental estradiol 17 beta-hydroxysteroid dehydrogenase (17 beta-HSD type 1)". ... Baker ME (May 1989). "Human placental 17 beta-hydroxysteroid dehydrogenase is homologous to NodG protein of Rhizobium meliloti ... Aka JA, Mazumdar M, Chen CQ, Poirier D, Lin SX (Apr 2010). "17beta-hydroxysteroid dehydrogenase type 1 stimulates breast cancer ... Human placental 17 -estradiol dehydrogenase". Biochemistry. 11 (14): 2699-703. doi:10.1021/bi00764a023. PMID 5045524. Murdock ...
... of estradiol biosynthesis: 17HSD type 1 and type 7". J Steroid Biochem Mol Biol. 69 (1-6): 431-9. doi:10.1016/S0960-0760(99) ... Ohnesorg T, Adamski J (2005). "Promoter analyses of human and mouse 17beta-hydroxysteroid dehydrogenase type 7". J. Steroid ... 2003). "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and ... "A single step procedure for purification of estradiol 17 beta-dehydrogenase from human placenta". Biochem. Biophys. Res. Commun ...
Fibroids are a type of uterine leiomyoma. Fibroids grossly appear as round, well circumscribed (but not encapsulated), solid ... Specific mutations of the MED12 protein have been noted in 70 percent of fibroids. The exact cause of fibroids is not clearly ... Aromatase and 17beta-hydroxysteroid dehydrogenase are aberrantly expressed in fibroids, indicating that fibroids can convert ... circulating androstenedione into estradiol. Similar mechanism of action has been elucidated in endometriosis and other ...
... danazol increases the ratio of free to plasma protein-bound testosterone, estradiol, progesterone, and cortisol.[5][6] The ... 3β-hydroxysteroid dehydrogenase/Δ5-4 isomerase, 17α-hydroxylase, 17,20-lyase, 17β-hydroxysteroid dehydrogenase, 21-hydroxylase ... Inhibition type. Estimated inhibition at 2 μM Cholesterol side-chain cleavage enzyme. 20 μM. Competitive. ? ... Occupation and downregulation of carrier proteins[edit]. Protein binding of testosterone in women[6] Group. Free. Albumin. SHBG ...
Moghrabi N, Head JR, Andersson S (Nov 1997). "Cell type-specific expression of 17 beta-hydroxysteroid dehydrogenase type 2 in ... "17β-Hydroxysteroid dehydrogenases (17β-HSDs) as therapeutic targets: protein structures, functions, and recent progress in ... plays its major role in the inactivation of potent steroid hormones oxidising estradiol and testosterone to estrone and ... Soubhye J, Alard IC, van Antwerpen P, Dufrasne F (2015). "Type 2 17-β hydroxysteroid dehydrogenase as a novel target for the ...
Estradiol 17-beta-dehydrogenase 11 is an enzyme that in humans is encoded by the HSD17B11 gene. GRCh38: Ensembl release 89: ... "17 beta-hydroxysteroid dehydrogenase type XI localizes to human steroidogenic cells". Endocrinology. 144 (5): 2084-91. doi: ... "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins ... "Entrez Gene: HSD17B11 hydroxysteroid (17-beta) dehydrogenase 11". Li KX, Smith RE, Krozowski ZS (1999). "Cloning and expression ...
11-beta-hydroxysteroid dehydrogenase type 1 MeSH D08.811.682.047.436.174.600 --- 11-beta-hydroxysteroid dehydrogenase type 2 ... type i MeSH D08.811.913.696.620.682.700.109.750 --- bone morphogenetic protein receptors, type ii MeSH D08.811.913.696.620.682. ... 17-hydroxysteroid dehydrogenases MeSH D08.811.682.047.436.375.280 --- estradiol dehydrogenases MeSH D08.811.682.047.436.400 ... myosin type iii MeSH D08.811.277.040.025.525.843 --- myosin type iv MeSH D08.811.277.040.025.525.875 --- myosin type v MeSH ...
Estradiol 17 beta-dehydrogenase 8 is an enzyme that in humans is encoded by the HSD17B8 gene. In mice, the Ke6 protein is a 17- ... 2007). "Transcriptional regulation of the human type 8 17beta-hydroxysteroid dehydrogenase gene by C/EBPbeta". J. Steroid ... The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An ... 2006). "Expression of aromatase and 17beta-hydroxysteroid dehydrogenase types 1, 7 and 12 in breast cancer. An ...
"KLF15 Is a transcriptional regulator of the human 17beta-hydroxysteroid dehydrogenase type 5 gene. A potential link between ... KKLF and MAZ proteins exhibited sequence-specific binding to the CLC-K1 GA element. MAZ had a strong activating effect on CLC- ... In rodents KLF15 appears to control the actions of estradiol and progesterone in the endometrium by inhibiting the production ... Krüppel-like factor 15 is a protein that in humans is encoded by the KLF15 gene in the Krüppel-like factor family. Its former ...
There are three types of myomectomy: *In a hysteroscopic myomectomy (also called transcervical resection), the fibroid can be ... Specific mutations of the MED12 protein have been noted in 70 percent of fibroids.[28] ... Aromatase and 17beta-hydroxysteroid dehydrogenase are aberrantly expressed in fibroids, indicating that fibroids can convert ... circulating androstenedione into estradiol.[32] Similar mechanism of action has been elucidated in endometriosis and other ...
Subsequently, 20α-hydroxysteroid dehydrogenase and 20β-hydroxysteroid dehydrogenase reduce these metabolites to form the ... The tendency for progesterone to have a regulatory effect, the presence of progesterone receptors in many types of body tissue ... Androstenedione can be converted to testosterone, estrone, and estradiol. Pregnenolone and progesterone can also be synthesized ... Progesterone binds extensively to plasma proteins, including albumin (50-54%) and transcortin (43-48%). It has similar affinity ...
Rare but serious adverse reactions of CPA include blood clots, liver damage, and certain types of benign brain tumors. CPA can ... In terms of plasma protein binding, CPA does not bind to sex hormone-binding globulin or transcortin and is instead bound ... The drug is marketed both alone and in combination with EE or estradiol valerate. Specific places in which CPA is marketed ... Stalvey JR (July 2002). "Inhibition of 3beta-hydroxysteroid dehydrogenase-isomerase in mouse adrenal cells: a direct effect of ...
Other names in common use include: 5α-Reductase 3-Oxosteroid Δ4-dehydrogenase 3-Oxo-5α-steroid Δ4-dehydrogenase Steroid Δ4-5α- ... In 5 alpha reductase type 2 deficient males, the type 1 isoenzyme is thought to be responsible for their virilization at ... an important step in N-glycosylation of proteins, which in turn is important for proper folding of asparagine residues on ... leading to increased testosterone and estradiol. Other enzymes compensate to a degree for the absent conversion, specifically ...
The three major naturally occurring forms of estrogen in women are estrone (E1), estradiol (E2), and estriol (E3). Another type ... estradiol is dehydrogenated by 17β-Hydroxysteroid dehydrogenase into the much less potent estrogen estrone. These reactions ... increase bone formation Protein synthesis Increase hepatic production of binding proteins Coagulation Increase circulating ... The three major naturally occurring estrogens in women are estrone (E1), estradiol (E2), and estriol (E3). Estradiol is the ...
Nakiterpiosin-type steroids are active against the signaling pathway involving the smoothened and hedgehog proteins, a pathway ... Examples include the dietary lipid cholesterol, the sex hormones estradiol and testosterone and the anti-inflammatory drug ... 5α-Reductase and 3α-Hydroxysteroid dehydrogenase. Steroids are primarily oxidized by cytochrome P450 oxidase enzymes, such as ... Estradiol, estrone and progesterone are made primarily in the ovary, estriol in placenta during pregnancy, and testosterone ...
5α-reductase type I and 3α-hydroxysteroid dehydrogenase are involved in the biosynthesis of inhibitory neurosteroids, while 3β- ... Benzodiazepines may influence neurosteroid metabolism by virtue of their actions on translocator protein (TSPO; "peripheral ... Certain other endogenous steroids, such as pregnenolone, progesterone, estradiol, and corticosterone are also neurosteroids. ... Melcangi RC, Celotti F, Martini L (March 1994). "Progesterone 5-alpha-reduction in neuronal and in different types of glial ...
The plasma protein binding of flutamide and hydroxyflutamide is high; 94 to 96% and 92 to 94%, respectively. Flutamide is ... However, it can have some indirect estrogenic effects via increased levels of estradiol secondary to AR blockade, and this ... succinate dehydrogenase), and V (ATP synthase), and thereby reduce cellular respiration via ATP depletion and hence decrease ... d037fb0c-881f-43d2-8693-aa1342d0130a&type=display Bentham Science Publishers (September 1999). Current Pharmaceutical Design. ...
Type I and type II errors - tyrosinase peptide - tyrosine kinase inhibitor - TZT-1027 ubiquinone - UCN-01 - UGT1A1 - ... lactate dehydrogenase - lactic acid dehydrogenase - LAK cell - lamina propria - lamivudine - lamotrigine - laparoscope - ... fusion protein G-CSF - gabapentin - Gail model - gallium nitrate - gallium scan - gamma irradiation - gamma knife - gamma ray ... estradiol - estramustine - estramustine phosphate - estrogen - estrogen receptor - estrogen receptor negative - estrogen ...
2003). "Mutations in the genes encoding 11β-hydroxysteroid dehydrogenase type 1 and hexose-6-phosphate dehydrogenase interact ... Kelly CJ, Stenton SR, Lashen H (2010). "Insulin-like growth factor binding protein-1 in PCOS: a systematic review and meta- ... Adipose tissue possesses aromatase, an enzyme that converts androstenedione to estrone and testosterone to estradiol. The ... Insulin resistance/Type II diabetes. A review published in 2010 concluded that women with PCOS have an elevated prevalence of ...
... type 3 MeSH D12.776.624.664.700.130 - muts homolog 2 protein MeSH D12.776.624.664.700.148 - myeloid-lymphoid leukemia protein ... estradiol MeSH D12.776.826.750.530.150 - receptors, aldosterone MeSH D12.776.827.275.700.500 - tacrolimus binding protein 1a ... nadh dehydrogenase MeSH D12.776.556.579.374.375.909 - electron transport complex ii MeSH D12.776.556.579.374.375.909.500 - ... myosin type iii MeSH D12.776.220.525.475.681 - myosin type iv MeSH D12.776.220.525.475.750 - myosin type v MeSH D12.776.220.525 ...
Mucolipidosis type 1 Mucolipidosis type 3 Mucolipidosis type 4 Mucopolysaccharidosis type 3 Mucopolysaccharidosis type 4 ... the upper lip Mediastinal endodermal sinus tumors Mediastinal syndrome Mediterranean fever Medium-chain Acyl-CoA dehydrogenase ... dystrophy Muscular fibrosis multifocal obstructed vessels Muscular phosphorylase kinase deficiency Mutations in estradiol ... Mitochondrial myopathy-encephalopathy-lactic acidosis Mitochondrial PEPCK deficiency Mitochondrial trifunctional protein ...
Mutations in the genes encoding 11β-hydroxysteroid dehydrogenase type 1 and hexose-6-phosphate dehydrogenase interact to cause ... Kelly CJ, Stenton SR, Lashen H. Insulin-like growth factor binding protein-1 in PCOS: a systematic review and meta-analysis. ... an enzyme that converts androstenedione to estrone and testosterone to estradiol. The excess of adipose tissue in obese women ... Impaired glucose tolerance, type 2 diabetes and metabolic syndrome in polycystic ovary syndrome: a systematic review and meta- ...
16α-OH-DHEA is converted by 3β-hydroxysteroid dehydrogenase type I (3β-HSD1) into 16α-hydroxyandrostenedione (16α-OH-A4) and 16 ... Estrone and estradiol are also produced in the placenta during pregnancy.[3] However, in the case of estrone and estradiol, ... Estriol is poorly bound to sex hormone-binding globulin (SHBG),[20] with much lower binding affinity for this protein, relative ... estradiol acts as an agonist.[8][6][13] Estradiol increases breast cancer cell growth via activation of the GPER (in addition ...
... as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH. ... Estradiol 17-beta-dehydrogenase 2 (EC:1.1.1.62). Alternative name(s):. 17-beta-hydroxysteroid dehydrogenase type 2. Short name ... Experimental evidence at protein leveli ,p>This indicates the type of evidence that supports the existence of the protein. Note ... estradiol 17-beta-dehydrogenase activity Source: UniProtKB ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a direct assay ...
Human Type I 17Beta-Hydroxysteroid Dehydrogenase: Site Directed Mutagenesis and X-Ray Crystallography Structure-Function ... HUMAN 17-BETA-HYDROXYSTEROID-DEHYDROGENASE TYPE 1 C-TERMINAL DELETION MUTANT COMPLEXED WITH ESTRADIOL AND NADP+. ... 17-BETA-HYDROXYSTEROID-DEHYDROGENASE protein, length: 289 (BLAST) Sequence Similarity Cutoff. Rank. Chains in Cluster. Cluster ... This allows for the easy identification of regions and types of structural flexibility present in a protein of interest. ...
Effects of cortisol and oestradiol on hepatic 11beta-hydroxysteroid dehydrogenase type 1 and glucocorticoid receptor proteins ...
cholate 7-alpha-dehydrogenase activity. estradiol 17-beta-dehydrogenase activity. steroid binding. ... Showing Protein 3-hydroxyacyl-CoA dehydrogenase type-2 (HMDBP00379). IdentificationBiological propertiesGene propertiesProtein ... Protein Sequence. ,3-hydroxyacyl-CoA dehydrogenase type-2 MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF ... A human brain L-3-hydroxyacyl-coenzyme A dehydrogenase is identical to an amyloid beta-peptide-binding protein involved in ...
... is a steroid-converting enzyme that has long been known to play critical roles in estradiol synthesis and more recently in ... 17β-HSD1 regulates the expression of important genes and proteins that are relevant to cell growth control, such as BRCA2 and ... Proteomic data demonstrate that the expression of more than 59 proteins is modulated following 17β-HSD1 overexpression. ... and the protein expression of the metastasis suppressor gene nm23-H1 and the expression of the two enzymes are closely ...
17-beta-hydroxysteroid dehydrogenase 7; 17 beta-hydroxysteroid dehydrogenase type VII; short chain dehydrogenase/reductase ... Products > Immunology Proteins > Cytokines and Growth Factors Proteins > Growth Factor & Receptor Proteins > Hormones Proteins ... short chain dehydrogenase/reductase family 37C; member 1; 17-beta-HSD 7; estradiol 17-beta-dehydrogenase 7; 17beta ... 3-keto sterol reductase activity; estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity; ...
Lipid biosynthesis proteins [BR:ko01004]. Fatty acid synthase. Component type. K10251 HSD17B12, KAR, IFA38; 17beta-estradiol 17 ... 1.1.1.62 17beta-estradiol 17-dehydrogenase. K10251 HSD17B12, KAR, IFA38; 17beta-estradiol 17-dehydrogenase / very-long-chain 3- ... Characterization of type 12 17beta-hydroxysteroid dehydrogenase, an isoform of type 3 17beta-hydroxysteroid dehydrogenase ... 01004 Lipid biosynthesis proteins. K10251 HSD17B12, KAR, IFA38; 17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl- ...
Ab132794 is a full length protein produced in Wheat germ and has been validated in WB, ELISA, SDS-PAGE. Abcam provides free ... 17 beta hydroxysteroid dehydrogenase 7. *17 beta hydroxysteroid dehydrogenase type VII. *17-beta-HSD 7 ... Estradiol 17 beta dehydrogenase 7. *Estradiol 17-beta-dehydrogenase 7. *Hsd17b7. *Hydroxysteroid (17 beta) dehydrogenase 7 ... By product type. Proteins and Peptides. Proteomics tools. Agonists, activators, antagonists and inhibitors. Lysates. Multiplex ...
Dehydrogenase 4 antibody validated for WB and tested in Human. Immunogen corresponding to recombinant fragment ... 17beta estradiol dehydrogenase type IV antibody. *3 alpha 7 alpha12 alpha trihydroxy 5 beta cholest 24 enoyl CoA hydratase ... By product type. Proteins and Peptides. Proteomics tools. Agonists, activators, antagonists and inhibitors. Lysates. Multiplex ... D bifunctional protein peroxisomal antibody. *D-3-hydroxyacyl CoA dehydratase/D-3-hydroxyacyl-CoA dehydrogenase bifunctional ...
... dehydrogenase type 1 stimulates breast cancer by dihydrotestosterone inactivation in addition to estradiol production". ... "17β-Hydroxysteroid dehydrogenases (17β-HSDs) as therapeutic targets: protein structures, functions, and recent progress in ... Soubhye J, Alard IC, van Antwerpen P, Dufrasne F (2015). "Type 2 17-β hydroxysteroid dehydrogenase as a novel target for the ... Yang SY, He XY, Isaacs C, Dobkin C, Miller D, Philipp M (2014). "Roles of 17β-hydroxysteroid dehydrogenase type 10 in ...
The HSD17B4 gene provides instructions for making the D-bifunctional protein. Learn about this gene and related health ... 17-beta-hydroxysteroid dehydrogenase 4. *17beta-estradiol dehydrogenase type IV. *3-alpha,7-alpha,12-alpha-trihydroxy-5-beta- ... The protein has two separate regions (domains) with enzyme activity, called the hydratase and dehydrogenase domains. These ... This protein is an enzyme, which means that it helps specific biochemical reactions take place. D-bifunctional protein is so ...
D-bifunctional protein, peroxisomal; 17-beta-hydroxysteroid dehydrogenase 4; 17beta-estradiol dehydrogenase type IV; short ... 17 beta hydroxysteroid dehydrogenase 4; 17beta estradiol dehydrogenase type IV; beta hydroxyacyl dehydrogenase; beta keto ... Products > Immunology Proteins > Cytokines and Growth Factors Proteins > Growth Factor & Receptor Proteins > Hormones Proteins ... HSD17B4; hydroxysteroid (17-beta) dehydrogenase 4; peroxisomal multifunctional enzyme type 2; 3 alpha; 7 alpha; 12 alpha ...
Our laboratory has previously cloned and purified an ovarian protein found to be a novel 17β-hydroxysteroid dehydrogenase type ... The stimulation of HSD17B7 expression by estradiol provides a powerful feed-forward mechanism for estradiol biosynthesis in ... protein expression, and promoter activity in MCF-7 cells. The effect of estradiol is mediated by estrogen receptor (ER)α, ... site that is essential for estradiol action. We found that estradiol stimulates the recruitment and DNA binding of NF1 to this ...
Estradiol Derivatives as Inhibitors of 17β-Hydroxysteroid Dehydrogenase Type 1. Medicinal Chemistry ... antigens involved in autoimmune response in breast cancer are modified self-proteins or over-expressed normal proteins that ... antigens involved in autoimmune response in breast cancer are modified self-proteins or over-expressed normal proteins that ... Protein & Peptide Letters. * In Vitro and In Vivo Evaluation of [99mTc(CO)3]-Radiolabeled ErbB-2-Targeting Peptides for Breast ...
Oestradiol) Dihydrolipoyl transacetylase, the second element of the multienzyme pyruvate dehydrogenase complex Acireductone ... E2, e2, E02, E.II, e² or E-2 may refer to: Ubiquitin-conjugating enzyme, a protein component of proteasome-mediated protein ... a type of visa which allows an individual to enter and work in the United States based on an investment he or she will be ... a type of organic reaction Honda E2, one of the predecessors of Hondas ASIMO robot Motorola ROKR E2, a smartphone Tungsten E2 ...
... as well as 17β-hydroxysteroid dehydrogenase type IV (17β-HSD type IV) is a protein that in humans is encoded by the HSD17B4 ... It was first identified as a 17-beta-estradiol dehydrogenase (Leenders et al., 1996; van Grunsven et al., 1998). Peroxisomal ... 1999). "17Beta-hydroxysteroid dehydrogenase type 1, 2, 3, and 4 expression and enzyme activity in human anterior pituitary ... D-bifunctional protein (DBP), also known as peroxisomal multifunctional enzyme type 2 (MFP-2), ...
Chicken 17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6) ELISA Kit-NP_003716.2 (MBS7235953) product datasheet at ... UniProt Protein Name 17-beta-hydroxysteroid dehydrogenase type 6 UniProt Synonym Protein Names 3-alpha->beta-hydroxysteroid ... Molecular Function: estradiol 17-beta-dehydrogenase activity; electron carrier activity; oxidoreductase activity; catalytic ... NCBI Protein Information 17-beta-hydroxysteroid dehydrogenase type 6; 17-beta-HSD 6; oxidoreductase; 3-alpha-,beta-HSE; retinol ...
PRL receptor associated protein, testicular 17-beta-hydroxysteroid dehydrogenase, type 1 17beta-HSD, type 1 17beta- ... type 12 17beta-HSD, type 12 17beta-hydroxysteroid dehydrogenase, type 7 17beta-hydroxysteroid dehydrogenase, type 8 17beta-HSD ... 17beta-HSD type 1, 17beta-HSD type 12, 17beta-HSD type 2, 17beta-HSD type 4, 17beta-HSD type 5, 17beta-HSD type 7, 17beta-HSD ... dehydrogenase, estradiol 17beta-, E2DH, EDH, estradiol 17beta-dehydrogenase, estradiol dehydrogenase, estrogen 17- ...
Browse our HSD17B1 partial proteins and recombinant proteins backed by our 100% Guarantee. ... Highly purified HSD17B1 partial proteins and recombinant proteins. ... E2DH protein, EC 1.1.1.62 protein, EDH17B1 protein, EDH17B2EDHB17 protein, estradiol 17-beta-dehydrogenase 1 protein, estradiol ... 17 beta-HSD1/HSD17B1 protein, HSD17B1 protein, 17-beta-HSD 1 protein, 17-beta-hydroxysteroid dehydrogenase type 1 protein, 20 ...
hydroxysteroid (17-beta) dehydrogenase 2. estradiol 17-beta-dehydrogenase activity, oxidoreductase activity. ... protein kinase; AMP-activated; alpha 1 catalytic subunit. ATP binding, cAMP-dependent protein kinase activity, kinase activity ... 17Beta-hydroxysteroid dehydrogenase Type 1 and Type 2: association between mRNA expression and activity in cell lines. Mol Cell ... Expression of 17beta-hydroxysteroid dehydrogenase type 2 and type 5 in breast cancer and adjacent non-malignant tissue: a ...
"Estradiol Protects Proopiomelanocortin Neurons Against Insulin Resistance, Endocrinology" on DeepDyve, the largest online ... 17β-estradiol EGFP enhanced green fluorescent protein ER endoplasmic reticulum GAPDH glyceraldehyde 3-phosphate dehydrogenase ... 17β-estradiol regulation of the mRNA expression of T-type calcium channel subunits: role of estrogen receptor α and estrogen ... 17β-estradiol regulation of the mRNA expression of T-type calcium channel subunits: role of estrogen receptor α and estrogen ...
... interaction of RA receptors with specificity protein (SP) 1/SP3 for estradiol metabolism. J Clin Endocrinol Metab 93:1915-1923 ... regulates 17beta-hydroxysteroid dehydrogenase type 2 expression in endometrium: ... Lobule type. The impact of lobule type on estrogen levels has not been investigated yet. Average levels of E1-S in GLT ... 2). In the following linear regression models, lobule type was tested as categorial exVAR. Relationship of lobule type with ...
estradiol 17-beta-dehydrogenase 11. Names. 17-beta-hydroxysteroid dehydrogenase type XI. CTCL tumor antigen HD-CL-03. CTCL- ... mRNA and Protein(s) * XM_011532021.1 → XP_011530323.1 estradiol 17-beta-dehydrogenase 11 isoform X1 ... mRNA and Protein(s) * NM_016245.5 → NP_057329.3 estradiol 17-beta-dehydrogenase 11 precursor ... dehydrogenase/reductase SDR family member 8. retinal short-chain dehydrogenase/reductase 2. short chain dehydrogenase/reductase ...
With respect to wild-type, recombinant C. parapsilosis/pCP-RCR exhibited over four-fold higher activity for catalyzing racemic ... reported increased expression of type I 17β-hydroxysteroid dehydrogenase enhances in situ production of estradiol in uterine ... A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein dye ... Increased expression of type I 17beta-hydroxysteroid dehydrogenase enhances in situ production of estradiol in uterine ...
  • In addition to acting as an agonist of the nuclear ERs, estriol also acts as an antagonist of the GPER at high concentrations, a membrane estrogen receptor where, conversely, estradiol acts as an agonist. (wikipedia.org)
  • 17β-HSD1 regulates the expression of important genes and proteins that are relevant to cell growth control, such as BRCA2 and CDKN1A interacting protein (BCCIP) and proliferating cell nuclear antigen (PCNA) which are down- and upregulated in MCF7-17βHSD1 cells, respectively. (biomedcentral.com)
  • SNP variants in the 17beta- HSD2 (zeige HSD11B2 Antikörper ) and 17beta-HSD7 genes and 17beta-HSD7 copy number is associated with increased estradiol levels in breast cancer tissues. (antikoerper-online.de)
  • In order to examine the effect of vitamin D3 on the ovarian granulosa cells, the mRNA and protein levels of genes were analyzed by real-time PCR and Western blot assay. (toxicolres.org)
  • Structural cytoskeletal proteins were also strongly represented among the genes upregulated in only cold-acclimated crabs. (biologists.org)
  • Since insulin resistance was largely localised in the liver, we analysed genome-wide expression profiles in female ERKO and wild-type mouse livers, using high-density oligonucleotide microarrays representing ∼20,000 genes to investigate the possible molecular mechanisms underlying the observed phenotypes. (springer.com)
  • Peptide Sequence: human serine palmitoyltransferase subunit SPT2 amino acids 548-562 To be used in conjunction with Cayman's SPT polyclonal antibody (Catalog No. 10005260) to block protein-antibody complex formation during analysis for SPT. (thomassci.com)
  • Peptide Sequence: human GPR40 amino acids 210-222 To be used in conjunction with Cayman's GPR40 polyclonal antibody (Catalog No. 10007605) to block protein-antibody complex formation during immunochemical analysis of GPR40. (thomassci.com)
  • The D-bifunctional protein is involved in the breakdown of certain molecules called fatty acids. (medlineplus.gov)
  • The D-bifunctional protein catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids and also acts in shortening cholesterol for bile acid formation. (wikipedia.org)
  • The increasing prevalence of obesity, resulting in increased cardiometabolic risk and precipitating illness such as cardiovascular disease, type 2 diabetes, fatty liver, cirrhosis, and certain types of cancer, constitutes a good example of this association. (hindawi.com)
  • The epidemic increase in obesity has been paralleled by the rise in cardiovascular disease, type 2 diabetes, fatty liver, cirrhosis, asthma, neurodegenerative diseases, and certain types of cancer [ 1 , 2 ] and subsequently linked to reduced life expectancy and premature death [ 3 ]. (hindawi.com)
  • Through a similar mechanism, the HSD10 protein also processes a group of fats called branched-chain fatty acids. (medlineplus.gov)
  • The uncoupling of the insulin receptor from its downstream effector system was corroborated by the reduced expression of phosphorylated protein kinase B in the arcuate nucleus of male but not female guinea pigs following insulin. (deepdyve.com)
  • Nevertheless homozygous and heterozygous mutants of 4 SNPs - rs6165 (genotype GG+GA 307 of and rs700519 (genotype TT+TC 264 of the phosphorylated site by proteins kinase B and 289Ser of the phosphorylated site by proteins kinase B or ribosomal proteins S6 kinase 1. (exposed-skin-care.net)
  • To examine the role of cAMP in mediating granulosa cell P450scc mRNA accumulation, granulosa cells were treated with forskolin, cholera toxin, 8-bromo-cAMP, 8-bromo-cGMP, 5′AMP, or cAMP analogs that differentially stimulate the two isoenzymes of protein kinase-A. Increased specific P450scc mRNA accumulation and progesterone production occurred in response to each agent except 5′AMP and 8-bromo-cGMP. (elsevier.com)
  • At the nonpermissive temperature, cessation of large T antigen expression was accompanied by induction of p53, as well as the p53-dependent proteins, wild-type p53-activated fragment-1/Cdk (cyclin-dependent kinase)-interacting protein-1 (p21/Waf1), Bcl (B-cell lymphoma)-associated protein (Bax), and murine double minute 2 (MDM2), that lead to cell cycle-arrest, suicide, and p53 inhibition, respectively. (jneurosci.org)
  • In summary, our findings demonstrate that estradiol stimulates HSD17B7 transcriptional activity in breast cancer cells through a novel mechanism requiring NF1 and strongly suggest a positive feedback mechanism to increase local estradiol synthesis causing growth of estrogen-dependent breast cancers. (sigmaaldrich.com)
  • ABA regulates seed maturation, promotes seed dormancy and desiccation tolerance and the synthesis of seed storage proteins and lipids, and inhibits phase transitions from embryonic growth to germination and from vegetative to reproductive growth. (plantphysiol.org)
  • The HSD10 protein is important for the production (synthesis) of proteins in mitochondria. (medlineplus.gov)
  • While most protein synthesis occurs in the fluid surrounding the nucleus, called the cytoplasm, a few proteins are synthesized in the mitochondria. (medlineplus.gov)
  • During protein synthesis, whether in the cytoplasm or in mitochondria, molecules called transfer RNAs (tRNAs) help assemble protein building blocks (amino acids) into the chains that form proteins. (medlineplus.gov)
  • Prostaglandin E2 may also be an important regulator of estradiol activity in breast tumors while invading macrophages and lymphocytes may also stimulate estrogen synthesis in breast cancers. (atlasgeneticsoncology.org)
  • Interestingly, 17β-HSD1 increases the mRNA transcript (by 3.6 times) and the protein expression of the metastasis suppressor gene nm23-H1 and the expression of the two enzymes are closely correlated. (biomedcentral.com)
  • The D-bifunctional protein is found in sac-like cell structures (organelles) called peroxisomes, which contain a variety of enzymes that break down many different substances. (medlineplus.gov)
  • Upon topical application of the East Indian sandalwood oil (EISO) cream to an affected area of skin, the active ingredients in the cream may suppress various enzymes, such as cyclooxygenase (COX) and cyclic adenosine monophosphate (cAMP) phosphodiesterases (PDEs), prevent the production of pro-inflammatory cytokines and chemokines and directly cause apoptosis in susceptible cell types, including certain cancer cells and virally-infected cells. (cancer.gov)
  • We investigated the role of retinoic acid (RA) production by aldehyde dehydrogenase 1 (Aldh1a1, -a2, and -a3), the major RA-producing enzymes, on sex-specific fat depot formation. (diabetesjournals.org)
  • Appropriate sample types may include undiluted body fluids and/or tissue homogenates, secretions such as Serum, plasma, Cell Culture Supernatants, body fluid and tissue homogenate. (mybiosource.com)
  • AIMS: To correlate differences in estradiol levels in serum and follicular fluid with genetic variants and to determine if they play a role in the results following assisted reproductive technology (ART). (bvsalud.org)
  • Genotypes of selected variants of CYP19A1, CYP17A1, HSD17, and COMT were compared to the estradiol measurements from follicular fluid and serum, as well as to the number and maturation status of the oocytes retrieved. (bvsalud.org)
  • RESULTS: Patients with the variant homozygous genotype AA of CYP19A1 (rs10046) showed increased serum concentrations of estradiol when compared to patients with other genotypes (p = 0.005). (bvsalud.org)
  • ER antagonists, ICI 182,780 and 4-hydroxytamoxifen, prevent estradiol-induced stimulation of the endogenously expressed HSD17B7, suggesting that these inhibitors not only block estradiol action but also its production. (sigmaaldrich.com)
  • We have identified a -185-bp region of the hsd17b7 promoter that is highly conserved among rat, mouse, and human and confers regulation by estradiol in MCF-7 cells. (sigmaaldrich.com)
  • We found that estradiol stimulates the recruitment and DNA binding of NF1 to this region of the hsd17b7 promoter. (sigmaaldrich.com)
  • 17β-HSD1 was stably transfected in MCF7 cells and the proteome of the generated cells overexpressing 17β-HSD1 (MCF7-17βHSD1 cells) was compared to that of the wild type MCF7 cells. (biomedcentral.com)
  • Transcriptional regulation of type 11 17β-hydroxysteroid dehydrogenase expression in prostate cancer cells. (nih.gov)
  • The invention provides methods of identifying proteins and polypeptides and their cognate polynucleotides that are expressed by cells under one environmental condition and not under a second environmental condition. (patentsencyclopedia.com)
  • RA mediates induction of 17 beta-hydroxysteroid dehydrogenase type 2 mRNA, catalyzing the conversion of estradiol to estrone, in endometrium but not endometriosis because of a defect in endometriotic stromal cells. (endometriosi.it)
  • Two dimensional protein analysis and mass spectrometry were applied to identify proteins induced by tamoxifen in tamoxifen-sensitive T47D cells. (openthesis.org)
  • These proteins could serve as markers for tamoxifen sensitivity in breast cancer cells. (openthesis.org)
  • Furthermore, the product of oestradiol oxidation, oestrone, was identified in intact cells transfected with a construct plasmid encoding the DHRS10 protein. (ox.ac.uk)
  • Treatment of granulosa cells with estradiol and FSH produced a synergistic increase in progesterone concentrations, but did not affect FSH-stimulated P450scc mRNA accumulation. (elsevier.com)
  • MCF-7 cells were obtained from the American Type Culture Collection and cultured as directed. (aacrjournals.org)
  • Sexual dimorphism in visceral fat (VF) was attributable to elevated adipose triglyceride lipase (Atgl) protein expression localized in clusters of multilocular uncoupling protein 1 (Ucp1)-positive cells in female Aldh1a1 −/− mice compared with males. (diabetesjournals.org)
  • The effects of three different doses of estrone (0.1, 0.5, and 2.5 µg/kg/day) on tumor growth in T47D-17ß-HSD1-inoculated group were investigated and compared with the animals inoculated with wild type T47D cells. (bvsalud.org)
  • Other mutations do not reduce the amount of HSD10 protein in cells, but impair its function in other ways. (medlineplus.gov)
  • Although IL6 necessary to support growth of multiple myeloma cells, and is upregulated in certain tumor types, notably lung (squamous), bladder and prostate carcinomas, no recurrent chromosome rearrangements at 7p21 or IL6 rearrangements have been observed in these neoplasms. (atlasgeneticsoncology.org)
  • cytosolic 17β-HSOR (type I), a single protein band with a relative molecular mass of approximately 34 kDa was demonstrated by Western analysis in both human luteinized granulosa cells and placental tissue. (elsevier.com)
  • In human ovary, immunoreactive type I 17β-HSOR was localized exclusively in granulosa cells of developing follicles, ranging from primary follicles with a single layer of cuboidal-shaped granulosa cells, preantral follicles with multiple layers of granulosa cells, and large antral follicles. (elsevier.com)
  • In the corpus luteum, type I 17β-HSOR immunoreactivity was localized solely in granulosa-lutein cells. (elsevier.com)
  • This study serves to demonstrate that in the human ovary, type I 17β-HSOR is compartmentalized in granulosa cells of the developing follicles and granulosa-lutein cells. (elsevier.com)
  • T production by αERKO Leydig cells was 2-fold higher than that in wild-type (WT) cells. (popcouncil.org)
  • Knockdown of the Txnip gene raised the levels of anti-apoptotic proteins HO-1 and Bcl-2 and geniposide potentiated the effect of Txnip when the INS-1 cells were challenged HG/PA. (atgcchecker.com)
  • Furthermore, geniposide enhanced the adoptive unfolded protein response by increasing the phosphorylation of PERK/eIF2α and IRE1α in HG/PA-treated INS-1 cells. (atgcchecker.com)
  • 4577-4588, 1998) that ectopic expression of Id-1 inhibits differentiation and stimulates the proliferation and invasiveness of mouse mammary epithelial cells, and that there is a correlation between the levels of Id-1 protein and the aggressiveness of several human breast cancer cell lines. (aacrjournals.org)
  • The interstitium consists of loose connective tissue, blood and lymphatic vessels, and various cell types, including Leydig cells, fibroblasts, macrophages and leukocytes. (biomedcentral.com)
  • Estradiol enters target cells freely (e.g., female organs, breasts, hypothalamus, pituitary) and interacts with a target cell receptor. (drugbank.com)
  • These systems have evolved in close relationship, sharing cellular machinery, being activated by many common hormones, cytokines, signaling proteins, transcription factors, and bioactive lipids and regulating each other. (hindawi.com)
  • Compared with the controls, higher steady state mRNA levels for steroidogenic acute regulatory protein and P450_17α were also measured in the testis of ICI 182,780-treated mice. (popcouncil.org)
  • 1. A method of detecting cancer or a predisposition to developing cancer in a subject, comprising determining an expression level of a cancer-associated protein, polypeptide or polynucleotide selected from the group consisting of myeloblastin precursor (e.g. (patentsencyclopedia.com)